beta-parvin

Overview
Namebeta-parvin
Smed IDSMED30002721
Length (bp)1598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-parvin (SMED30002721) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-parvin (SMED30002721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-parvin (SMED30002721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-parvin (SMED30002721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002721

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002721SMESG000080798.1 SMESG000054735.1 SMESG000030429.1 dd_Smed_v4_6842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002721SMESG000080798.1 SMESG000054735.1 SMESG000030429.1 dd_Smed_v4_6842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30002721SMESG000080798.1 SMESG000054735.1 SMESG000030429.1 dd_Smed_v4_6842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002721SMESG000080798.1 SMESG000054735.1 dd_Smed_v4_9524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002721SMESG000080798.1 SMESG000054735.1 dd_Smed_v4_9524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002721SMESG000080798.1 SMESG000054735.1 Contig49428newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002721SMESG000080798.1 SMESG000054735.1 Contig49428uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002721SMESG000080798.1 SMESG000054735.1 SMESG000030429.1 dd_Smed_v4_6842_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-parvin vs. Ensembl Human
Match: PARVB (parvin beta [Source:HGNC Symbol;Acc:HGNC:14653])

HSP 1 Score: 317.005 bits (811), Expect = 1.302e-103
Identity = 181/349 (51.86%), Postives = 249/349 (71.35%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            K+E+FL KL     +K++ +E+ +L  EGK AI SP+SP + D+ P+   LEE EER +I+P +KE PK   LV +LL+WIN   VE+RI+V+ LEEDLYDGQ+LQKL+EKL+G K++  EVTQSE+GQKQ+L+ V+E+++  L   G     +W+V+ I+ K+LVAIL LLV+LA +++APIR+PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLE YFVPL+ F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:   17 KDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGW--ALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRF--ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYK 361          
BLAST of beta-parvin vs. Ensembl Human
Match: PARVB (parvin beta [Source:HGNC Symbol;Acc:HGNC:14653])

HSP 1 Score: 312.383 bits (799), Expect = 2.894e-102
Identity = 173/328 (52.74%), Postives = 235/328 (71.65%), Query Frame = 1
Query:  190 IEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            + +L  EGK AI SP+SP + D+ P+   LEE EER +I+P +KE PK   LV +LL+WIN   VE+RI+V+ LEEDLYDGQ+LQKL+EKL+G K++  EVTQSE+GQKQ+L+ V+E+++  L   G     +W+V+ I+ K+LVAIL LLV+LA +++APIR+PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLE YFVPL+ F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:    1 MSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGW--ALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRF--ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYK 324          
BLAST of beta-parvin vs. Ensembl Human
Match: PARVB (parvin beta [Source:HGNC Symbol;Acc:HGNC:14653])

HSP 1 Score: 312.383 bits (799), Expect = 2.752e-101
Identity = 174/331 (52.57%), Postives = 236/331 (71.30%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            Q  + +L  EGK AI SP+SP + D+ P+   LEE EER +I+P +KE PK   LV +LL+WIN   VE+RI+V+ LEEDLYDGQ+LQKL+EKL+G K++  EVTQSE+GQKQ+L+ V+E+++  L   G     +W+V+ I+ K+LVAIL LLV+LA +++APIR+PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLE YFVPL+ F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:   68 QGGVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGW--ALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRF--ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYK 394          
BLAST of beta-parvin vs. Ensembl Human
Match: PARVA (parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652])

HSP 1 Score: 299.286 bits (765), Expect = 1.293e-96
Identity = 167/330 (50.61%), Postives = 230/330 (69.70%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. Ensembl Human
Match: PARVB (parvin beta [Source:HGNC Symbol;Acc:HGNC:14653])

HSP 1 Score: 258.07 bits (658), Expect = 9.151e-82
Identity = 152/313 (48.56%), Postives = 207/313 (66.13%), Query Frame = 1
Query:  235 LSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +SP + D+ P+   LEE EER +I+P +KE PK   LV +LL+WIN   VE+RI+V+ LEEDLYDGQ+LQKL+EKL+G K++  EVTQSE+GQKQ+L+ V+E+++  L   G     +W+V+ I+ K+LVAIL LLV+LA +++APIR+PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL +V+                       +F DGV+L+LLMGLLE YFVPL+ F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:    1 MSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGW--ALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRF--ERDAFDTLFDHAPDKLSVVK-----------------------KFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYK 286          
BLAST of beta-parvin vs. Ensembl Celegans
Match: pat-6 (Paralyzed arrest at two-fold protein 6 [Source:UniProtKB/Swiss-Prot;Acc:O16785])

