Dual specificity tyrosine-phosphorylation-regulated kinase 2

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 2
Smed IDSMED30002728
Length (bp)2101
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30002728) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30002728) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30002728) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 2 (SMED30002728) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30002728h1SMcG0015923 dd_Smed_v4_10966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002728h1SMcG0015923 dd_Smed_v4_10966_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30002728h1SMcG0015923 dd_Smed_v4_10966_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 293/469 (62.47%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  317 YRESDNKNVFLDT-----SQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + ++ NK   L T     + +   G PVV    L         DS   +Q   +S  SM                G  +  P+  E AMK YM KLT+FEHHEIFSYPEIYF+G NAKKR G+ GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKRAK F++S+GYPRYC +   +DG ++L G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:   94 FEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQL---------DSIHRRQGSSTSLKSMEG-------------MGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP 540          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:HGNC Symbol;Acc:HGNC:3093])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 293/469 (62.47%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  317 YRESDNKNVFLDT-----SQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + ++ NK   L T     + +   G PVV    L         DS   +Q   +S  SM                G  +  P+  E AMK YM KLT+FEHHEIFSYPEIYF+G NAKKR G+ GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKRAK F++S+GYPRYC +   +DG ++L G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:   21 FEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQL---------DSIHRRQGSSTSLKSMEG-------------MGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP 467          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/448 (61.61%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQS-RGSSTISMTASFTKDSLTNVSRRAGSYEKN--PINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVD 1747
            R  N + S  +  S + S T+S   S   D L  V   + S      P+  E A+K Y + LT++E  EI +YPEIYFVG NAKKR+GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILGS Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP  L+E SKRAK FINS+G PRYC++    DG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCL W P  R+TP +AL+  W+ +  P       P T +D
Sbjct:   75 RKSNTIQSDGISDSEKCSPTVSQGKS--SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPR------PLTTID 514          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/448 (61.61%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQS-RGSSTISMTASFTKDSLTNVSRRAGSYEKN--PINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVD 1747
            R  N + S  +  S + S T+S   S   D L  V   + S      P+  E A+K Y + LT++E  EI +YPEIYFVG NAKKR+GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILGS Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP  L+E SKRAK FINS+G PRYC++    DG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCL W P  R+TP +AL+  W+ +  P       P T +D
Sbjct:   75 RKSNTIQSDGISDSEKCSPTVSQGKS--SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPR------PLTTID 514          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Match: DYRK3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:HGNC Symbol;Acc:HGNC:3094])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/448 (61.61%), Postives = 337/448 (75.22%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQS-RGSSTISMTASFTKDSLTNVSRRAGSYEKN--PINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVD 1747
            R  N + S  +  S + S T+S   S   D L  V   + S      P+  E A+K Y + LT++E  EI +YPEIYFVG NAKKR+GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILGS Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP  L+E SKRAK FINS+G PRYC++    DG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCL W P  R+TP +AL+  W+ +  P       P T +D
Sbjct:   95 RKSNTIQSDGISDSEKCSPTVSQGKS--SDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPR------PLTTID 534          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 270/419 (64.44%), Postives = 326/419 (77.80%), Query Frame = 2
Query:  557 ETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHENFLM 1813
            E A++ +  KL  FE +EI++Y  ++FVG +AKK+ GV+GG +N GYDDE  SY  V HDHIAYR+EV+K++GKGSFGQV+KA+DHKY  YVALK++RNEKRF RQA EEIRIL++L++QD    HNI+H+L+ F FRNH C+TFELL+INLYELIK+NKFQGFSL LVRKFA+S+LLCLDLL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLA IIELLG+PP   +E +KRA+ FI S+GYPRYC      DG ++L G RSKRGK RGPP ++S  + LKN  D  FV FLKRCL W P+ RMTP +ALK +WLRR+ PN  +D   S     D   K+T T   I  + N LM
Sbjct:  396 EDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADH-EKKTETLPNIDSNANILM 813          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 270/419 (64.44%), Postives = 326/419 (77.80%), Query Frame = 2
Query:  557 ETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHENFLM 1813
            E A++ +  KL  FE +EI++Y  ++FVG +AKK+ GV+GG +N GYDDE  SY  V HDHIAYR+EV+K++GKGSFGQV+KA+DHKY  YVALK++RNEKRF RQA EEIRIL++L++QD    HNI+H+L+ F FRNH C+TFELL+INLYELIK+NKFQGFSL LVRKFA+S+LLCLDLL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLA IIELLG+PP   +E +KRA+ FI S+GYPRYC      DG ++L G RSKRGK RGPP ++S  + LKN  D  FV FLKRCL W P+ RMTP +ALK +WLRR+ PN  +D   S     D   K+T T   I  + N LM
Sbjct:  379 EDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADH-EKKTETLPNIDSNANILM 796          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 263/399 (65.91%), Postives = 317/399 (79.45%), Query Frame = 2
Query:  557 ETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGD 1753
            E A++ +  KL  FE +EI++Y  ++FVG +AKK+ GV+GG +N GYDDE  SY  V HDHIAYR+EV+K++GKGSFGQV+KA+DHKY  YVALK++RNEKRF RQA EEIRIL++L++QD    HNI+H+L+ F FRNH C+TFELL+INLYELIK+NKFQGFSL LVRKFA+S+LLCLDLL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLA IIELLG+PP   +E +KRA+ FI S+GYPRYC      DG ++L G RSKRGK RGPP ++S  + LKN  D  FV FLKRCL W P+ RMTP +ALK +WLRR+ PN  +D   S     D
Sbjct:  379 EDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLAD 777          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 263/399 (65.91%), Postives = 317/399 (79.45%), Query Frame = 2
Query:  557 ETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGD 1753
            E A++ +  KL  FE +EI++Y  ++FVG +AKK+ GV+GG +N GYDDE  SY  V HDHIAYR+EV+K++GKGSFGQV+KA+DHKY  YVALK++RNEKRF RQA EEIRIL++L++QD    HNI+H+L+ F FRNH C+TFELL+INLYELIK+NKFQGFSL LVRKFA+S+LLCLDLL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLA IIELLG+PP   +E +KRA+ FI S+GYPRYC      DG ++L G RSKRGK RGPP ++S  + LKN  D  FV FLKRCL W P+ RMTP +ALK +WLRR+ PN  +D   S     D
Sbjct:  396 EDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLAD 794          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 270/419 (64.44%), Postives = 326/419 (77.80%), Query Frame = 2
Query:  557 ETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHENFLM 1813
            E A++ +  KL  FE +EI++Y  ++FVG +AKK+ GV+GG +N GYDDE  SY  V HDHIAYR+EV+K++GKGSFGQV+KA+DHKY  YVALK++RNEKRF RQA EEIRIL++L++QD    HNI+H+L+ F FRNH C+TFELL+INLYELIK+NKFQGFSL LVRKFA+S+LLCLDLL +N++IHCDLKPEN+LLKQQGRSGIKVIDFGSSC++ QRIYTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLA IIELLG+PP   +E +KRA+ FI S+GYPRYC      DG ++L G RSKRGK RGPP ++S  + LKN  D  FV FLKRCL W P+ RMTP +ALK +WLRR+ PN  +D   S     D   K+T T   I  + N LM
Sbjct:  114 EDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRRQDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTFITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLADH-EKKTETLPNIDSNANILM 531          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100406)

HSP 1 Score: 530.02 bits (1364), Expect = 2.931e-178
Identity = 246/387 (63.57%), Postives = 313/387 (80.88%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            ++ +  M LYMNKLT +E  EI +YP+IYF+G NAKKR GV G  +N  YD+EQ +Y++V HDH+AYR+E++KI+GKGSFGQV+KAYDHK + +VALK++RNEKRF RQA EEIRIL +L++ D  +  NI+H+ + FTFRNH C+TFELL+INLYELIKKN F+GFSLQLVRKFAHS+L CLD L++N +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+E+QRIYTYIQSRFYRAPEVILG  Y   IDMWS GCILAEL +G  LFPGE+E+DQLACIIE+LG+P K+++ +SKR+K F + +GYPRYC +   +DG ++L G +S+RGK RGPP +KS+   L  C D  F++F++ CL+W    R+TP EALK  WLRR+ P
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLP 594          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100404)

HSP 1 Score: 530.02 bits (1364), Expect = 2.931e-178
Identity = 246/387 (63.57%), Postives = 313/387 (80.88%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            ++ +  M LYMNKLT +E  EI +YP+IYF+G NAKKR GV G  +N  YD+EQ +Y++V HDH+AYR+E++KI+GKGSFGQV+KAYDHK + +VALK++RNEKRF RQA EEIRIL +L++ D  +  NI+H+ + FTFRNH C+TFELL+INLYELIKKN F+GFSLQLVRKFAHS+L CLD L++N +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+E+QRIYTYIQSRFYRAPEVILG  Y   IDMWS GCILAEL +G  LFPGE+E+DQLACIIE+LG+P K+++ +SKR+K F + +GYPRYC +   +DG ++L G +S+RGK RGPP +KS+   L  C D  F++F++ CL+W    R+TP EALK  WLRR+ P
