Degenerin unc-8

Overview
NameDegenerin unc-8
Smed IDSMED30002740
Length (bp)1916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Degenerin unc-8 (SMED30002740) t-SNE clustered cells

Violin plots show distribution of expression levels for Degenerin unc-8 (SMED30002740) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Degenerin unc-8 (SMED30002740) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Degenerin unc-8 (SMED30002740) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002740

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30002740SMESG000022994.1 dd_Smed_v4_18730_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 60.4622 bits (145), Expect = 3.590e-9
Identity = 49/218 (22.48%), Postives = 92/218 (42.20%), Query Frame = 3
Query:  960 EDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTKFETEYTKS 1613
            E C +  +QK+ V  C C  P  P+ +   +  K C   ++  +E + +    +  ++   KE    D      C  ++P  C E  Y+       W    ++        F+                 +++ R + AM+ I       +  +E   Y ++ +++D+GGL GLW+G SVV + EIV  I +   Q    ++K + L+T  ++  T+S
Sbjct:  599 EACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPD------CYCHQP--CQETNYEVTYSSARWPSGSAKVMECLPGDFL----------------CLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI-VFATQAYVRKRKGVSLNTLHKSSTTQS 791          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 58.151 bits (139), Expect = 1.850e-8
Identity = 46/210 (21.90%), Postives = 86/210 (40.95%), Query Frame = 3
Query:  960 EDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTK 1589
            E C +  +QK+ V  C C  P  P+ +   +  K C   ++  +E + +    +  ++   KE    D      C  ++P  C E  Y+       W    ++        F+                 +++ R + AM+ I       +  +E   Y ++ +++D+GGL GLW+G SVV + EIV  I  +     + RK+   +S +
Sbjct:  493 EACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPD------CYCHQP--CQETNYEVTYSSARWPSGSAKVMECLPGDFL----------------CLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSISAQ 676          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 58.151 bits (139), Expect = 1.850e-8
Identity = 46/210 (21.90%), Postives = 86/210 (40.95%), Query Frame = 3
Query:  960 EDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTK 1589
            E C +  +QK+ V  C C  P  P+ +   +  K C   ++  +E + +    +  ++   KE    D      C  ++P  C E  Y+       W    ++        F+                 +++ R + AM+ I       +  +E   Y ++ +++D+GGL GLW+G SVV + EIV  I  +     + RK+   +S +
Sbjct:  493 EACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPD------CYCHQP--CQETNYEVTYSSARWPSGSAKVMECLPGDFL----------------CLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSISAQ 676          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 57.7658 bits (138), Expect = 1.898e-8
Identity = 46/210 (21.90%), Postives = 86/210 (40.95%), Query Frame = 3
Query:  960 EDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTK 1589
            E C +  +QK+ V  C C  P  P+ +   +  K C   ++  +E + +    +  ++   KE    D      C  ++P  C E  Y+       W    ++        F+                 +++ R + AM+ I       +  +E   Y ++ +++D+GGL GLW+G SVV + EIV  I  +     + RK+   +S +