HSP 1 Score: 235.728 bits (600), Expect = 2.036e-72
Identity = 146/311 (46.95%), Postives = 219/311 (70.42%), Query Frame = 1
Query:  244 LIPDLGPDGYHLEEGE-ERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            L+P L  + + LEEGE  R+L +  A++  K+  +V +L+ W+N E  +QRI+VR+L+EDL+DGQI+QKL+EKL  I+++ PEV+QSE GQ+Q+L+IV+++ N+ L      +  KW+ + I+ KD  AI++LLV LA +Y+AP+R P+ V  +V++ +K +GQ+   R  E IT    +L  + T  +DAF  L D+ PDKL  V+ +L+ F N +L KINL V+DLDNQF DGVFL+LL+GLLEGYFVPLY F+    + ++++ NVQ AF LM+D G+    +R +D+ NGD+KS LR+L++LF+ YK
Sbjct:   69 LVPVLARNIW-LEEGEIRRYLTKETARDQ-KLAQVVDLLIYWLNEELADQRIVVRHLQEDLFDGQIIQKLLEKLEQIRIEVPEVSQSEEGQRQKLQIVVQTANRILGQ--PREQEKWSADLIHQKDFTAIIQLLVLLALHYRAPVRFPDNVVANVVVAQKEHGQVKTHRITEQITTVQTELAPKGT--RDAFDTLFDYGPDKLAHVKTSLLAFCNKHLNKINLEVSDLDNQFQDGVFLVLLVGLLEGYFVPLYHFNLQVQSHEEKVKNVQFAFKLMEDTGLEKPRSRVQDIANGDVKSTLRLLHLLFTKYK 373          
BLAST of beta-parvin vs. Ensembl Celegans
Match: fln-2 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWA2])

HSP 1 Score: 51.2174 bits (121), Expect = 2.292e-6
Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  868 LITFTN-SNLQKINLSVTDLDNQFCDGVFLILLMGLLEG--YFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            L TFTN  N Q     + DL     DGV LI L+ +L+G  Y+  +Y   PT     Q++ NVQ+A   +++ GV +    + D+V+G+ K IL +++ L   Y+
Sbjct:   17 LHTFTNWINEQLQGNVIRDLTQDLSDGVNLIKLVEILQGRRYYGKVYDQDPTEI---QKLMNVQMALDALREDGVKTVNIGSHDIVDGNEKLILGLIWCLVQRYQ 118          
BLAST of beta-parvin vs. Ensembl Celegans
Match: fln-2 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AWA2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.438e-6
Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  868 LITFTN-SNLQKINLSVTDLDNQFCDGVFLILLMGLLEG--YFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            L TFTN  N Q     + DL     DGV LI L+ +L+G  Y+  +Y   PT     Q++ NVQ+A   +++ GV +    + D+V+G+ K IL +++ L   Y+
Sbjct:   17 LHTFTNWINEQLQGNVIRDLTQDLSDGVNLIKLVEILQGRRYYGKVYDQDPTEI---QKLMNVQMALDALREDGVKTVNIGSHDIVDGNEKLILGLIWCLVQRYQ 118          
BLAST of beta-parvin vs. Ensembl Fly
Match: parvin (gene:FBgn0052528 transcript:FBtr0074793)

HSP 1 Score: 287.345 bits (734), Expect = 2.706e-92
Identity = 176/359 (49.03%), Postives = 249/359 (69.36%), Query Frame = 1
Query:  100 TPTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            TPT  K   KE++F +K +TL RK+  + E++++  EGK AI+SP SP   D+ P+ Y L E E+R +I+P +   P+V  L  +L++WIN E  EQRI+V++LEED+YDGQ+L KL EKL+G K+D PEVTQSE GQ ++L IV++++N TL  H      KW+V  ++SK++VAIL LLVAL R+++AP+R+PE V ++V++  K  G L+  +  E IT     L      E+DAF  L+D APDKL +V+++LITF N +L K+N  ++DL+  F DGV+L LLMGLL G+FVPL+ FH TP  +DQ +SNV  AF LM+D G+P    R ED+VN DLKS LRVLY LF+ +++
Sbjct:   12 TPTAIKKGEKEDSFWDKFSTLGRKRGTR-EVKKVQEEGKYAIDSPGSPSQYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQRILVDWINDELAEQRIIVQHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGFHQKI--PKWSVASVHSKNIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDDLGMRC--EKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHLTPQDVDQMVSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLFTMFRD 365          
BLAST of beta-parvin vs. Ensembl Fly
Match: parvin (gene:FBgn0052528 transcript:FBtr0346042)