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLP 594          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk3 (gene:FBgn0027101 transcript:FBtr0100402)

HSP 1 Score: 530.02 bits (1364), Expect = 2.931e-178
Identity = 246/387 (63.57%), Postives = 313/387 (80.88%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            ++ +  M LYMNKLT +E  EI +YP+IYF+G NAKKR GV G  +N  YD+EQ +Y++V HDH+AYR+E++KI+GKGSFGQV+KAYDHK + +VALK++RNEKRF RQA EEIRIL +L++ D  +  NI+H+ + FTFRNH C+TFELL+INLYELIKKN F+GFSLQLVRKFAHS+L CLD L++N +IHCD+KPEN+LLKQQGRSGIKVIDFGSSC+E+QRIYTYIQSRFYRAPEVILG  Y   IDMWS GCILAEL +G  LFPGE+E+DQLACIIE+LG+P K+++ +SKR+K F + +GYPRYC +   +DG ++L G +S+RGK RGPP +KS+   L  C D  F++F++ CL+W    R+TP EALK  WLRR+ P
Sbjct:  209 VSPQQVMILYMNKLTPYERTEILTYPQIYFIGANAKKRPGVYG-PNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLP 594          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0100447)

HSP 1 Score: 429.098 bits (1102), Expect = 1.699e-140
Identity = 200/388 (51.55%), Postives = 276/388 (71.13%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRY---GVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLR 1696
             P+     +K + N LT  E  E+  Y E+++ GQ+A K Y        T N GYDD+  +Y  + HDHIA+R+E+++++GKGSFGQV++A DHK N +VA+K+IRN+KRF  QA  E+ IL+ L+++D   +HN++H+L+   FR H+C+TFEL+++NLYELIKKN + GFS+ L+R+F +SI+ CL LL++  +IHCDLKPENILLKQ+G S IKVIDFGSSCY  ++IYTYIQSRFYR+PEVILG  Y   IDMWS GCILAEL+TG PLFPGE+E +QLACI+E+LG+PPK LI  ++R ++F +SR  PR                  + +G+ R  PG+KS+  +L +C D  F+ FL+RCL+W P +RMTP EA   E+L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCIT---------------NTKGRKRS-PGSKSLAHIL-HCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Match: Dyrk2 (gene:FBgn0016930 transcript:FBtr0089289)

HSP 1 Score: 429.098 bits (1102), Expect = 1.699e-140
Identity = 200/388 (51.55%), Postives = 276/388 (71.13%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRY---GVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLR 1696
             P+     +K + N LT  E  E+  Y E+++ GQ+A K Y        T N GYDD+  +Y  + HDHIA+R+E+++++GKGSFGQV++A DHK N +VA+K+IRN+KRF  QA  E+ IL+ L+++D   +HN++H+L+   FR H+C+TFEL+++NLYELIKKN + GFS+ L+R+F +SI+ CL LL++  +IHCDLKPENILLKQ+G S IKVIDFGSSCY  ++IYTYIQSRFYR+PEVILG  Y   IDMWS GCILAEL+TG PLFPGE+E +QLACI+E+LG+PPK LI  ++R ++F +SR  PR                  + +G+ R  PG+KS+  +L +C D  F+ FL+RCL+W P +RMTP EA   E+L+
Sbjct:  125 TPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVARRRRLFFDSRDAPRCIT---------------NTKGRKRS-PGSKSLAHIL-HCQDRYFIDFLQRCLEWDPAERMTPDEAAHHEFLQ 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 277/405 (68.40%), Postives = 335/405 (82.72%), Query Frame = 2
Query:  494 KDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + S T++       +  P+  E AMK YM+KL+ FEH EI SY EIYF+G NAKKR GV+GG++N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  S  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CL+ LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IE+LG+P + L+E+SKRAK FI+S+G+PRYC +    D  ++L G RS+RGK RGPPG++  V+ LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  123 QGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLP 527          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 277/405 (68.40%), Postives = 335/405 (82.72%), Query Frame = 2
Query:  494 KDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + S T++       +  P+  E AMK YM+KL+ FEH EI SY EIYF+G NAKKR GV+GG++N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  S  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CL+ LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IE+LG+P + L+E+SKRAK FI+S+G+PRYC +    D  ++L G RS+RGK RGPPG++  V+ LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  113 QGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLP 517          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 277/405 (68.40%), Postives = 335/405 (82.72%), Query Frame = 2
Query:  494 KDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + S T++       +  P+  E AMK YM+KL+ FEH EI SY EIYF+G NAKKR GV+GG++N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  S  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CL+ LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IE+LG+P + L+E+SKRAK FI+S+G+PRYC +    D  ++L G RS+RGK RGPPG++  V+ LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  134 QGSSTSIKSTESKPKPAPLTPEQAMKQYMSKLSVFEHQEILSYTEIYFIGPNAKKRQGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKNHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLESLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIEMLGMPSEKLLESSKRAKNFISSKGHPRYCTVTTLPDASVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLKQCLEWDPSQRMTPSQALRHPWLRRRLP 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 322/389 (82.78%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            +P+  E A+K +  ++T+ E  EI +Y EIYF+G NAKKR  V GGT+N GYDD+Q  Y++V HDH+AYR+E +K++GKGSFGQV K YDHK   +VALK++RNEKRF RQAAEEIRILE+LKKQD + + N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ LHR+K+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP  L+E +KRAK FI+S+G+PRYC +   ++G I+L G+RS+RGK RG PG+K   + LK C D +F+ FLK+CL W P  RMTP +AL+  WL ++ P
Sbjct:  131 SPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVSTLSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGCEDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLP 519          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Match: dyrk3 (dual specificity tyrosine phosphorylation regulated kinase 3 [Source:ZFIN;Acc:ZDB-GENE-080219-31])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 322/389 (82.78%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            +P+  E A+K +  ++T+ E  EI +Y EIYF+G NAKKR  V GGT+N GYDD+Q  Y++V HDH+AYR+E +K++GKGSFGQV K YDHK   +VALK++RNEKRF RQAAEEIRILE+LKKQD + + N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ LHR+K+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP  L+E +KRAK FI+S+G+PRYC +   ++G I+L G+RS+RGK RG PG+K   + LK C D +F+ FLK+CL W P  RMTP +AL+  WL ++ P
Sbjct:  130 SPMTPEQALKQHRQQMTTLEQQEIHNYSEIYFLGPNAKKRQAVAGGTNNSGYDDDQGGYIHVPHDHLAYRYEFLKVIGKGSFGQVAKVYDHKLQQHVALKIVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALHRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPSKLLEQAKRAKNFISSKGHPRYCTVSTLSNGTIVLNGSRSRRGKMRGAPGSKEWGTALKGCEDATFIDFLKKCLDWDPSTRMTPVQALRHPWLYKRLP 518          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: DYRK2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:100485120])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 286/429 (66.67%), Postives = 341/429 (79.49%), Query Frame = 2
Query:  458 GSSTISMTASFTKDSLTNVSRRAGS------------YEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            G ST+ + +   +  L +  RR GS             + + +  E AMK YM KLT+FEHHEIF+YPEIYF+G NAKKR GV+GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+LKKQD  +N N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG  Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKR K F +S+GYPRYC +    DG ++L G RS+RGK RGPPG++  V+ LK C D  F+ FL +CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  139 GKSTLPVVS---ERQLESTHRRQGSSSSLKSAEGITKLKSSSLTPEQAMKQYMQKLTAFEHHEIFNYPEIYFLGPNAKKRQGVIGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKLHQHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDNNMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGGRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRGKNFFSSKGYPRYCTVTSLPDGSVVLNGGRSRRGKLRGPPGSRDWVTALKGCDDPLFLDFLTQCLEWDPSLRMTPSQALRHHWLRRRLP 564          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 270/415 (65.06%), Postives = 330/415 (79.52%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIG 1792
            +  + A+K Y ++L+++E  EI S+ EIYFVG NAKKR GV+GG +N GYDD+Q  Y  V HDH+AYR+EV+K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNH+CMTFELL++NLYELIK+NKFQGFSLQLVRKFAHSIL CL+ L+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCIL EL TG PLFPGEDE DQLAC++ELLG PP  L+E +KRAK FINS+GYPRYC +    +G  +L G+RS+RGK RG PG+K  V+ LK C D  F+ FLK CL W P  RMTP +AL+ +W+ ++ P  S     +    G  I  +T++   IG
Sbjct:  122 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKPSV----TEKASGKRISSQTSSFPGIG 532          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 270/415 (65.06%), Postives = 330/415 (79.52%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIG 1792
            +  + A+K Y ++L+++E  EI S+ EIYFVG NAKKR GV+GG +N GYDD+Q  Y  V HDH+AYR+EV+K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNH+CMTFELL++NLYELIK+NKFQGFSLQLVRKFAHSIL CL+ L+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCIL EL TG PLFPGEDE DQLAC++ELLG PP  L+E +KRAK FINS+GYPRYC +    +G  +L G+RS+RGK RG PG+K  V+ LK C D  F+ FLK CL W P  RMTP +AL+ +W+ ++ P  S     +    G  I  +T++   IG