Sbjct:  513 EACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPD------CYCHQP--CQETNYEVTYSSARWPSGSAKVMECLPGDFL----------------CLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSISAQ 696          
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 57.7658 bits (138), Expect = 1.898e-8
Identity = 46/210 (21.90%), Postives = 86/210 (40.95%), Query Frame = 3
Query:  960 EDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTK 1589
            E C +  +QK+ V  C C  P  P+ +   +  K C   ++  +E + +    +  ++   KE    D      C  ++P  C E  Y+       W    ++        F+                 +++ R + AM+ I       +  +E   Y ++ +++D+GGL GLW+G SVV + EIV  I  +     + RK+   +S +
Sbjct:  513 EACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGELYSKGKEAIIPD------CYCHQP--CQETNYEVTYSSARWPSGSAKVMECLPGDFL----------------CLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLI--VFATQAYVRKRKGSISAQ 696          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: S5W2R2 (Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 8.527e-148
Identity = 229/493 (46.45%), Postives = 344/493 (69.78%), Query Frame = 3
Query:   54 LLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIY 1532
            L++ STIHG+ H+++A ++I K+LW  LFL+G      N+VFI  ++LSNP++IS+  ++EPF+WPD+TFCNPT P+    ++  + HW  TL K+K V   +A ++ + ++I      D ELEE T+ MS+ADP KL +  F++ +   GY   H G+Y  KE+ +S T+++  D K  F++Q VQ+RNNIPCHTF +DKS+ +K+  + S++F  + N  SY IFNSSY F+S+FLYI+N + +PQ +E+++ PG+NN + + Q R+ ++  +R CRNE ++ ELYD+LL ST  + G ++DC+KI SQ+ YV  C CY+ FLPI+K+   FP+LCLN SIF++ ++L NA CM++ F  Y E  +  +     C  Y+P+ CN+V+YK D RKE+ ++LWS++ NDRRR  I+  Y   F  +  + DFV++++D++  L+I R ++ GD YKEE EYP SEL+SDVGGLMGLWLGLSV+G+FEIVEF+Y
Sbjct:    4 LIQSSTIHGIGHIFSATNKIFKVLWCILFLVGVIAIIVNIVFISMKFLSNPVIISYTFEHEPFIWPDITFCNPTDPYAFTINSQPYLHWIETLNKTKRVAGKVARQTSMSQLIHSRRENDYELEERTIAMSSADPAKLQATAFQNYLYRIGYIKAHKGLYFSKEFQSSSTKLNE-DWKSLFTSQIVQMRNNIPCHTFHLDKSRIVKQKFIKSLLFRFKLNEESYKIFNSSYTFQSMFLYISNKDEIPQSNEIILTPGYNNVVQLTQNRHSYTGLRRTCRNEKFEAELYDSLLQSTEKYSGSYDDCKKIVSQQKYVKYCNCYNSFLPIFKNSSGFPRLCLNASIFSEAEVLKNAKCMINTFRKYAESDKARRRFYNRCKMYRPIPCNKVLYKIDHRKEILVDLWSKSTNDRRREIIKTLYLKTFQTNETSLDFVEKVKDNIMQLIINRDNESGDLYKEEREYPFSELLSDVGGLMGLWLGLSVIGLFEIVEFVY 495          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A5J4NUF1 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0013022 PE=3 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 6.267e-92
Identity = 188/521 (36.08%), Postives = 289/521 (55.47%), Query Frame = 3
Query:   54 LLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKT-LKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFL--PIYKDEKHFPK---LCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVE-CNKYKPVKCNEVVYK-TDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRD--------WKNRD--------------FVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEF 1526
            LL+HST+HGL+HV TA +++ +I W  L L G  GFF NL FI+ RYL+ P+L S+  + E F+WPD+T CN  AP+ LH  +     W+    ++    + L   S LF  I   +   NE+    +  ST  P +    + +  + F      + G+ L  E S + T ++   LK++F TQ +Q R N+PC+T Q+  S T ++   +NS+   ++FN  SY I NSSY    I L+I++    P  D + +LPG+   +++R +R      +  CR + Y  E++D  L +     G    C +I SQ LY+N C CYSPFL  P+  + K F K   LC N S F+  QI  NA+CM+ ++E Y+    ++ + E   C +++   C++V YK +D R+   +ELWS ++N+ R  F+  ++Q LF+ D        W + D               +K MRD+  +L + R S+ G+  +EE EYP+SEL+SDVGGLMGLW+G+SV+G+FEIVE 