HSP 1 Score: 287.345 bits (734), Expect = 2.706e-92
Identity = 176/359 (49.03%), Postives = 249/359 (69.36%), Query Frame = 1
Query:  100 TPTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            TPT  K   KE++F +K +TL RK+  + E++++  EGK AI+SP SP   D+ P+ Y L E E+R +I+P +   P+V  L  +L++WIN E  EQRI+V++LEED+YDGQ+L KL EKL+G K+D PEVTQSE GQ ++L IV++++N TL  H      KW+V  ++SK++VAIL LLVAL R+++AP+R+PE V ++V++  K  G L+  +  E IT     L      E+DAF  L+D APDKL +V+++LITF N +L K+N  ++DL+  F DGV+L LLMGLL G+FVPL+ FH TP  +DQ +SNV  AF LM+D G+P    R ED+VN DLKS LRVLY LF+ +++
Sbjct:   12 TPTAIKKGEKEDSFWDKFSTLGRKRGTR-EVKKVQEEGKYAIDSPGSPSQYDIPPEDYALREHEQRAVIDPQSISDPQVIKLQRILVDWINDELAEQRIIVQHLEEDMYDGQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLKAVNHTLGFHQKI--PKWSVASVHSKNIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEKNAGVLNAQKFQEQITSEYDDLGMRC--EKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEISDLNTDFRDGVYLCLLMGLLGGFFVPLHEFHLTPQDVDQMVSNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLFTMFRD 365          
BLAST of beta-parvin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 51.6026 bits (122), Expect = 1.878e-6
Identity = 30/107 (28.04%), Postives = 57/107 (53.27%), Query Frame = 1
Query:  850 QLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTY 1170
            ++ + T   + N +L+ I+ S+ +L+    DG+ LI L+ +L    +P Y+    PT   Q++ NV +A   ++D G+      + D+V+  LK IL +++ L   Y
Sbjct:   45 KIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKR--PTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHY 149          
BLAST of beta-parvin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0089471)

HSP 1 Score: 51.6026 bits (122), Expect = 1.958e-6
Identity = 30/107 (28.04%), Postives = 57/107 (53.27%), Query Frame = 1
Query:  850 QLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTY 1170
            ++ + T   + N +L+ I+ S+ +L+    DG+ LI L+ +L    +P Y+    PT   Q++ NV +A   ++D G+      + D+V+  LK IL +++ L   Y
Sbjct:   15 KIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKR--PTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHY 119          
BLAST of beta-parvin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337101)

HSP 1 Score: 51.2174 bits (121), Expect = 2.363e-6
Identity = 30/107 (28.04%), Postives = 57/107 (53.27%), Query Frame = 1
Query:  850 QLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTY 1170
            ++ + T   + N +L+ I+ S+ +L+    DG+ LI L+ +L    +P Y+    PT   Q++ NV +A   ++D G+      + D+V+  LK IL +++ L   Y
Sbjct:   45 KIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKR--PTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHY 149          
BLAST of beta-parvin vs. Ensembl Zebrafish
Match: parvb (parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411])