Sbjct:  100 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKPSV----TEKASGKRISSQTSSFPGIG 510          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 270/415 (65.06%), Postives = 330/415 (79.52%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIG 1792
            +  + A+K Y ++L+++E  EI S+ EIYFVG NAKKR GV+GG +N GYDD+Q  Y  V HDH+AYR+EV+K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNH+CMTFELL++NLYELIK+NKFQGFSLQLVRKFAHSIL CL+ L+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCIL EL TG PLFPGEDE DQLAC++ELLG PP  L+E +KRAK FINS+GYPRYC +    +G  +L G+RS+RGK RG PG+K  V+ LK C D  F+ FLK CL W P  RMTP +AL+ +W+ ++ P  S     +    G  I  +T++   IG
Sbjct:   93 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKPSV----TEKASGKRISSQTSSFPGIG 503          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Match: dyrk3 (dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:NCBI gene;Acc:493520])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 270/415 (65.06%), Postives = 330/415 (79.52%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIG 1792
            +  + A+K Y ++L+++E  EI S+ EIYFVG NAKKR GV+GG +N GYDD+Q  Y  V HDH+AYR+EV+K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNH+CMTFELL++NLYELIK+NKFQGFSLQLVRKFAHSIL CL+ L+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCIL EL TG PLFPGEDE DQLAC++ELLG PP  L+E +KRAK FINS+GYPRYC +    +G  +L G+RS+RGK RG PG+K  V+ LK C D  F+ FLK CL W P  RMTP +AL+ +W+ ++ P  S     +    G  I  +T++   IG
Sbjct:   83 LTPDQAVKQYKHQLSAYELQEISSFSEIYFVGPNAKKRQGVVGGPNNGGYDDDQGGYNLVPHDHVAYRYEVLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHICMTFELLSMNLYELIKRNKFQGFSLQLVRKFAHSILQCLEALYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILVELLTGYPLFPGEDEGDQLACMMELLGAPPPKLLEQAKRAKNFINSKGYPRYCTVTTLPNGTTVLNGSRSRRGKMRGAPGSKDWVAALKGCEDSLFIDFLKGCLTWDPVARMTPSQALRHQWISKRLPKPSV----TEKASGKRISSQTSSFPGIG 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:MGI Symbol;Acc:MGI:1330301])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 285/434 (65.67%), Postives = 343/434 (79.03%), Query Frame = 2
Query:  449 QSRGSSTISMTA--SFTKDSLTNVSRRAGS------------YEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            Q  G +T+  T      +  L ++ RR GS             + +P+  E AMK YM KLT+FEHHEIFSYPEIYF+G NAKKR G+ GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRS IKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKRAK F++S+GYPRYC +   +DG ++L G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  105 QPNGLTTVGKTGLPGVPERQLESIHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk3 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3 [Source:MGI Symbol;Acc:MGI:1330300])

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 276/445 (62.02%), Postives = 335/445 (75.28%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNH-SQDNCPSTAV 1744
            R  N + S  +  S  SS  S   S    S    +  +   +  P+  E A+K Y + LT++E  EI SYPEIYFVG NAKKR GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILG  Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC+IELLG+PP+ L+E SKRAK FINS+G PRYC++   TDG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCLQW P  R+TP +AL+  W+ +  P   + D  P   V
Sbjct:   95 RRSNTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRV 539          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk4 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 [Source:MGI Symbol;Acc:MGI:1330292])

HSP 1 Score: 437.958 bits (1125), Expect = 6.715e-145
Identity = 205/385 (53.25%), Postives = 272/385 (70.65%), Query Frame = 2
Query:  539 KNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            K P+    A+K + N+L+ +E  EI  Y E++F+G  AKK   V        +DDE  SY+ V HDHIAYR+EV++++GKGSFGQV K  DHK N  VALK+IRN+KRF  QA  E++ILE L+++D  +NHN+VH+ + F FRNH+C+TFELL INLYEL+K N F GF+L +VR+F  SIL CL +L+  K+IHCDLKPENI+L Q+G+  +KVIDFGSSCYEHQ++YTYIQSRFYR+PEVILG PYNM IDMWS GCI+AEL+TG PLFPGE+E +QLACI+E+LG+PP    + + R ++F +S+G P+  N               + RG  R P  +   ++++    D SF+ FL+RCL W P  RMTP +ALK  W+
Sbjct:  148 KVPLTVAEALKFFKNQLSPYEQSEILGYSELWFLGLEAKKLNVVPEKFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHHQALVELKILEALRRKDKDNNHNVVHMKDFFYFRNHLCITFELLGINLYELMKNNSFHGFNLSIVRRFTFSILKCLHMLYVEKIIHCDLKPENIVLYQRGQVTVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIMEVLGLPPAHFTQTASRRQVFFDSKGLPKNIN---------------NNRGGKRYP--DSKDLTMVVKTYDSSFLDFLRRCLVWEPSLRMTPEQALKHAWI 515          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 293.893 bits (751), Expect = 1.466e-89
Identity = 152/356 (42.70%), Postives = 214/356 (60.11%), Query Frame = 2
Query:  686 NCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKM--IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGP---------------PGNKSIVSLLKNCSDH-SFVSFLKRCLQWLPQDRMTPREALKQEWLRR 1699
            N GYDD+ + Y+    +    R+E+  ++GKGSFGQVVKAYDH+    VA+K+I+N+K F  QA  E+R+LE + + D    + IVH+   F FRNH+C+ FELL+ NLY+L++   F+G SL L RK A  +   L  L   ++  IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG+PY++ IDMWS GCIL E+ TG PLF G +E DQ++ I+E+LGIPP  ++E + +A+ +            E    G   L+  +  R  Y+GP               PG +       + +D+  F   + R L++ P  R++P  AL+  + RR
Sbjct:   89 NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKY-----------FERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 433          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 294.278 bits (752), Expect = 4.371e-89
Identity = 152/356 (42.70%), Postives = 214/356 (60.11%), Query Frame = 2
Query:  686 NCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKM--IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGP---------------PGNKSIVSLLKNCSDH-SFVSFLKRCLQWLPQDRMTPREALKQEWLRR 1699
            N GYDD+ + Y+    +    R+E+  ++GKGSFGQVVKAYDH+    VA+K+I+N+K F  QA  E+R+LE + + D    + IVH+   F FRNH+C+ FELL+ NLY+L++   F+G SL L RK A  +   L  L   ++  IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG+PY++ IDMWS GCIL E+ TG PLF G +E DQ++ I+E+LGIPP  ++E + +A+ +            E    G   L+  +  R  Y+GP               PG +       + +D+  F   + R L++ P  R++P  AL+  + RR
Sbjct:  149 NHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKY-----------FERLPGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRR 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q92630|DYRK2_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 293/469 (62.47%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  317 YRESDNKNVFLDT-----SQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + ++ NK   L T     + +   G PVV    L         DS   +Q   +S  SM                G  +  P+  E AMK YM KLT+FEHHEIFSYPEIYF+G NAKKR G+ GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKRAK F++S+GYPRYC +   +DG ++L G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:   94 FEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQL---------DSIHRRQGSSTSLKSMEG-------------MGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP 540          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q5U4C9|DYRK2_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 285/434 (65.67%), Postives = 343/434 (79.03%), Query Frame = 2
Query:  449 QSRGSSTISMTA--SFTKDSLTNVSRRAGS------------YEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            Q  G +T+  T      +  L ++ RR GS             + +P+  E AMK YM KLT+FEHHEIFSYPEIYF+G NAKKR G+ GG +N GYDD+Q SYV V HDH+AYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRS IKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L++ SKRAK F++S+GYPRYC +   +DG ++L G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  105 QPNGLTTVGKTGLPGVPERQLESIHRRQGSSTSLKSMEGMGKVKASPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGPNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSSIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP 538          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q5ZIU3|DYRK2_CHICK (Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus OX=9031 GN=DYRK2 PE=2 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 279/395 (70.63%), Postives = 331/395 (83.80%), Query Frame = 2
Query:  524 AGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
             G  + + +  E AMK YM KLT+FEH+EIF Y EIYF+G NAKKR GV+GG +NCGYDD+Q SY+ V HDHIAYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  +N N++H+LE+FTFR+H+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILG+ Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P   L+++SKRAK F++S+GYPRYC I   +DG IIL G RS+RGK RGPP ++   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:   71 TGKVKASVMTPEQAMKQYMQKLTTFEHNEIFGYTEIYFLGPNAKKRQGVIGGPNNCGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKMHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNNMNVIHMLENFTFRSHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSPKLLDSSKRAKNFVSSKGYPRYCTITTLSDGSIILNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAIRMTPSQALRHPWLRRRLP 465          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q922Y0|DYRK3_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 276/445 (62.02%), Postives = 335/445 (75.28%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNH-SQDNCPSTAV 1744