Sbjct:   30 LLEHSTVHGLSHVSTAATKLGRITWFCLLLAGIAGFFTNLSFIIDRYLTRPVLTSYISEYEGFIWPDITLCNAMAPYSLHL-HGRIPKWQALRNQASAFAQKL--NSSLFASID--SQDQNEIAIQALMYSTLSPPEYGVGEPEEFIQFVATDVGYQGIILTVEISGNMTHLNP-PLKKYFHTQVLQKRYNVPCYTLQLRHSLTAVQSNQVNSIGLGVKFNVESYRIINSSYASPYIDLFISHPGHAPHDDPIEMLPGYTLSLSLRMSRLRREPARLSCRTDFYTTEVFDPDLVTKRRVNGSATFCHRIVSQHLYLNSCHCYSPFLPYPVVYNHKLFSKMAILCFNMSRFSVAQINRNADCMLRIYERYQLSSVYNSVPEARACEQFRKPLCDDVEYKLSDIRRTAMVELWSNSYNEARIAFLTSSFQNLFSSDIPPEQLVSWLDSDTKDDNTKDNDSMPKILKYMRDNFGLLSVNRKSELGELVREELEYPLSELMSDVGGLMGLWIGISVIGLFEIVEL 544          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A183A5V1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2336 PE=3 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.451e-88
Identity = 181/532 (34.02%), Postives = 292/532 (54.89%), Query Frame = 3
Query:   27 EKYNKTLSGLLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDL---NSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHF-----PKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVE-CNKYKPV-KCNEVVYKTDQ-RKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKE-------------MRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQL 1550
            +K+   +  LL+HST+HGL+HV TA+SRI + +WL L+L G  GFF NL FIV RY++ P+L S+  D+E F+WPD+T CNP AP+P+H  N   + W    +++  V K ++    LF  I D  +   E+    +  ST  P++    + +  + F       +G++L  E  ++ T++D+    Q+F  Q +Q R+NIPC+T Q+  +  L + D    N V   ++FN+ S++I NSSY  R+I L+I+     P+ + + +L G+ +++++  TR++   N+  CR + +  +++DA L +     G  + C K+ SQ+LY+N C CYSPFLP    ++H      P LC N S F    I  NA CM  V+  Y +   +  + E + C  ++    C    Y  +  R+   IELWS+T N+ R  F+   ++ +F  D       +              MR++  M+ I R    G    EE EYP+SEL+SD+GGLMGLW+G+SV+G+FE+VE +  +   +
Sbjct:   24 QKFYLGVRRLLEHSTVHGLSHVSTASSRIGRSIWLILWLAGVAGFFTNLSFIVSRYMTRPVLTSYKHDHESFIWPDITLCNPMAPYPVHLRNRT-EKWNELRLRATRVAKNISED--LFAAIDD--AEQLEIAIQALLYSTISPEQFGVGEPQELIQFVAADKGRSGIHLTVEMYSTFTDLDAPK-TQYFHAQMLQKRHNIPCYTLQL--AHVLSQEDCLSTNQVSLGLKFNHDSFLIINSSYAPRNIDLFISLPGHFPEDESMELLSGYTHKVSVSMTRFIREPNRLPCRTDEFVAQMFDANLKTRREIVGSADFCHKLVSQRLYINNCGCYSPFLPYPVVDEHLLVHGQPVLCFNMSHFNITSIDQNAKCMYDVYTQYHDHSVYMNLPEAQYCETFRSTPPCESTSYMPESLRRTPIIELWSDTINEGRTAFLTSTFESVFGPDLPEERIRQLLNNSGNNSNMFTYMRNNFGMVTISRKFPRGTLTHEELEYPLSELLSDLGGLMGLWIGISVIGLFEVVELLAFVSLSM 547          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A4S2L913 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009406 PE=3 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.237e-81
Identity = 183/523 (34.99%), Postives = 291/523 (55.64%), Query Frame = 3
Query:   54 LLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQI------DKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPI-----YKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEV-ECNKYKPV-KCNEVVYKTDQ--RKEMWIELWSETFNDRRRTFIQDNYQPLFNRDW-KNR------------DFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLI 1538