HSP 1 Score: 303.523 bits (776), Expect = 1.622e-98
Identity = 166/333 (49.85%), Postives = 233/333 (69.97%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFD-TSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            +E+ +L  EGK AI +PL    P+L P+   LEE  ER +++P ++E      L  +L++WINSE  E RI+V++LEEDLYDGQ+LQKL EKLSG K++  EVTQSE+GQKQ+L+ V+E++N  L      D  ++W+V+ I+SK+LV+I+ LL+ALA YY APIR+PE V + V++V+K  G L      + +T  + +++     E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLE YFVPLY+F+ TP   +Q++ NV  AF LM+D G+     R EDVVN +LKS LRVLY LF+ YK +
Sbjct:   36 KEVSDLQEEGKNAINAPLLHTSPELLPEDTLLEENAERTILDPTSREDLNFKDLQKVLIDWINSELEEDRIIVKDLEEDLYDGQVLQKLFEKLSGYKLNVAEVTQSEIGQKQKLQTVLEAVNGVLRP---LDWNTEWSVDSIHSKNLVSIVYLLLALAIYYAAPIRLPEHVSVQVIVVKKKEGILQTAHVTKQLTSTTTEMMI-GRSERDAFDTLLDHAPDKLNVVKTSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLENYFVPLYNFYLTPENFEQKVHNVAFAFELMQDGGLQKPKARPEDVVNLNLKSTLRVLYNLFTNYKNS 364          
BLAST of beta-parvin vs. Ensembl Zebrafish
Match: parvaa (parvin, alpha a [Source:ZFIN;Acc:ZDB-GENE-040721-2])

HSP 1 Score: 294.278 bits (752), Expect = 7.796e-95
Identity = 164/330 (49.70%), Postives = 226/330 (68.48%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P +K   K+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQSE+ QKQ+L+ V+E IN  L    S  + KW V+ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL V +LD QF DGV+L+LLMGLLEGYFVPLY+F  TP   DQ++ NV  +F LM+D G+     R ED+VN +LKS LRV+Y LF+ Y+
Sbjct:   44 KEVSELQEEGMNAINLPLSPTPFELHPEDIMLEENEVRTMVDPNSKSDRKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLERINDALKV--STRSIKWNVDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQVMEEITGNTEAL--SGRHERDAFDTLFDHAPDKLSVVKKTLITFVNKHLNKLNLEVAELDTQFADGVYLVLLMGLLEGYFVPLYNFFLTPENFDQKVHNVSFSFELMQDGGMERPKPRPEDIVNCNLKSTLRVIYNLFTRYR 369          
BLAST of beta-parvin vs. Ensembl Zebrafish
Match: parvab (parvin, alpha b [Source:ZFIN;Acc:ZDB-GENE-070424-60])

HSP 1 Score: 293.123 bits (749), Expect = 1.933e-94
Identity = 162/330 (49.09%), Postives = 228/330 (69.09%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP   +L P+   L+E E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQ E+ QKQ+L+ V+E IN TL    S    +W VE +++K++VAIL LLVA++++++APIR+PE V I V++V+K  G L   +  E IT  +F+ L+    E+DAF  L D APDKL +V++TLITF N +L K+NL V++L+ QF DGV+L+LLMGLLEGYFVPLY+F   P   D ++ NV  +F LM+D  +     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   39 KEVSELQEEGMNAINLPLSPTPFELDPEDTMLDENEVRTMVDPHSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQCEIAQKQKLQTVLEKINDTLKV--SSRNIRWNVESVHAKNIVAILHLLVAISQHFRAPIRLPEHVSIQVVVVQKREGILQSRQIQEEIT-GNFEALS-GRYERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELETQFADGVYLVLLMGLLEGYFVPLYNFFLIPEHFDHKVHNVAFSFELMQDGDLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 364          
BLAST of beta-parvin vs. Ensembl Zebrafish
Match: parvb (parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411])

HSP 1 Score: 201.06 bits (510), Expect = 1.556e-60
Identity = 117/252 (46.43%), Postives = 174/252 (69.05%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFD-TSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQ 933
            ++++ +L  EGK AI +PL    P+L P+   LEE  ER +++P ++E      L  +L++WINSE  E RI+V++LEEDLYDGQ+LQKL EKLSG K++  EVTQSE+GQKQ+L+ V+E++N  L      D  ++W+V+ I+SK+LV+I+ LL+ALA YY APIR+PE V + V++V+K  G L      + +T  + +++     E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L+ Q
Sbjct:   11 RKQVSDLQEEGKNAINAPLLHTSPELLPEDTLLEENAERTILDPTSREDLNFKDLQKVLIDWINSELEEDRIIVKDLEEDLYDGQVLQKLFEKLSGYKLNVAEVTQSEIGQKQKLQTVLEAVNGVLRP---LDWNTEWSVDSIHSKNLVSIVYLLLALAIYYAAPIRLPEHVSVQVIVVKKKEGILQTAHVTKQLTSTTTEMMI-GRSERDAFDTLLDHAPDKLNVVKTSLITFVNKHLNKLNLEVTELETQ 258          
BLAST of beta-parvin vs. Ensembl Zebrafish
Match: parvg (parvin, gamma [Source:ZFIN;Acc:ZDB-GENE-070410-67])