            R  N + S  +  S  SS  S   S    S    +  +   +  P+  E A+K Y + LT++E  EI SYPEIYFVG NAKKR GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILG  Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC+IELLG+PP+ L+E SKRAK FINS+G PRYC++   TDG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCLQW P  R+TP +AL+  W+ +  P   + D  P   V
Sbjct:   95 RRSNTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRV 539          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Match: sp|Q4V8A3|DYRK3_RAT (Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus OX=10116 GN=Dyrk3 PE=2 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 275/434 (63.36%), Postives = 332/434 (76.50%), Query Frame = 2
Query:  413 RTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKN--PINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            R  + + S  +  S  SS  S   S   DSL  V     S      P+  E A+K Y + LT++E  EI SYPEIYFVG NAKKR GV+GG +N GYDD   +Y++V  DH+AYR+EV+KI+GKGSFGQV + YDHK   YVALKM+RNEKRF RQAAEEIRILE+LKKQD + + N++H+LESFTFRNHVCM FELL+I+LYELIKKNKFQGFS+QLVRKFA SIL  LD LH+NK+IHCDLKPENILLK  GRS  KVIDFGSSC+E+Q++YTYIQSRFYRAPE+ILG  Y+  ID+WSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP+ L+E SKRAK FINS+G PRYC++   TDG ++L G RS+RGK RGPPG+K   + LK C D+ F+ FLKRCLQW P  R+TP +AL+  W+ +  P
Sbjct:   95 RRTSTLQSDGVSNSEKSSPASQGKS--SDSLGTVKCSLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIISYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVTTQTDGRVVLLGGRSRRGKKRGPPGSKDWAAALKGCDDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSAP 526          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A1I8JL07 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 281/387 (72.61%), Postives = 331/387 (85.53%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            +  ETAMKLYM KL++FEHHEIFS+P++YFVGQNA KR GV+GG +N GYDDEQ SY +  HDHI+YR+EV+KI+GKGSFGQV+K +DHK N  VALKM+RNEKRFTRQA+EEIRILE L +QD  ++HN+VHILE FTFRNHVC+TFELL++NLYELIKKNKFQGFSLQLVRKFAHSIL CLD+LHRNK+IHCDLKPENILLK QGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILG  Y M IDMWS GCILAEL+TG P+FPGEDE DQLAC +E+LG PP  L+E SKR ++F +SRG+PRYC++E D DG   LKG RS+RGK+RGPPG+K++ + L+ C D  F+ FL RCL W P +RMTP EAL+ +WL+R+ P
Sbjct: 1237 MTPETAMKLYMQKLSTFEHHEIFSFPQVYFVGQNANKRQGVVGGPNNSGYDDEQGSYQHTAHDHISYRYEVLKIIGKGSFGQVLKCHDHKTNSQVALKMVRNEKRFTRQASEEIRILEQLLRQDRDNSHNVVHILEHFTFRNHVCITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDMLHRNKIIHCDLKPENILLKCQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSLGCILAELYTGVPIFPGEDEGDQLACAMEVLGAPPTRLLEASKRTRVFFSSRGHPRYCSVETDADGATQLKGGRSRRGKFRGPPGSKTLSTALRGCEDRHFLDFLTRCLHWAPDERMTPHEALRHDWLKRRLP 1623          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A183ARR5 (Protein kinase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9651 PE=4 SV=1)

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 292/431 (67.75%), Postives = 346/431 (80.28%), Query Frame = 2
Query:  464 STISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFIN-SRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRR---KPPNHSQDNCPSTAV 1744
            ST +   + +  S+ N+    GS   N +  E AMKLY++KLT +EHHEIF YP+IYFVG NAKKR GV+G  +N GYDD+Q SY+   HDH+AYR+EV+KILGKGSFGQVVKAYDHK   YVALKM+RNEKRFT QAAEEIRILE LK+QD  +  N+VH+LE FTFRNHVCMTFELL++NLYELIK++KFQGF LQLVRKFAHSIL+CLD+LHRNK+IHCDLKPENILLKQQGRSGIKVIDFGSSCYE QRIYTYIQSRFYRAPEVILG  Y   ID+WSFGCILAEL TG PLFPGEDE DQLACIIELLG+PP+ L+E  +R K F + + GYPRYC +  D DG ++L+ ++SKRGK RG PG++S+V+ L  C D +F+ FL+RCLQWLP++RMTPREA + EWLRR   KPP        +T+V
Sbjct:  168 STTTHCPTSSSVSVPNLLPNGGS--GNGLTPEMAMKLYVHKLTPYEHHEIFGYPQIYFVGHNAKKRSGVLGAPNNGGYDDDQGSYLNTAHDHVAYRYEVLKILGKGSFGQVVKAYDHKTGTYVALKMVRNEKRFTHQAAEEIRILEQLKQQDKDNTRNVVHMLEHFTFRNHVCMTFELLSMNLYELIKRSKFQGFPLQLVRKFAHSILVCLDMLHRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCYESQRIYTYIQSRFYRAPEVILGFKYGSAIDIWSFGCILAELLTGAPLFPGEDEGDQLACIIELLGMPPQKLLEQCRRVKHFFSTTHGYPRYC-MATDADGRVVLRPSKSKRGKLRGTPGSRSLVTALNGCEDAAFLDFLRRCLQWLPEERMTPREAFRHEWLRRRLPKPPATGNTTSSATSV 595          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A3Q1JSB3 (Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 307/514 (59.73%), Postives = 376/514 (73.15%), Query Frame = 2
Query:  317 YRESDNKNVFLDTSQI--------INPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHENFLMNNACLVP 1834
            Y E+ NK   L TSQ           PG P+ +    A         S+P +  R  S  S  ++ +K  +            NP+++E  MK +M+K++SFEHHE+FS+PEIYFVG NAKKR GVMGG +N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKA+DHK   +VALKM+RNEKRF RQAAEEIRILE+L+KQD  S+ N++H++E+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLDLLHR ++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILGS Y M IDMWS GCILAEL TG PL PGEDEADQLACIIELLG+P + L+E SKRAK F++S+GYPRYC +    D   +L G RS+RGK RGPPG+K   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P       P T   G    ++T++  R   +E+ + + + L P
Sbjct:   73 YEENTNKRPVL-TSQPNGLAPLNSSRPGLPLPDRQSSA---------SEPAQHCRQGSATSNKSTDSKPKV------------NPMSAEQVMKQFMSKMSSFEHHEVFSFPEIYFVGPNAKKRSGVMGGANNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKLQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSSMNVIHMMENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDLLHRTRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLEGSKRAKNFVSSKGYPRYCTVTTLPDSSTVLNGGRSRRGKVRGPPGSKDWSAALKGCDDPLFLDFLKQCLEWDPALRMTPSQALRHPWLRRRLPK------PPT---GTTTGEKTSSSKRGTANESAISSISKLAP 555          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: I3KNL6 (Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 OS=Oreochromis niloticus OX=8128 GN=dyrk2 PE=4 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 300/468 (64.10%), Postives = 359/468 (76.71%), Query Frame = 2
Query:  317 YRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRR---KPPN 1711
            Y E+ NK   L TSQ  N   P+  +     +  +    S+P    R SS  S  ++  K  +            NP+  E AMK +M+K++SFEHHE+FSYPE+YFVGQNAKKR GV+GG +N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKA+DHK   +VALKM+RNEKRF RQAAEEIRILE+LKKQD  S+ N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILGS Y M IDMWS GCILAEL TG PL PGEDEADQLACIIELLG+P + L++ SKRAK F++S+GYPRYC +    DG  +L   RS+RGK RGPPG+K   + LK C D  F+ FLK+CL+W P  R+TP  AL+  WLRR   KPP+
Sbjct:   73 YEENTNKRPVL-TSQP-NGLAPISSSRPGLPLPDRQTSASEPAHHHRQSSAASNKSTDNKPKV------------NPMTPEQAMKQFMSKISSFEHHEVFSYPEVYFVGQNAKKRQGVIGGANNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKLLDGSKRAKNFVSSKGYPRYCTVTTLPDGTTVLNSGRSRRGKMRGPPGSKDWSTALKGCDDAHFIDFLKQCLEWDPALRITPNHALRHPWLRRRLPKPPS 526          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Match: A0A267DM35 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033881g1 PE=4 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 281/389 (72.24%), Postives = 332/389 (85.35%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            + +  ETAMKLYM KL++FEHHEIFS+P++YFVGQNA KR GV+GG +N GYDDEQ SY +  HDHI+YR+EV+KI+GKGSFGQV+K +DHK N  VALKM+RNEKRFTRQA+EEIRILE L +QD  ++HN+VHILE FTFRNHVC+TFELL++NLYELIKKNKFQGFSLQLVRKFAHSIL CLD+LHRNK+IHCDLKPENILLK QGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILG  Y M IDMWS GCILAEL+TG P+FPGEDE DQLAC +E+LG PP  L+E SKR ++F +SRG+PRYC++E D DG   LKG RS+RGK+RGPPG+K++ + L+ C D  F+ FL RCL W P +RMTP EAL+ +WL+R+ P
Sbjct:  142 HAMTPETAMKLYMQKLSTFEHHEIFSFPQVYFVGQNANKRQGVVGGPNNSGYDDEQGSYQHTAHDHISYRYEVLKIIGKGSFGQVLKCHDHKTNSQVALKMVRNEKRFTRQASEEIRILEQLLRQDRDNSHNVVHILEHFTFRNHVCITFELLSMNLYELIKKNKFQGFSLQLVRKFAHSILQCLDMLHRNKIIHCDLKPENILLKCQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSLGCILAELYTGVPIFPGEDEGDQLACAMEVLGAPPTRLLEASKRTRVFFSSRGHPRYCSVETDADGATQLKGGRSRRGKFRGPPGSKTLSTALRGCEDRHFLDFLTRCLHWAPDERMTPHEALRHDWLKRRLP 530          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:103042530])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 283/410 (69.02%), Postives = 339/410 (82.68%), Query Frame = 2
Query:  479 TASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            T    + S T++       +  P+  E AMK Y++KL++FEH EIF+YPEI+FVG NAKKR GV+GG++N GYDD+Q SY++V HDHIAYR+EV+K++GKGSFGQVVKAYDHK + +VALKM+RNEKRF RQAAEEIRILE+L+KQD  S  N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQR+YTYIQSRFYRAPEVILGS Y M IDMWS GCILAEL TG PL PGEDE DQLAC+IELLG+P + L+++SKRAK FI+S+GYPRYC +    DG + L G RS+RGK RGPPG+K  V+ LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P
Sbjct:  116 TTQCRQGSSTSIKSTDSKPKPAPLTPEQAMKQYLSKLSTFEHQEIFNYPEIFFVGPNAKKRPGVVGGSNNGGYDDDQGSYIHVPHDHIAYRYEVLKVIGKGSFGQVVKAYDHKTHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDSTMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACVIELLGMPSQKLLDSSKRAKNFISSKGYPRYCTVTSLPDGTVALNGGRSRRGKLRGPPGSKDWVTALKGCDDPLFLDFLKQCLEWDPTLRMTPSQALRHPWLRRRLP 525          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 264/389 (67.87%), Postives = 325/389 (83.55%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