            LL+HST+HGL+HV +A+S + +I W  LF+ G  GF  NL  IV RY+S P+L S   D++ F+WPD+T CNP+AP+ +H  +   + W      +K+V + + S+  LF  I + +    E++   +  ST  P           V F    T H G+ L  E   + T + S  ++Q+F T  +Q R NIPC+T QI      D+ K ++KV L      ++FN  S++I N+SY+  ++   I+    +P  + + +LPG+ + I +   R+    +KR CRN ++ VE++DA L +     G    C +I SQ LY+  C CYSPFLP      + D    P LC N S F  EQ+  NA CM ++ E Y++   +  I E  EC     V  C ++ ++  Q  R  +W ELWSE +ND R +F++  +Q +F  D  +NR              ++ +R++ A++ I+R  + G+  +E+ EYP++EL+SD+GGLMGLW+G+SV+G+FE++E + L+
Sbjct:   72 LLEHSTVHGLSHVSSASSHVGRITWFVLFVAGITGFCINLSLIVSRYVSRPVLTSIFNDHDDFVWPDITICNPSAPYVVHLYDR-HEKWLRLRDWAKNVAQYIPSE--LFAAIDEADKV--EIKTQALMHSTMSPSDFGVGIPNETVNFVAADTGHYGIVLTVELDGNLTYL-SAPMEQYFRTHILQKRYNIPCYTLQIEQGMPEDERKRVRKVALG-----LKFNIESHMIINTSYVSPTLDFIISRPGHMPHDEPIELLPGYMHYIGLNFQRFKREPSKRPCRNNVFDVEVFDANLATKYPVHGSATLCHRILSQNLYIKYCGCYSPFLPYPVIPSHPDFDDSPVLCFNMSRFKIEQLNQNAKCMFNLLEKYRDPVTYMNIPEARECEYLGSVPPCEDIEHQLIQTRRTPLW-ELWSEKYNDARLSFLKAAFQLVFEVDIVQNRLGKSFHINNDSEPALRYLRENFALITIERKVEKGELIREDLEYPLAELLSDIGGLMGLWIGISVIGLFEVLELLGLM 582          
BLAST of Degenerin unc-8 vs. TrEMBL
Match: A0A504YRR8 (Degenerin unc-8 OS=Fasciola gigantica OX=46835 GN=FGIG_05554 PE=3 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 7.119e-81
Identity = 182/525 (34.67%), Postives = 285/525 (54.29%), Query Frame = 3
Query:   54 LLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTM---STADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDK------SKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLP---IYKDEKHF--PKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVE-CNKYKPV-KCNEVVYKTDQ-RKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKE-------------MRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLI 1538
            LL+HST+HGL+HV TA++RI + +WL L++ G  GFF NL FIV RY++ P+L S+  D+E F+WPD+T CNP AP+P+H +N + + W N L +    V    S + LF  I +      E EE+TV     ST  P +  ++D    V F       TG++L  E   + T +D     ++F  Q +Q R NIPC+T ++D+        + K+V L      ++FN+ S +I NSSY   +I L+I+    +P+ + + IL G+++++ +   R+     +  CR E +  +++DA L +     G  + C K+ SQ+LY++ C CYSPFLP   + +D   +  P LC N S F    I  NA CM  V+  +KE F +  + E   C  ++    C  + Y  +  R+   IE W++T N+ R  F+   ++ +F +D       +              MR++  ++ I R    G    EE EYP+SEL+SDVGGLMGLW+G+SV+G+FE+VE    +
Sbjct:   34 LLEHSTVHGLSHVSTASTRIGRSVWLILWMAGVAGFFTNLSFIVSRYMTRPVLTSYKHDHELFIWPDITLCNPMAPYPVHLNNRS-EKW-NLLHQLATAVSRNISGN-LFATIDE-----AEQEEVTVQALIHSTVSPMEFGANDPHELVHFVAVDKGQTGIHLTIEMDATFTNLDIPK-HRYFHVQVLQKRYNIPCYTLRLDQVLNEEECASTKQVSLG-----LKFNHDSNLIINSSYAPFNIDLFISLPGHMPEDEPMEILSGYSHKVTVTMGRFTRERTRLPCRTEQFVTQVFDADLKTQREVVGSADFCLKLLSQRLYIDHCGCYSPFLPYPVMGQDHPLYQHPVLCFNMSHFNASGIDRNARCMYEVYTQFKEDFIYMNLPEAGFCETFRATPPCESINYVLESPRRTPIIEFWADTVNEARSAFVTSTFESVFGQDLPEERLKQMVNNSGNTSSLLFYMRNNFGLVKITRKLPRGTLTHEELEYPLSELLSDVGGLMGLWVGISVIGLFEVVELFAFV 544          
BLAST of Degenerin unc-8 vs. Ensembl Nematostella
Match: EDO31696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX71])

HSP 1 Score: 49.6766 bits (117), Expect = 2.951e-6
Identity = 62/268 (23.13%), Postives = 111/268 (41.42%), Query Frame = 3
Query:  789 LPQKDEVLILPGFNNEINIRQ--TRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFP--KLC--LNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDN-YQPLFN--RDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRK 1565