HSP 1 Score: 182.956 bits (463), Expect = 7.262e-53
Identity = 106/297 (35.69%), Postives = 180/297 (60.61%), Query Frame = 1
Query:  286 GEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIIT-DASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            GE+R +I+P + E PKV  L  +LL+WINS    + I+VR+LEEDLYDG +L  L+ + +GI +   E+  S   Q ++L+++++++N+TL    + D +KW+V+ I+S+DL+A L LLVA+ R ++  + +P  V + ++        +   +Q E IT   S   L+  ++++     L      K++ V++ ++ F N N+  + L+VTDLD QF DGV L+LL+G LE +F+PL  F   P +  + + NV LA  L+ D G P  +   +D+V+ D+ + ++VLY LF+ +K
Sbjct:   19 GEKRMIIQPTSLEDPKVIKLKEVLLDWINSTLKVEHIVVRSLEEDLYDGLVLHHLLRRSAGIDLHVEEIALSTGAQIRKLEVILKALNETLEL--NVDQAKWSVKLIHSRDLLATLHLLVAIVRRFQPDLVLPANVTVELIQCEVTKSGIKADKQTEFITFSESSNELDRESNKECPIDELFKLEAHKIETVKKAILHFVNKNMASLGLNVTDLDKQFADGVILLLLIGQLEDFFIPLCDFFLCPVSSSEMLHNVTLALDLLIDRGFPVQSVDPQDIVSQDVPATVKVLYYLFNRHK 313          
BLAST of beta-parvin vs. Ensembl Xenopus
Match: parvb (parvin beta [Source:NCBI gene;Acc:448070])

HSP 1 Score: 291.582 bits (745), Expect = 3.995e-94
Identity = 171/329 (51.98%), Postives = 230/329 (69.91%), Query Frame = 1
Query:  190 IEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQL-LNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            + +L  EGK AI +P+SP   DL P+   LEE EER +I+P +KE  K   LV +L++WIN   VE+RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+E++ + L   G     +W V+ I+ K+LVAIL LLVALA +++APIR+PE VC+ V++V+K  G L    Q      ASF   L     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL++F+ TP   +Q++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ YK
Sbjct:    8 LSDLQEEGKNAINAPMSPTPIDLHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQVLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGW--AIRWNVDSIHGKNLVAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLL----QTLTCQCASFITDLLALYAERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPEDIVNLDLKSTLRVLYNLFTKYK 330          
BLAST of beta-parvin vs. Ensembl Xenopus
Match: parvb (parvin beta [Source:NCBI gene;Acc:448070])

HSP 1 Score: 292.738 bits (748), Expect = 2.427e-93
Identity = 181/350 (51.71%), Postives = 244/350 (69.71%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQL-LNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            K+E+FL KL     +KKK +E+ +L  EGK AI +P+SP   DL P+   LEE EER +I+P +KE  K   LV +L++WIN   VE+RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+E++ + L   G     +W V+ I+ K+LVAIL LLVALA +++APIR+PE VC+ V++V+K  G L    Q      ASF   L     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL++F+ TP   +Q++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ YK
Sbjct:   89 KDESFLGKLGGTLVRKKKAKEVSDLQEEGKNAINAPMSPTPIDLHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQVLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGW--AIRWNVDSIHGKNLVAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLL----QTLTCQCASFITDLLALYAERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPEDIVNLDLKSTLRVLYNLFTKYK 432          
BLAST of beta-parvin vs. Ensembl Xenopus
Match: parvb (parvin beta [Source:NCBI gene;Acc:448070])