             P+ +E A+K Y  +LT+ E  E+ +Y EI+FVG NAKKR  V GG++NCGYDD+Q  Y++V HDHIAYR+E +K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ L R+K+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP+ L+E +KRAK FINS+G+PRYC +   ++G ++L G+RS+RGK RGPPG+K  V+ LK C D +F+ FL++CL W P  RMTP  AL+  WL ++ P
Sbjct:  134 GPLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTTLSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLP 522          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:103034036])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 264/389 (67.87%), Postives = 325/389 (83.55%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
             P+ +E A+K Y  +LT+ E  E+ +Y EI+FVG NAKKR  V GG++NCGYDD+Q  Y++V HDHIAYR+E +K++GKGSFGQV K YDHK + ++ALKM+RNEKRF RQAAEEIRILE+LKKQD + + N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ L R+K+IHCDLKPENILLKQQGRSGIKVIDFGSSC++HQR+YTYIQSRFYRAPEVILGS Y M IDMWSFGCILAEL TG PLFPGEDE DQLAC++ELLG+PP+ L+E +KRAK FINS+G+PRYC +   ++G ++L G+RS+RGK RGPPG+K  V+ LK C D +F+ FL++CL W P  RMTP  AL+  WL ++ P
Sbjct:  126 GPLGAEQALKQYRQQLTAMEQQEVHNYSEIFFVGPNAKKRQAVAGGSNNCGYDDDQGGYIHVPHDHIAYRYEFLKVIGKGSFGQVAKVYDHKLHQHLALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALQRHKIIHCDLKPENILLKQQGRSGIKVIDFGSSCFDHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACMMELLGMPPQKLLEQAKRAKNFINSKGHPRYCTVTTLSNGTLVLNGSRSRRGKMRGPPGSKEWVTALKGCDDPTFIDFLRKCLDWEPSTRMTPVSALRHPWLYKRLP 514          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 465.307 bits (1196), Expect = 9.669e-156
Identity = 218/414 (52.66%), Postives = 298/414 (71.98%), Query Frame = 2
Query:  458 GSSTISMTASFTKDSLTNVSRRAGSYE--KNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            GSS  +++ S T+ S+ N   +  +YE  + P++   A+K + ++LT +E  EI  Y EI+++G + KK  G  G   N GYDDE  SY+ V HDHIAYR+EV++++GKGSFGQV+K  DHK N  VA+K+IRN+KRF +QA  E++IL+ ++++D  S HN++H+ E F FRNH+C++FELL  NLYELIKKN FQGFSL L+R+FAHS+L CL +LHR K+IHCDLKPENILL Q+G+  IKV+DFGSSCYE QR+YTYIQSRFYR+PEVILG PY+M IDMWS GCILAEL+TG PLFPGE E +Q+ACI+E++G+PP   ++ + R ++F +S+G PR                  + +GK R  P +K + S+LK  +D  F+ F++RCL W P  RMTP E ++ EW+
Sbjct:  100 GSSVDNISESLTR-SIINKFEKIRTYEGQRLPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVT---------------NSKGKKRR-PNSKELASVLKT-NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWI 495          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 466.463 bits (1199), Expect = 9.999e-156
Identity = 243/527 (46.11%), Postives = 334/527 (63.38%), Query Frame = 2
Query:  128 GNNNLTNAKSDPQLAAKRNFGNIQNFQYNNINDEMSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQ--SR-GSSTISMTASFTKDSLTNVSRRAGSYE--KNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            G+ N  N +  P+ A    F + Q  Q      E +    N N S K  G   GT    +             L  S  I    P +   L+  V+       +P  Q  +R GSS  +++ S T+ S+ N   +  +YE  + P++   A+K + ++LT +E  EI  Y EI+++G + KK  G  G   N GYDDE  SY+ V HDHIAYR+EV++++GKGSFGQV+K  DHK N  VA+K+IRN+KRF +QA  E++IL+ ++++D  S HN++H+ E F FRNH+C++FELL  NLYELIKKN FQGFSL L+R+FAHS+L CL +LHR K+IHCDLKPENILL Q+G+  IKV+DFGSSCYE QR+YTYIQSRFYR+PEVILG PY+M IDMWS GCILAEL+TG PLFPGE E +Q+ACI+E++G+PP   ++ + R ++F +S+G PR                  + +GK R  P +K + S+LK  +D  F+ F++RCL W P  RMTP E ++ EW+
Sbjct:   21 GSQNRRNRRVQPEAARPEAFPHPQRLQA-----ESTRLGTNRNYSQKC-GTETGTLPQLDPPVKPVVVPNGKLLHQSDGI---LPNIVKQLVQNVQQSQEERERPRPQFPARFGSSVDNISESLTR-SIINKFEKIRTYEGQRLPMSPTAALKHFQSQLTEYEQEEIMDYSEIWYLGLDTKKIEGCQGSPQNSGYDDEHGSYLKVLHDHIAYRYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRDSCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGNPRNVT---------------NSKGKKRR-PNSKELASVLKT-NDPLFLDFIRRCLVWDPTKRMTPDEGMQHEWI 520          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 259/380 (68.16%), Postives = 317/380 (83.42%), Query Frame = 2
Query:  551 NSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEW 1690
            + + A++LY  KLT++EH EI++Y EIYFVG NAKKR GV+GG  NCGYDDEQ SYV+V HDH+AYR+EV+K++GKGSFGQVVKA+DHK   +VALKM+RNEKRF RQAAEEIRILE+L+KQD  ++ NI+H+LESFTFR HVCMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LHRN++IHCDLKPENILLKQ GRSGIKVIDFGSSC+EHQR+YTYIQSRFYRAPEV+LG+ Y   IDMWS GCILAEL TG+PL PGEDE DQLAC +ELLG+PP+ L+   KR++ F++SRG+PRYC +    DG ++L   RS+RGK RGPPG++ + + L+ C D   + FL+ CL+W P +R+TP +AL+  W
Sbjct:   95 SPDQAVRLYGQKLTAYEHQEIYNYAEIYFVGHNAKKRPGVVGGASNCGYDDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 258/389 (66.32%), Postives = 317/389 (81.49%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIK-VIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPN 1711
            ++ E AM+ YM++L+ FEHHEIF+Y E+YFVG +AKKR   + G +N G+DDEQ SY++V HDH+AYR+EV++++GKGSFGQVVKAYDH+ + YVALKM+RNEKRF RQAAEEIRILE+LKKQD  +  N++H+LESF FRNH+CMTFELL++NLYELIKKNKFQGFSLQ+VRKFAHSILLCL+ LH+N++IHCDLKPENILL+QQGRSGIK +IDFGSSCYEHQR+YTYIQSRFYRAP    G  Y + IDMWS GCILAEL TG+PL PGEDE DQLAC +EL G PP  L+E SKRA+ F +S G+PRYC +     G ++L G R++RGK RGPP ++   + LK C DH F+ FLK+CL W P  R+TP +ALK  WLRR+P N
Sbjct:  104 MSPEQAMRKYMHRLSMFEHHEIFNYHEVYFVGPSAKKRQATLSGVNNNGFDDEQGSYIHVPHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTMNVIHMLESFNFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHKNRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTLPGGPVVLNGGRTRRGKLRGPPSSRDWTTALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWLRRRPLN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 287.73 bits (735), Expect = 1.275e-86
Identity = 145/335 (43.28%), Postives = 206/335 (61.49%), Query Frame = 2
Query:  749 RFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKM--IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYR---------------GPPGNKSIVSLLKNCSDH-SFVSFLKRCLQWLPQDRMTPREALKQEWLRR 1699
            R+E+  ++GKGSFGQVVKAYDH+   +VA+K+I+N+K F  QA  E+R+LE + K D    + IVH+   F FRNH+C+ FELL+ NLY+L++   F+G SL L RKFA  +   L  L   ++  IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG PY++ IDMWS GCIL E+ TG PLF G +E DQ+  I+E+LG+PP  ++E + +A+ +            E  +DG   +K  +  + +Y+               G PG + +       +D+  F   + R L + P+ R+TP  AL+  + ++
Sbjct:  161 RYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKY-----------FERLSDGSWTVKKTKDSKREYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKK 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 3.229e-76
Identity = 138/331 (41.69%), Postives = 195/331 (58.91%), Query Frame = 2
Query:  725 VGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQA-AEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLR--RKPP 1708
            V H+H+ YR+EV+++LG+GSFG+V+K  DHK   +VA+K++ N  RF       EI IL+ L+    SS   I+ ++E F+FR   C+ FELLN NL   +K    QGF L++VR FA S+L  L+ L    +IH DLKP NI +       +K+ DFG SC++H+  +T IQ+R YRAPEVIL   Y+   DMWS GC LAEL +G  LFPG    DQL  I+E+ G+PP+ +IE S+    F   + +    N+             R  RG  R  PG++++   L+   +H F  F++ CLQW P+ R+TP  A+  EW+R  R PP
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACKDFS--SNV-------------RLNRGLVR-VPGSRALPLALRTTDEH-FTDFIRSCLQWDPEWRLTPHGAMDHEWVRAPRMPP 312          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 3.068e-75
Identity = 135/325 (41.54%), Postives = 194/325 (59.69%), Query Frame = 2
Query:  725 VGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQA-AEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLR 1696
            V H+H+ YR+EV+++LG+GSFG+V+K  DHK   +VA+K++ N  RF       EI IL+ L+    SS   I+ ++E F+FR   C+ FELLN NL   +K    QGF L++VR FA S+L  L+ L    +IH DLKP NI +       +K+ DFG SC++H+  +T IQ+R YRAPEVIL   Y+   DMWS GC LAEL +G  LFPG    DQL  I+E+ G+PP+ +IE S R ++   +   P + +I              + RG  R  PG++++   L+   +H F  F++ CLQW P+ R+TP  A+  EW+R
Sbjct:    2 VWHEHLLYRYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEES-RVQLGFFAITKPTHWDIN-------------NHRGLVR-VPGSRALPLALRTTDEH-FTDFIRSCLQWDPEWRLTPHGAMDHEWVR 307          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 259.225 bits (661), Expect = 4.671e-76
Identity = 141/347 (40.63%), Postives = 207/347 (59.65%), Query Frame = 2
Query:  449 QSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSY----PEIYFVGQNAKKRYGVMGGTHNC--GYDDEQNSYVYVGHDHIAY----RFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENL-KKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFI 1456
            Q +  S   M    +K+ L  V      + +  +NS+T     ++ L S     I +Y    PE  +      KR         C  G+D+  + Y+   +D +      ++ V+ ILG+G+FGQVVK  +      +A+K++++   +  Q+  E +ILE L +K DP++ H+ + + +SF  +NH+C+ FELL+ NLYEL+K+NKF G S+QL+R F   IL  L +L  +K+IHCDLKPENILL    +  +K+IDFGSSC E + +YTYIQSRFYRAPE+ILG PY+  IDMWS GCI+AEL+ G P+FPG  E +QL  II+ LG PP  +I+  K +  F+
Sbjct:  263 QGQKLSIPQMQLCNSKNDLQPVLNATPKFRRASLNSKT-----ISPLVSVTKSLITTYSLCSPEFTYQTSKNPKRVLTKPSEGKCNNGFDNINSDYILYVNDVLGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFM 604          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 150.599 bits (379), Expect = 1.747e-38
Identity = 90/289 (31.14%), Postives = 146/289 (50.52%), Query Frame = 2
Query:  701 DEQNSYVYVGHDHIAY--RFEVVKILGKGSFGQVVKAYDHKYNI-YVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILL---------------------KQQGRSG---------IKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIP-PKSLIENSKRAKMFINSR 1465