             P++   L+ PGF+ +I + +   + +   N   C  +       +A + + N+F+   +      S+   V  C  Y         E  FP   +C  LN++I           C+  V      KF+  +  E+ C+      C E  Y+      +W        + R +  I DN +  +FN  R W   ++++        +  K  + +    +E   Y +   +SD+GG +GLW+G+SV+   E+VE   LI F++ F RK
Sbjct:  177 FPEERGTLVAPGFSTDIGLEKMDIKRVDPHNNGSCVTD-------EASINTENIFK---QKFNTSYSKTACVLSCLAYHQMHECKCMEYRFPTDSVCDTLNSTI---------VECLAKV------KFKLSR-NELGCSTACGPACREEAYRLTSSFAVWP-------SQRYQNSIIDNLFDGIFNYSRSWFRDNYLE------VNIFFKELNYF---IEESVAYELVNFLSDIGGQLGLWVGVSVMTGAEVVELALLIFFKV-FCRK 401          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022994.1 (SMESG000022994.1)

HSP 1 Score: 1182.16 bits (3057), Expect = 0.000e+0
Identity = 593/594 (99.83%), Postives = 594/594 (100.00%), Query Frame = 3
Query:    3 MNEKDIIMEKYNKTLSGLLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTKFETEYTKSPEPFHSVRVKIPTYNNKLNSESPCCEIHYCSHPYSDTLHNENGYLFSMNDNHEPHKC 1784
            MNEKDIIMEKYNKTLSGLLKHSTIHGLNHVYTANSRISKILWLFLFLLGFCGFFFNLVFIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTKFETEYTKSPEPFHSVRVKIPTYNNKLNSESPCCEIHYCSHPYSDTLHNENGYLFS+NDNHEPHKC
Sbjct:    1 MNEKDIIMEKYNKTLSGLLKHSTIHGLNHVYTANSRISKILWLFLFLLGFCGFFFNLVFIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTKFETEYTKSPEPFHSVRVKIPTYNNKLNSESPCCEIHYCSHPYSDTLHNENGYLFSINDNHEPHKC 594          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022997.1 (SMESG000022997.1)

HSP 1 Score: 503.827 bits (1296), Expect = 4.498e-173
Identity = 255/517 (49.32%), Postives = 361/517 (69.83%), Query Frame = 3
Query:   24 MEKYNKTLSGLLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSL 1574
            M  Y++ L  LL+++TIHGLNHVYTA  R SKILW FLFL+G CGFF NLV I+QRYLSNPIL+S+ VDNE F WPDLTFCNP+APF L  S+ A  H+++ L  S + +K L ++S LF+ +  F   D E EE++V MS+ D   L  +D+   + F+GY+  H+ +YL K+Y+   T++        FSTQ+VQ+RNN+PCHTFQI +SK +    ++S++F I  N+PSY IFNSSY+ RS+FLYIT  ++LPQ  E++I PG+N E+++ QTR++ +  K  CR++I+QVELYD L   TN++EG++EDCRKI SQ+LYV  C CY+PFLPI+K    FPKLC NTSIF++  IL NA CM  V + +     +  + E  C +Y P+KCN+ +Y ++ ++E+W+EL  +  N+R   ++Q  Y  LF RDW  RD+VKE+++++ ++ IKR S++G   KEE EY  S+L+SD+GGLMG WLGLSVVG+FEI   IY +L ++   +K  +
Sbjct:    1 MLNYDEILVELLQNTTIHGLNHVYTARIRTSKILWFFLFLIGLCGFFINLVGIIQRYLSNPILVSNFVDNENFSWPDLTFCNPSAPFSLDNSSIALMHYKSVLKNSTNTIKKLLNESLLFQNV--FKIIDEEFEELSVVMSSMDYATLKVEDYNKTIKFHGYSKSHSDIYLYKQYNRHATDIVMEMENYLFSTQFVQMRNNVPCHTFQIGRSKLIDFNTIHSLLFFININHPSYKIFNSSYLSRSVFLYITRKDNLPQNGEIIISPGYNTEVSVTQTRFIINKLKNSCRHKIFQVELYDVLFQKTNLYEGNYEDCRKILSQELYVKHCNCYNPFLPIFKSNLGFPKLCFNTSIFSELDILGNAQCMFMVMKNFSNSSIYLSLVERRCGQYYPMKCNDTLYTSEYQRELWVELLQKHVNERTNKWLQMAYIKLFGRDWNGRDYVKEIQENIGIVTIKRMSRFGGLVKEELEYSYSDLLSDIGGLMGFWLGLSVVGLFEIGGMIYFLLLRILGCKKTKI 515          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022999.1 (SMESG000022999.1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.193e-169
Identity = 250/514 (48.64%), Postives = 360/514 (70.04%), Query Frame = 3
Query:   33 YNKTLSGLLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSL 1574