            D+   YVY  +D      RF V  +LG+G+FG+V+K  D+KY   YVA+K+IR   R+   A  E+RIL+ +   DP      + + E F ++NH+C+  +L   ++Y+ +  N    F    ++  A  ++  +  LH   +IH DLKPENIL+                     +++   G         IK+IDFGS+ + ++     I +R YRAPE++LG  ++   D+WS  C+L EL  G  L+P  +  + +A +  + G P P  +I+     KMF  S+
Sbjct:  294 DKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIID-----KMFYKSK 577          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 135.576 bits (340), Expect = 7.034e-36
Identity = 97/328 (29.57%), Postives = 168/328 (51.22%), Query Frame = 2
Query:  749 RFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIR--NEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKK----NKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTY---IQSRFYRAPEVILGS-PYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRY-CNIEVDTDGHIILKGNRSKRGKYRGPPGN--KSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            +F+ ++ LG G++  V K  +    +YVALK ++  +E+     A  EI +++ LK +      NIV + +     N + + FE ++ +L + +      N  +G  L LV+ F   +L  L   H NK++H DLKP+N+L+ ++G+  +K+ DFG +      + T+   + + +YRAP+V++GS  Y+  ID+WS GCILAE+ TG PLFPG ++ +QL  I +++G P +SL  +  +          P+Y  NI+                   + PP +  + +    K   D + + FL   LQ  P  R++ ++AL   W 
Sbjct:    6 QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHE------NIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQ--LKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTK---------LPKYNPNIQ-------------------QRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 124.02 bits (310), Expect = 2.870e-31
Identity = 102/340 (30.00%), Postives = 164/340 (48.24%), Query Frame = 2
Query:  740 IAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIR--NEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILE-----SFTFRNHVCMTFELLNINLYELI--KKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFG-SSCYEHQR---------IYTYIQSRFYRAPEVILG-SPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIEN--SKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            I  ++++V ++G+G++G V  A      I VA+K I+  ++K F  +   EI++L    + +     NI+ IL+     S    N V +  EL+  +L ++I  + + F   S   V+ F + IL  L  +H  ++IH D+KP N+LL       +KV DFG + C              +  Y+ +R+YRAPE++L    Y   +D+WS GCILAE+ +G PLFPG D   QL  I+E+LG P         SKRAK +I         N+ +                  R P   +++ S  K   +   +  L + LQ+ P  R++  EAL+  +L
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHE-----NIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYI--------ANLPM------------------RPPLPWETVWS--KTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 124.02 bits (310), Expect = 9.265e-31
Identity = 77/234 (32.91%), Postives = 127/234 (54.27%), Query Frame = 2
Query:  740 IAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIR---NEKRFTRQAAEEIRILENLKKQDPSSNHNI-VHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILG-SPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLI 1426
            I  R+  +  +G G+FG V  A D   +  VA+K I    +     ++   E+++L++L+ ++     +I +  LE   F        EL   +L+ L++    +    Q V+ F + IL  L  +H   +IH DLKP NIL+ +     +K+ DFG +  +  ++  Y+ +R+YRAPE++L    Y++ +D+WS GCI AE+  G PLFPG+D   Q + I +LLG PPK +I
Sbjct:   19 ITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVT------ELQGTDLHRLLQTRPLEK---QFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINEN--CDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVI 241          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 292/428 (68.22%), Postives = 337/428 (78.74%), Query Frame = 2
Query:  434 SKPLKQSRGSSTISMTASFTKDSLTNVSRR-----AGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRK 1702
            S P+    G  ++S T      S + + RR      GS +     +E AMK YM+KL+ +E HEIF+Y +IYFVG+ AKKR GV+GG +NCGYDDEQ SY++V  DHIAYR+EV+KI+GKGSFGQVVKA DHK N +VALKM+RNEKRF RQA EEIRILE+LKKQD  + HNI+H+LE FTFRNHVCMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILG+ Y M IDMWSFGCILAEL TG PLFPGEDE DQLAC +ELLG  P+ L E SKRAK FINS+GYPRYC I    DG + + G RS+RGK RG P +K+ V  LK C D  F+ FLKRCL+W P  RMTP +AL+  WLRR+
Sbjct:   60 SMPVVHDHGLPSVSRTGR----SPSVIERRQSSNSTGSQKSRSFTAEVAMKQYMHKLSGYETHEIFNYSQIYFVGEAAKKRQGVVGGANNCGYDDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVAVSGGRSRRGKTRGAPNSKTFVQALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRR 483          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 434.876 bits (1117), Expect = 2.026e-148
Identity = 203/353 (57.51%), Postives = 273/353 (77.34%), Query Frame = 2
Query:  581 NKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQ 1639
            +++T+FE  EI  YPE++F+G +AKK  GV G   N  YDD+  SY+   HDH+AYR+EV+++LGKGSFGQVVKA DHK   +VA+K+IRN+KRF +QA  E++IL+NL+K+D  + HN++H++E F FRNH+C+TFEL+ +NLYELIKKN FQGFSL L+R+FA ++L CL ++H+ K+IHCDLKPENILL+Q+G++ IKVIDFGSSCYEHQR+YTYIQSRFYR+PEVILG PY+M IDMWSFGCILAEL+TG PLFPGE+E +QLACI+E+LG+P   LIE++ R ++F +S+G PR                  + +GK R  P ++ I + LK  +D  F+ FLK+CL+
Sbjct:    3 DRITTFEQSEILDYPEVWFLGLDAKKIDGVPGAPQNNNYDDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFDSKGIPRCIT---------------NSKGKKR-RPSSRDISAALKT-NDALFLDFLKQCLE 338          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 285.804 bits (730), Expect = 2.677e-89
Identity = 154/365 (42.19%), Postives = 218/365 (59.73%), Query Frame = 2
Query:  683 HNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKM--IHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEV-DTDGHIILKGNRSKR---GKYRGPPGNKSIVSLLKNCSDH-SFVSFLKRCLQWLPQDRMTPREALKQEWLRRKP-----PNHSQDNCPSTA 1741
            +N GYDDE   Y+    +    R+E+  ++GKGSFGQV KAYDH+   ++A+K+I+N+K F  QA  E+++LE + K DP   + IV +   F +RNH+C+ FELL+ NLY+L++   F+G SL L RKFA  +   L  L   ++  IHCDLKPENILL    RS IK++DFGSSC   QRIY YIQSRFYR+PEV+LG PYN+ IDMWS GCIL E+ TG PLF G +E DQ+  I+E+LG+PPK +++N+ +A+ F +      Y  ++V D     +  G+R      G   G PG + +        D+  F   + R L +  + R+ P  AL   + ++         HS  N P+  
Sbjct:   56 YNDGYDDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCLKVKDGVKEYLSPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKKTAEEGTNTTHSATNSPAMG 420          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 205.297 bits (521), Expect = 4.979e-60
Identity = 124/337 (36.80%), Postives = 183/337 (54.30%), Query Frame = 2
Query:  758 VVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILL----KQQGRSGIKVIDFGSSCYEHQRI-YTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKR-GKYRGPPGNKSIVSLLKNCSD-------------------HSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            V++ LG+G+FGQVVK +    N  VA+K++++   + RQ   EI IL  L  ++ S  +N V  +E F  +NH C+ FE+L  NLY+ +K++KF    L+ +R     +L+ L  L    +IH DLKPENI+L    KQ  R  +KVIDFGS+ +  + +  TY+QSR+YRAPEVILG P+   IDMWS GC++AEL+ G PL+PG  E DQ+  II+  G+P   L+ N+ +      SR + +  N         +   N  +R  K       K I + L + +                    + FVS LKR L    + R+TP EAL  +++
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSAEN-SEAYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFR--VKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATK-----TSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFV 329          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 183.726 bits (465), Expect = 5.221e-51
Identity = 105/350 (30.00%), Postives = 184/350 (52.57%), Query Frame = 2
Query:  698 DDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILL-------------KQQGR----SGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHS-FVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            DDE    +Y   D +  R+EV  +LG+G+FG+V++ YD K    VA+K+I+N +++   A  EI++LE + +++       + +L+ F    H+C+ FE + +++++ +K N ++ + L  VR  ++ +++ +  LH  K+ H DLKPEN+L              KQ  R    S +++IDFGS+ +EH+   T + +R YRAPEVIL   ++   D+WS GCI+ EL+TG  LF   +  + LA +  ++G  P    + S++ K F   +       +E D          +S  GKY           +L +   H  F + L   L++ P+ R+T +EA++  + 
Sbjct:  107 DDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKGK-------LEWD---------EKSSSGKYVRENCKPLKKYMLSDSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:NCBI gene;Acc:101170635])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 283/421 (67.22%), Postives = 342/421 (81.24%), Query Frame = 2
Query:  473 SMTASFTKDSLTNVSRRAGSYEK-NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCP 1732
            S  A   + S    ++ A S  K NP+ +E AMK +M+K++SFEHHE+FS+ E+YF+G +AKKR GV+GG +N GYDD+Q SY+ V HDHIAYR+EV+K++GKGSFGQVVKA+DHK   +VALKM+RNEKRF RQAAEEIRILE+LKKQD  S+ N++H+LE+FTFRNH+CMTFELL++NLYELIKKNKFQGFSL LVRKFAHSIL CLD LH+N++IHCDLKPENILLKQQGRSGIKVIDFGSSC+EHQR+YTYIQSRFYRAPEVILGS Y M IDMWS GCILAEL TG PL PGEDEADQLACIIELLG+P + +++ SKRAK F++S+GYPRYC +   +DG  +L G RS+RGK RGPPG+K   + LK C D  F+ FLK+CL+W P  RMTP +AL+  WLRR+ P       P
Sbjct:   99 SEAAQHGRQSSATSNKPADSKPKTNPLTAEQAMKQFMSKMSSFEHHEVFSFSEVYFIGPSAKKRSGVLGGPNNGGYDDDQGSYIQVPHDHIAYRYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLKKQDKDSSMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEADQLACIIELLGMPSQKILDASKRAKNFVSSKGYPRYCTVTTLSDGTTVLNGGRSRRGKVRGPPGSKVWSTALKGCDDPLFLDFLKQCLEWDPAHRMTPSQALRHSWLRRRLPKPPTGTTP 519          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 318/395 (80.51%), Query Frame = 2
Query:  524 AGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            +GS    P+  + A++LY ++L+  E  EI SYP++YFVG NAKKR  V GG++NCGYDDEQ  Y++V HDH+AYR+E +KI+GKGSFGQV K YDHK   ++ALKM+RNEKRF RQA EEIRILE+L KQD +   N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ L R+++IHCDLKPENILLKQQGRSGIKVIDFGSSC+EHQR+YTYIQSRFYRAPEVILGS Y + IDMWSFGCILAEL TG PLFPGEDE+DQLAC +ELLG+PP  ++E +KRAK FINS+G+PRYC       G  +L G+RS+RGK RGPP +K     LK C D +F+ F+K+CL W P  R+TP +AL+  WL R+ P
Sbjct:  142 SGSKMCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLP 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 318/395 (80.51%), Query Frame = 2
Query:  524 AGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPP 1708
            +GS    P+  + A++LY ++L+  E  EI SYP++YFVG NAKKR  V GG++NCGYDDEQ  Y++V HDH+AYR+E +KI+GKGSFGQV K YDHK   ++ALKM+RNEKRF RQA EEIRILE+L KQD +   N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ L R+++IHCDLKPENILLKQQGRSGIKVIDFGSSC+EHQR+YTYIQSRFYRAPEVILGS Y + IDMWSFGCILAEL TG PLFPGEDE+DQLAC +ELLG+PP  ++E +KRAK FINS+G+PRYC       G  +L G+RS+RGK RGPP +K     LK C D +F+ F+K+CL W P  R+TP +AL+  WL R+ P
Sbjct:  142 SGSKMCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLP 536          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk3 (dual specificity tyrosine-phosphorylation-regulated kinase 2 [Source:NCBI gene;Acc:101157613])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 271/456 (59.43%), Postives = 336/456 (73.68%), Query Frame = 2
Query:  524 AGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL-RRKP-----------------PNHSQDNCPSTAVDGDLIYKETATGDRIGVHENFLMNNACLVPV 1837
            +GS    P+  + A++LY ++L+  E  EI SYP++YFVG NAKKR  V GG++NCGYDDEQ  Y++V HDH+AYR+E +KI+GKGSFGQV K YDHK   ++ALKM+RNEKRF RQA EEIRILE+L KQD +   N+VH+LE+FTFRNH+CMTFELL++NLYELIK+NKFQGFSL LVRKFAHSIL CL+ L R+++IHCDLKPENILLKQQGRSGIKVIDFGSSC+EHQR+YTYIQSRFYRAPEVILGS Y + IDMWSFGCILAEL TG PLFPGEDE+DQLAC +ELLG+PP  ++E +KRAK FINS+G+PRYC       G  +L G+RS+RGK RGPP +K     LK C D +F+ F+K+CL W P  R+TP +AL+  WL RR P                 P+H   + PS    G      T   +++    N L ++   +P+
Sbjct:   84 SGSKMCGPLTPDQALRLYRSQLSPMELSEIHSYPDVYFVGPNAKKRPAVAGGSNNCGYDDEQGGYIHVPHDHLAYRYEFLKIIGKGSFGQVAKVYDHKLQQHLALKMVRNEKRFHRQAQEEIRILEHLHKQDRNGTMNVVHMLENFTFRNHICMTFELLSMNLYELIKRNKFQGFSLPLVRKFAHSILQCLEALSRHRIIHCDLKPENILLKQQGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVILGSRYGLPIDMWSFGCILAELLTGYPLFPGEDESDQLACAMELLGMPPLKVLEQAKRAKNFINSKGHPRYCGYNTLPTGATVLTGSRSRRGKMRGPPASKDWNVALKGCEDPTFIDFIKKCLDWDPLSRLTPSQALRHPWLYRRLPKPLAVTEKNQGAPVKRLPDHHSTSFPSILAKGGPALGSTPASNKL--RSNMLGDSGEAIPL 537          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 460.299 bits (1183), Expect = 6.993e-154
Identity = 215/391 (54.99%), Postives = 284/391 (72.63%), Query Frame = 2
Query:  521 RAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWL 1693
            +A   ++ P++   A+  +  +LT FE  EI +Y E++F+G  ++K  G  G  HN GYDDE  SY+ V HDHIAYRFEV++++GKGSFGQV+K  DHK N  VA+KMIRN+KRF  QA  E++ILE +KK+D  + HN++H+ E F FRNH+C++FELL +NLYELIKKN FQGFSL L+R+FAH++L CL +LH+ K+IHCDLKPENILL Q+G   IKV+DFGSSCYE QR+YTYIQSRFYR+PEVILG PY+M IDMWS GCILAEL TG PLFPGE E +Q+ACI+E+LG+PP   ++++ R K+F +S+G PR  NI              + +GK R  P +K + + LK  +D  F+ F+K CL W P  RMTP E L+ +W+
Sbjct:  123 KACEGQRLPMSPSEALNNFQERLTEFEQEEINAYAEVWFLGLGSQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDHKTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNLHNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPR--NI-------------TNSKGKKRR-PNSKELSAALKT-TDPLFLEFIKGCLTWDPTKRMTPDEGLQHQWI 496          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 1194.87 bits (3090), Expect = 0.000e+0
Identity = 568/571 (99.47%), Postives = 568/571 (99.47%), Query Frame = 2
Query:   92 MDKNIYLPWINSGNNNLTNAKSDPQLAAKRNFGNIQNFQYNNINDEMSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHEN 1804
            MDKNIYLPWINSGNNNLTNAKSDPQLAAKRNFGNIQNFQYNNINDEMSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNH QDNCPSTAVDGDLIYKETATGDRIG  EN
Sbjct:    1 MDKNIYLPWINSGNNNLTNAKSDPQLAAKRNFGNIQNFQYNNINDEMSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHFQDNCPSTAVDGDLIYKETATGDRIGAREN 571          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000042409.1 (SMESG000042409.1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 522/525 (99.43%), Postives = 522/525 (99.43%), Query Frame = 2
Query:  230 MSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTAVDGDLIYKETATGDRIGVHEN 1804
            MSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNH QDNCPSTAVDGDLIYKETATGDRIG  EN
Sbjct:    1 MSGEIINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVENNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEKNPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHFQDNCPSTAVDGDLIYKETATGDRIGAREN 525          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 289/403 (71.71%), Postives = 338/403 (83.87%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRK--PPNHSQDNCPSTAVDG 1750
            ++ ++AM+ +M+KLT++EHHEIFSYP I+FVG NAKKR GV+GGT+NCGYDD+QNSY++V HDHIAYR+EV+K+LGKGSFGQVVKA DHK    VA+KM+RNEKRFTRQAAEEIR+LE LKKQDP SN N++HI++ F FRNHVCMTFELL+INLYELIKKNKFQGFSLQLVRKFA+SILLCL+LL+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG  Y M IDMWSFGCILAEL+TG P+FPGEDE DQLACI+E+LG PP  L +  KR K+F  S+ YPRYC    D DG +ILKG RSKRG++RGPP +K++ + LKNC D  F+ F  RCL W+P+ RMTP+EALK  WLRRK  P N       S  +DG
Sbjct:  150 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 552          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000058389.1 (SMESG000058389.1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 289/403 (71.71%), Postives = 338/403 (83.87%), Query Frame = 2
Query:  548 INSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRK--PPNHSQDNCPSTAVDG 1750
            ++ ++AM+ +M+KLT++EHHEIFSYP I+FVG NAKKR GV+GGT+NCGYDD+QNSY++V HDHIAYR+EV+K+LGKGSFGQVVKA DHK    VA+KM+RNEKRFTRQAAEEIR+LE LKKQDP SN N++HI++ F FRNHVCMTFELL+INLYELIKKNKFQGFSLQLVRKFA+SILLCL+LL+RNK+IHCDLKPENILLKQQGRSGIKVIDFGSSC EHQRIYTYIQSRFYRAPEVILG  Y M IDMWSFGCILAEL+TG P+FPGEDE DQLACI+E+LG PP  L +  KR K+F  S+ YPRYC    D DG +ILKG RSKRG++RGPP +K++ + LKNC D  F+ F  RCL W+P+ RMTP+EALK  WLRRK  P N       S  +DG
Sbjct:  147 LSPDSAMRQFMSKLTTYEHHEIFSYPSIFFVGTNAKKRAGVLGGTNNCGYDDDQNSYIHVAHDHIAYRYEVLKLLGKGSFGQVVKALDHKTGECVAIKMVRNEKRFTRQAAEEIRLLELLKKQDPDSNCNVIHIIDQFIFRNHVCMTFELLSINLYELIKKNKFQGFSLQLVRKFAYSILLCLELLYRNKIIHCDLKPENILLKQQGRSGIKVIDFGSSCCEHQRIYTYIQSRFYRAPEVILGGKYGMPIDMWSFGCILAELYTGYPIFPGEDEGDQLACIMEILGQPPTKLTDICKRTKIFFTSQRYPRYCVQSTDADGSVILKGGRSKRGRFRGPPASKTLSTALKNCDDQLFLDFTLRCLTWIPETRMTPKEALKHPWLRRKQIPGNSITKTKYSNNIDG 549          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Match: SMESG000064198.1 (SMESG000064198.1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 279/424 (65.80%), Postives = 339/424 (79.95%), Query Frame = 2
Query:  542 NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNCGYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALKMIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTFELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNMMIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKRAKMFINSRGYPRYCNIEVDTD---GHII-------LKGNRSKRGKYRGPPGNKSIVSL-------------------LKNCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDN 1726
            +P+  + AMKLYM++L++FEHHEIF+YP+IYFVG NAKK++G+  G +N GYDDE  SY +V HDH++YR+E++KILGKGSFGQVVKAYDHK  ++VALKM+RNEKRF +QA EEI+ILE LK QD  +N NIVHILE FTFRNHVCMTFELLNINLY LIKKNKFQGFSL LV+KFA+SIL+CLDLLH+NK+IHCDLKPENILLKQQGRSGIKVIDFGSSCY+HQRIYTYIQSRFYRAPEVILG  Y++ IDMWSFGCIL E+ TG PLFPGEDE DQLACIIE+LG+PP++ ++  KR+K F  S+GYPRYC +E +T+   G  I       LKG +SKRGKYRG PG+KS+ S+                   LK+ ++  F++FL +CL+W+P DR TP+EAL+ EWLRRK P    +N
Sbjct:   76 SPLTPDQAMKLYMHRLSTFEHHEIFNYPQIYFVGHNAKKKHGISVGANNNGYDDEHGSYQHVAHDHVSYRYEILKILGKGSFGQVVKAYDHKTGMFVALKMVRNEKRFAKQALEEIKILEQLKIQDKDNNKNIVHILEHFTFRNHVCMTFELLNINLYSLIKKNKFQGFSLLLVKKFAYSILVCLDLLHKNKVIHCDLKPENILLKQQGRSGIKVIDFGSSCYDHQRIYTYIQSRFYRAPEVILGGKYSVQIDMWSFGCILVEMLTGYPLFPGEDEMDQLACIIEVLGMPPQNFLDQCKRSKEFFCSKGYPRYCQLETETETQSGKTIINGVVFYLKGCKSKRGKYRGSPGSKSLASIVNAMNPDLNSDANIDSEIQLKDFTN--FINFLLKCLEWVPDDRFTPKEALRHEWLRRKLPRPPDNN 497          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+062.47dual specificity tyrosine phosphorylation regulate... [more]
DYRK20.000e+062.47dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+061.61dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+061.61dual specificity tyrosine phosphorylation regulate... [more]
DYRK30.000e+061.61dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-20.000e+064.44Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+064.44Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+065.91Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+065.91Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-20.000e+064.44Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk32.931e-17863.57gene:FBgn0027101 transcript:FBtr0100406[more]