            +N+ L  LL+++TIHGLNHVYTA  R SKILW FLFL+G CGFF NLV I+QRYLSNPIL+S+ VDNE F WPDLTFCNP+APF L  S+ A  H+++ L  S +++ +L ++S LF+  + F +   E EE++V MS+ D   L  +D+   + F+GY+   + +Y  K++S   T + + +  Q FSTQ+VQ+RNNIPCHTFQ+ KSK+L    ++S+ F +  N+PSY IFNSSYI RSIFLYIT  ++LPQK E++I PG + E+++ QTR++ +  K+ CR++I+QVELYD L   TN++EG++EDCRKI SQ+LYV  C CY+PFLPI+K+   FPKLC NTSIF++  IL NA CM  V + +     +  + E  C +Y P+KCN+ +Y    RKE+W+EL  +  NDR + +++  Y  +F++ W  RD++++++ ++  + I R SK+G   KEE EY  S+L+SD+GGLMG WLGLSVVG+FEI   IY +L ++  ++K  +
Sbjct:   20 HNEILVELLQNTTIHGLNHVYTARIRTSKILWFFLFLIGLCGFFINLVGIIQRYLSNPILVSNFVDNENFSWPDLTFCNPSAPFSLDNSSIALMHYKSVLENSSNIINILTNRSPLFK--RGFRTIRGEFEELSVVMSSMDYATLKVEDYNKTINFHGYSKSSSDIYFYKDFSQYSTNLITTNENQLFSTQFVQMRNNIPCHTFQLGKSKSLDFNSIHSLSFYVNLNHPSYRIFNSSYIQRSIFLYITRKDNLPQKGEIIISPGHSTEVSVTQTRFIINKLKKPCRHKIFQVELYDVLFQKTNLYEGNYEDCRKILSQELYVKHCNCYNPFLPIFKNNLGFPKLCFNTSIFSELDILGNAQCMFMVMKNFSNSSIYLSLVERRCGQYYPMKCNDTIYTCKSRKELWVELVQKHMNDRMKDWLKRVYMQIFHQHWSGRDYMRDIQQNIGFVTITRMSKFGGFVKEESEYSCSDLLSDIGGLMGFWLGLSVVGLFEIGGMIYFLLLKILNSKKTKI 531          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000069054.1 (SMESG000069054.1)

HSP 1 Score: 484.952 bits (1247), Expect = 6.813e-166
Identity = 241/512 (47.07%), Postives = 354/512 (69.14%), Query Frame = 3
Query:   54 LLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKFTRKKSLDLSTK 1589
            L+K STIHG+NH+Y+AN +++K LW  LF+ G  G   N+ F+  RY S P+LIS+  ++EPF+WPD+TFCNPTAPF L + + A+ +W     +S+DVVK+L  +++LF+II++   TD ELEE T+ M++++P KL +D F+++V F GYT  H+G+Y  K+  N+  +    DLK  FSTQ VQI+NNIPCHTF + KS  L    + S++F +RFNY SY IFNSSY  RSIFLYI+N + + Q   + + PGFNN +++ Q R+ ++  +R CR++ ++ E+YDAL  +   FEG +EDC++I SQ+L+V+KCKCYSPFLPI+K++  FP+LCLN + F+K ++L NA CMV+V+E +K+   F K    +C  +K  KC+ + Y+ D RK+M +ELWS+ +N +R   I+  +   F ++   +DF + MRD++  L+I+R  +Y D +KEE EYP SEL+SD+GGLMGLWLG+SVVG+FEI+EF YL        +K     S K
Sbjct:    4 LVKSSTIHGINHIYSANGKLAKFLWCVLFIFGIIGIIVNICFVSIRYFSYPVLISYTFEHEPFVWPDITFCNPTAPFYLDRKSKAYKYWMQINNQSRDVVKMLVKETKLFQIIRESKETDFELEERTIAMASSNPVKLGADLFENHVKFVGYTRPHSGIYFNKDIQNNNPKTFPGDLKPLFSTQIVQIQNNIPCHTFHMHKSNILNPNSVQSLVFGLRFNYDSYEIFNSSYTTRSIFLYISNRDEIQQDQNIFLSPGFNNILSLSQNRHHYNGLRRKCRHKTFKFEVYDALFQNVKTFEGSYEDCKQIVSQRLFVDKCKCYSPFLPIFKNQTGFPRLCLNATFFSKTKLLENAKCMVNVYENFKKSGNFRKHYNNQCLIFKLHKCDLLSYQMDLRKDMLVELWSKVYNGKRLNSIKFMHSYYFGKNESKKDFNEVMRDNIVDLIIERKFEYSDLFKEEREYPFSELLSDIGGLMGLWLGMSVVGLFEILEFFYLFSINACLNKKNKSRFSPK 515          
BLAST of Degenerin unc-8 vs. Planmine SMEST
Match: SMESG000022995.1 (SMESG000022995.1)

HSP 1 Score: 477.248 bits (1227), Expect = 1.440e-162
Identity = 259/515 (50.29%), Postives = 353/515 (68.54%), Query Frame = 3
Query:   24 MEKYNKTLSGLLKHSTIHGLNHVYTANSRISKIXXXXXXXXXXXXXXXXXXXIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSNSAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTADPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGT----EVDSNDLKQFFSTQYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIFRSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIYQVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKHFPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPVKCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFVKEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVVGMFEIVEFIYLILFQLKF 1556