Dyrk32.931e-17863.57gene:FBgn0027101 transcript:FBtr0100404[more]
Dyrk32.931e-17863.57gene:FBgn0027101 transcript:FBtr0100402[more]
Dyrk21.699e-14051.55gene:FBgn0016930 transcript:FBtr0100447[more]
Dyrk21.699e-14051.55gene:FBgn0016930 transcript:FBtr0089289[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+068.40dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+068.40dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+068.40dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+067.35dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+067.35dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK20.000e+066.67dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+065.06dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+065.06dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+065.06dual specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk30.000e+065.06dual specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk20.000e+065.67dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk30.000e+062.02dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk46.715e-14553.25dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b1.466e-8942.70dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b4.371e-8942.70dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92630|DYRK2_HUMAN0.000e+062.47Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5U4C9|DYRK2_MOUSE0.000e+065.67Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q5ZIU3|DYRK2_CHICK0.000e+070.63Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q922Y0|DYRK3_MOUSE0.000e+062.02Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q4V8A3|DYRK3_RAT0.000e+063.36Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JL070.000e+072.61Protein kinase domain-containing protein OS=Macros... [more]
A0A183ARR50.000e+067.75Protein kinase domain-containing protein OS=Echino... [more]
A0A3Q1JSB30.000e+059.73Dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
I3KNL60.000e+064.10Dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
A0A267DM350.000e+072.24Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+069.02dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+067.87dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+067.87dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk49.669e-15652.66dual specificity tyrosine phosphorylation regulate... [more]
dyrk49.999e-15646.11dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+068.16dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk20.000e+066.32dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa1.275e-8643.28dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007952.13.229e-7641.69pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
ENSPMAT00000007958.13.068e-7541.54pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK14.671e-7640.63Serine-threonine protein kinase; component of a gl... [more]
KNS11.747e-3831.14Protein kinase involved in negative regulation of ... [more]
PHO857.034e-3629.57Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KSS12.870e-3130.00Mitogen-activated protein kinase (MAPK); involved ... [more]
HOG19.265e-3132.91Mitogen-activated protein kinase involved in osmor... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461440.000e+068.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362942.026e-14857.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451872.677e-8942.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492384.979e-6036.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337585.221e-5130.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk20.000e+067.22dual specificity tyrosine phosphorylation regulate... [more]
dyrk30.000e+066.08dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+066.08dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk30.000e+059.43dual specificity tyrosine-phosphorylation-regulate... [more]
dyrk46.993e-15454.99dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042409.10.000e+099.47SMESG000042409.1[more]
SMESG000042409.10.000e+099.43SMESG000042409.1[more]
SMESG000058389.10.000e+071.71SMESG000058389.1[more]
SMESG000058389.10.000e+071.71SMESG000058389.1[more]
SMESG000064198.10.000e+065.80SMESG000064198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002728 ID=SMED30002728|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2101bp
GGTATCTAAGCACTATTTTAAAATAATTATATTACTTTGACAATAAAGTT
TTTAATTTTAGATATTGTTGAAGAACAAATGCACTCAAAATATGGATAAA
AATATATATTTACCATGGATAAATTCAGGAAACAATAATTTAACGAACGC
AAAATCAGACCCACAGCTAGCAGCTAAAAGAAATTTTGGCAACATTCAAA
ATTTCCAGTATAATAATATAAATGATGAAATGTCGGGAGAAATAATCAAC
AACAATTTATCCTGCAAACTCAATGGAGATATTAATGGAACTAATCATAA
CACAAATGTTTTAAAATATAGAGAATCCGACAATAAAAATGTTTTCCTTG
ATACTTCACAGATTATAAATCCAGGATTTCCTGTTGTTGAAAATAATTTA
CTAGCCAAAGTACGAACAAAAAATATGGTTGATTCTAAACCTTTAAAACA
GAGTAGAGGATCTTCCACTATAAGTATGACAGCATCTTTTACAAAAGATT
CCTTGACAAATGTTTCAAGGCGAGCGGGTTCGTATGAAAAAAACCCAATC
AATTCTGAAACCGCTATGAAATTGTACATGAATAAATTAACATCGTTTGA
GCATCATGAAATATTTAGCTATCCTGAGATATATTTTGTTGGTCAAAATG
CTAAAAAGCGTTATGGGGTTATGGGTGGAACACATAACTGTGGATATGAT
GACGAACAGAACTCATATGTATACGTCGGACATGATCATATAGCTTATCG
ATTTGAAGTTGTCAAAATTCTAGGAAAGGGTAGTTTCGGTCAAGTGGTAA
AGGCATACGATCACAAATATAATATTTATGTTGCACTGAAAATGATACGA
AACGAAAAACGTTTTACGAGGCAAGCAGCGGAAGAAATTCGAATCCTTGA
AAATCTTAAAAAACAAGATCCGTCTTCAAATCACAATATTGTACATATTT
TAGAGAGCTTTACTTTCAGAAATCACGTCTGCATGACGTTTGAATTGTTG
AACATAAATCTTTATGAATTGATTAAAAAGAATAAATTCCAAGGGTTTTC
TTTGCAACTTGTTAGGAAATTTGCTCATTCAATTTTGCTGTGCTTGGATC
TTTTACATCGAAATAAAATGATCCACTGTGATTTGAAACCAGAAAATATT
TTGTTAAAGCAACAGGGCAGAAGTGGAATAAAAGTTATAGATTTTGGTTC
AAGTTGCTATGAACACCAAAGGATTTACACCTATATTCAGTCAAGATTTT
ATCGTGCTCCAGAAGTTATCTTAGGGAGTCCGTACAACATGATGATAGAC
ATGTGGAGTTTTGGATGCATTTTAGCTGAGTTATGGACAGGCACTCCATT
GTTTCCCGGTGAAGATGAAGCAGATCAGCTTGCCTGCATCATTGAATTAT
TGGGTATTCCACCAAAGAGTTTAATAGAAAATTCAAAAAGAGCAAAAATG
TTCATTAACTCTAGAGGTTATCCCCGATATTGCAATATCGAAGTAGACAC
AGATGGTCACATTATTTTAAAAGGAAATCGTTCAAAACGCGGAAAATATC
GTGGACCTCCTGGAAATAAATCTATTGTGTCTTTATTAAAAAATTGCAGT
GATCACTCATTTGTTTCATTTTTAAAACGTTGTCTACAATGGCTCCCTCA
AGATCGCATGACACCGAGAGAAGCTCTGAAACAAGAATGGTTGCGCCGTA
AACCTCCTAATCATTCCCAAGACAATTGTCCTTCAACTGCAGTGGACGGG
GATTTAATATATAAAGAAACTGCAACTGGAGATAGAATTGGAGTACATGA
AAACTTTCTGATGAATAATGCCTGTCTTGTGCCAGTTTAAATAATTAACA
GATGAAGCTTCATCTGTTAGAGATTGAGCTGGAAATTTCATTTTATATTT
AGTCCATAATATCATTTATTTTTAACGCGAAATATGAAAATAATTAACTA
AACTGTTCCTATTCTACGAGTCTACAAAATAGCAGATTATGTATGCATAA
TAACAAACGTTTTTATTGCGTTATTTTTGATAATTCAGAATATTATTTCC
ACCCTTTTTGCGATTATTTATTTATTTTTTATTTTTAAAACACATTAGCG
A
back to top

protein sequence of SMED30002728-orf-1

>SMED30002728-orf-1 ID=SMED30002728-orf-1|Name=SMED30002728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=583bp
MDKNIYLPWINSGNNNLTNAKSDPQLAAKRNFGNIQNFQYNNINDEMSGE
IINNNLSCKLNGDINGTNHNTNVLKYRESDNKNVFLDTSQIINPGFPVVE
NNLLAKVRTKNMVDSKPLKQSRGSSTISMTASFTKDSLTNVSRRAGSYEK
NPINSETAMKLYMNKLTSFEHHEIFSYPEIYFVGQNAKKRYGVMGGTHNC
GYDDEQNSYVYVGHDHIAYRFEVVKILGKGSFGQVVKAYDHKYNIYVALK
MIRNEKRFTRQAAEEIRILENLKKQDPSSNHNIVHILESFTFRNHVCMTF
ELLNINLYELIKKNKFQGFSLQLVRKFAHSILLCLDLLHRNKMIHCDLKP
ENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGSPYNM
MIDMWSFGCILAELWTGTPLFPGEDEADQLACIIELLGIPPKSLIENSKR
AKMFINSRGYPRYCNIEVDTDGHIILKGNRSKRGKYRGPPGNKSIVSLLK
NCSDHSFVSFLKRCLQWLPQDRMTPREALKQEWLRRKPPNHSQDNCPSTA
VDGDLIYKETATGDRIGVHENFLMNNACLVPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR042521DYRK
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0043130ubiquitin binding
GO:0000166nucleotide binding
GO:0000287magnesium ion binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0045725positive regulation of glycogen biosynthetic process
GO:0051534negative regulation of NFAT protein import into nucleus
GO:1901796regulation of signal transduction by p53 class mediator
GO:0006915apoptotic process
GO:0006974cellular response to DNA damage stimulus
GO:0007224smoothened signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 221..534
e-value: 6.4E-84
score: 294.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 221..534
e-value: 3.4E-55
score: 187.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 221..534
score: 39.128
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 277..533
e-value: 1.0E-121
score: 408.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 203..302
e-value: 1.0E-121
score: 408.2
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 79..543
NoneNo IPR availablePANTHERPTHR24058:SF112DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 3 HOMOLOG-RELATEDcoord: 79..543
IPR042521Dual specificity tyrosine-phosphorylation-regulated kinaseGENE3DG3DSA:1.10.8.980coord: 124..195
e-value: 7.7E-18
score: 66.7
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 343..355
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 227..250
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 209..542