            M KY+  L  LL+++TIHGLNHVYTA  + +K LWL +F LG  GF FNL+ I++RY+SNPILI+H ++NEPF WPDLTFCNPTAPF L +      +W++T+ KSKD + +L + S++F+I+  F+   +EL E +V MST DP  L +  F+ +V+FYG++  H  VYL +EY    T    E   N++   F+TQ+VQ RNNIPCHTFQI+KSK      ++++ F I  NYPSY +FNSSYI RS   Y+T    LPQ D  +ILPGF +E+ I QTR+ H   K  CR   +QVELYDA L+ST ++EG+++DCRK+ SQK+YV+KC CYSPFLPIYK E +FPKLC N SIF+ E++L NA CM +V+E Y +     K E   C+KYK VKCN+  YK    KE+ +EL S   N R   +++  Y  LFNR     ++++E R+++A L ++R+S  GD Y E+ EY  S+LISD+GGLMGLWLGLSVVG+FEI + +Y  +F++ F
Sbjct:    1 MRKYDLALIELLENTTIHGLNHVYTAKFKATKCLWLVMFTLGIAGFSFNLIHIIKRYMSNPILITHFIENEPFYWPDLTFCNPTAPFILEKGQPELYYWQSTMSKSKDSIDILYNSSQIFQILNTFHDDKSELAEKSVMMSTVDPAVLGTQRFEKHVMFYGFSKSHPEVYLTQEYKRYPTDFVHENLRNEISNLFTTQFVQFRNNIPCHTFQIEKSKIFNSSSIHTLFFFINLNYPSYQVFNSSYISRSSIFYVTKKGYLPQDDVTIILPGFTHEVLISQTRFQHEETKNPCRKTAFQVELYDATLSSTYLYEGEYDDCRKVVSQKMYVSKCNCYSPFLPIYKMENNFPKLCFNASIFSAEKMLENAFCMYNVYEKYSKNSTI-KGETGVCSKYKAVKCNDYSYKVSSNKEIMVELNSGGLNYRMDQWMKKAYTKLFNRTRVKSNYLQESRENIAFLTVRRASSSGDLYVEKMEYSHSDLISDIGGLMGLWLGLSVVGLFEIGQIVYFTIFKVLF 514          
The following BLAST results are available for this feature:
BLAST of Degenerin unc-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1053.590e-922.48Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.850e-821.90Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.850e-821.90Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.898e-821.90Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.898e-821.90Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5W2R28.527e-14846.45Asic OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A5J4NUF16.267e-9236.08Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A183A5V11.451e-8834.02Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4S2L9132.237e-8134.99Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YRR87.119e-8134.67Degenerin unc-8 OS=Fasciola gigantica OX=46835 GN=... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO316962.951e-623.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Degenerin unc-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Degenerin unc-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022994.10.000e+099.83SMESG000022994.1[more]
SMESG000022997.14.498e-17349.32SMESG000022997.1[more]
SMESG000022999.11.193e-16948.64SMESG000022999.1[more]
SMESG000069054.16.813e-16647.07SMESG000069054.1[more]
SMESG000022995.11.440e-16250.29SMESG000022995.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002740 ID=SMED30002740|Name=Degenerin unc-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1916bp
TAATGAATGAAAAGGATATAATAATGGAGAAATATAACAAAACACTGTCC
GGACTATTAAAACACAGCACAATCCACGGTCTAAATCATGTCTATACAGC
CAATAGTAGAATTTCTAAAATTCTTTGGCTTTTTCTATTTCTTTTGGGTT
TTTGTGGATTTTTTTTCAATCTTGTTTTTATTGTACAGAGATATTTGTCT
AATCCGATCCTCATCAGCCATCATGTAGACAACGAACCGTTTATGTGGCC
AGATTTGACATTTTGCAATCCGACAGCTCCTTTTCCTTTGCATCAAAGTA
ATTCTGCTTTTGATCATTGGAGGAATACTTTGATGAAATCCAAAGACGTT
GTAAAGTTGTTAGCCTCTAAAAGTCGGCTGTTTAGAATAATCCAAGATTT
CAATAGTACAGACAATGAGTTAGAAGAAATGACAGTGACAATGTCAACAG
CTGATCCTCAAAAGTTGCTTTCTGATGACTTTAAAAGCAATGTTTTATTT
TATGGATATACTACTCAACATACTGGTGTATATTTGGTCAAAGAGTACAG
TAATTCTGGAACCGAAGTAGACAGCAATGATTTAAAGCAGTTCTTCTCCA
CTCAATATGTACAGATTCGAAACAACATTCCATGTCACACCTTCCAAATT
GATAAGTCTAAAACCCTGAAAAAAGTTGACTTAAATTCGGTAATGTTCGT
AATTCGATTCAATTATCCCAGCTATGTGATATTTAACTCAAGCTACATTT
TTAGATCCATTTTCCTATATATAACCAACAACAATAGTTTACCACAGAAA
GATGAAGTGCTGATTTTACCAGGTTTTAACAACGAAATAAACATCAGACA
AACCAGATATCTCCACAGTACCAATAAGAGAATCTGTCGCAATGAAATAT
ATCAAGTCGAACTCTACGACGCTTTGTTGACATCGACAAATGTTTTCGAA
GGTGACCATGAAGACTGCAGAAAGATCGCCAGCCAAAAACTATACGTGAA
CAAATGCAAATGTTACAGTCCGTTTTTACCCATATACAAAGACGAAAAAC
ATTTTCCTAAACTTTGTTTAAACACATCCATTTTTACTAAGGAACAAATA
TTATCAAATGCCAACTGCATGGTTCATGTTTTCGAGATGTACAAAGAGAA
ATTTCAATTCGACAAAATTGAAGAAGTCGAATGCAATAAATATAAACCCG
TCAAGTGTAACGAAGTCGTTTATAAAACTGATCAACGAAAAGAAATGTGG
ATTGAACTGTGGTCGGAAACCTTTAATGATAGACGAAGGACATTCATTCA
AGATAACTATCAGCCTTTATTCAACAGAGATTGGAAAAACCGAGATTTTG
TTAAAGAAATGAGAGACGACGTTGCAATGCTATTAATAAAAAGATCCTCC
AAGTATGGAGATCGTTATAAAGAAGAATTCGAATATCCAGTTTCCGAACT
GATTTCGGATGTCGGTGGACTAATGGGTCTTTGGTTAGGGTTGAGTGTGG
TGGGAATGTTTGAAATTGTCGAATTCATTTATCTCATCCTATTTCAATTG
AAATTTACCAGGAAAAAAAGTTTAGATTTGTCGACAAAGTTTGAAACGGA
ATATACGAAATCTCCTGAACCATTCCATTCGGTTCGAGTGAAAATTCCCA
CTTACAATAACAAACTGAATTCCGAATCTCCTTGCTGTGAAATTCATTAC
TGTTCACATCCATACAGCGATACTTTACATAATGAAAACGGATACTTGTT
TTCTATGAATGACAACCACGAACCGCATAAGTGCATCCAGTCGATGATAA
GTTCGTTTTAGAGTCGAATATAAATACTGAGATTTTGAGATTTTCATTTT
GTATAGATTCTGGGAGTAAAAGTTTGGAAATATAATGAATTATAATGTTA
ATGAATAATTTGGAGG
back to top

protein sequence of SMED30002740-orf-1

>SMED30002740-orf-1 ID=SMED30002740-orf-1|Name=SMED30002740-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=603bp
MNEKDIIMEKYNKTLSGLLKHSTIHGLNHVYTANSRISKILWLFLFLLGF
CGFFFNLVFIVQRYLSNPILISHHVDNEPFMWPDLTFCNPTAPFPLHQSN
SAFDHWRNTLMKSKDVVKLLASKSRLFRIIQDFNSTDNELEEMTVTMSTA
DPQKLLSDDFKSNVLFYGYTTQHTGVYLVKEYSNSGTEVDSNDLKQFFST
QYVQIRNNIPCHTFQIDKSKTLKKVDLNSVMFVIRFNYPSYVIFNSSYIF
RSIFLYITNNNSLPQKDEVLILPGFNNEINIRQTRYLHSTNKRICRNEIY
QVELYDALLTSTNVFEGDHEDCRKIASQKLYVNKCKCYSPFLPIYKDEKH
FPKLCLNTSIFTKEQILSNANCMVHVFEMYKEKFQFDKIEEVECNKYKPV
KCNEVVYKTDQRKEMWIELWSETFNDRRRTFIQDNYQPLFNRDWKNRDFV
KEMRDDVAMLLIKRSSKYGDRYKEEFEYPVSELISDVGGLMGLWLGLSVV
GMFEIVEFIYLILFQLKFTRKKSLDLSTKFETEYTKSPEPFHSVRVKIPT
YNNKLNSESPCCEIHYCSHPYSDTLHNENGYLFSMNDNHEPHKCIQSMIS
SF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030476Pentaxin_CS
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 328..345
score: 31.33
coord: 474..488
score: 33.33
coord: 39..56
score: 22.67
coord: 488..504
score: 48.71
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 20..508
e-value: 2.1E-46
score: 158.8
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 11..524
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 39..506
e-value: 4.3E-27
score: 97.1
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 91..252
e-value: 4.3E-27
score: 97.1
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 69..476
e-value: 4.3E-27
score: 97.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 288..402
e-value: 4.3E-27
score: 97.1
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 11..524
NoneNo IPR availableTMHMMTMhelixcoord: 492..514
NoneNo IPR availableTMHMMTMhelixcoord: 40..62