HSP 1 Score: 288.886 bits (738), Expect = 4.741e-93
Identity = 166/328 (50.61%), Postives = 228/328 (69.51%), Query Frame = 1
Query:  190 IEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            + +L  EGK AI +P+SP   DL P+   LEE EER +I+P +KE  K   LV +L++WIN   VE+RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+E++ + L   G     +W V+ I+ K+LVAIL LLVALA +++APIR+PE VC+ V++V+K  G L     +      +   +     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL++F+ TP   +Q++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ YK
Sbjct:   15 VSDLQEEGKNAINAPMSPTPIDLHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQVLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGW--AIRWNVDSIHGKNLVAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLLQ--TAHVTEELTTTTEMMMGKFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPEDIVNLDLKSTLRVLYNLFTKYK 338          
BLAST of beta-parvin vs. Ensembl Xenopus
Match: parvb (parvin beta [Source:NCBI gene;Acc:448070])

HSP 1 Score: 261.536 bits (667), Expect = 5.424e-82
Identity = 160/327 (48.93%), Postives = 224/327 (68.50%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAE 1107
            K+E+FL KL     +KKK +E+ +L  EGK AI +P+SP   DL P+   LEE EER +I+P +KE  K   LV +L++WIN   VE+RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+E++ + L   G     +W V+ I+ K+LVAIL LLVALA +++APIR+PE VC+ V++V+K  G L     +      +   +     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL++F+ TP   +Q++ NV  +F LM+D G+     R E
Sbjct:   18 KDESFLGKLGGTLVRKKKAKEVSDLQEEGKNAINAPMSPTPIDLHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQVLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGW--AIRWNVDSIHGKNLVAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLLQ--TAHVTEELTTTTEMMMGKFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPE 340          
BLAST of beta-parvin vs. Ensembl Xenopus
Match: parvb (parvin beta [Source:NCBI gene;Acc:448070])

HSP 1 Score: 256.144 bits (653), Expect = 2.533e-80
Identity = 171/364 (46.98%), Postives = 232/364 (63.74%), Query Frame = 1
Query:   88 TTMSTPTGHKTPL-KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQL-LNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            T + +PT     + K+E+FL KL     +KKK +E+ +L  EGK AI +P+SP   DL P+   LEE EER +I+P +KE  K   LV +L++WIN   VE+RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+E++ + L   G     +W V+ I+ K+LVAIL LLVALA +++APIR+PE VC+ V++V+K  G L    Q      ASF   L     E+DAF  L D APDKL +V+                       +F DGV+L+LLMGLLEGYFVPL++F+ TP   +Q++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ YK
Sbjct:    4 TPVRSPTLQGPKMRKDESFLGKLGGTLVRKKKAKEVSDLQEEGKNAINAPMSPTPIDLHPEDTLLEENEERTMIDPNSKEEAKFKELVKVLIDWINEVLVEERIIVKNLEEDLYDGQVLQKLLETLGSRKLNVAEVTQSEIGQKQKLQTVLEAVQELLRPQGW--AIRWNVDSIHGKNLVAILHLLVALAMHFRAPIRLPEHVCVQVVVVKKREGLL----QTLTCQCASFITDLLALYAERDAFDTLFDHAPDKLSVVK-----------------------KFADGVYLVLLMGLLEGYFVPLHNFYLTPEGFEQKVHNVAFSFELMQDGGLKKPKARPEDIVNLDLKSTLRVLYNLFTKYK 338          
BLAST of beta-parvin vs. Ensembl Mouse
Match: Parva (parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144])

HSP 1 Score: 298.13 bits (762), Expect = 2.748e-96
Identity = 166/330 (50.30%), Postives = 230/330 (69.70%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ E   EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K+LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. Ensembl Mouse
Match: Parva (parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144])

HSP 1 Score: 298.13 bits (762), Expect = 2.748e-96
Identity = 166/330 (50.30%), Postives = 230/330 (69.70%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ E   EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K+LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. Ensembl Mouse
Match: Parva (parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144])

HSP 1 Score: 295.434 bits (755), Expect = 9.429e-96
Identity = 165/329 (50.15%), Postives = 229/329 (69.60%), Query Frame = 1
Query:  187 EIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            ++ E   EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K+LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:    9 KVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 333          
BLAST of beta-parvin vs. Ensembl Mouse
Match: Parvb (parvin, beta [Source:MGI Symbol;Acc:MGI:2153063])

HSP 1 Score: 288.5 bits (737), Expect = 9.506e-93
Identity = 184/365 (50.41%), Postives = 251/365 (68.77%), Query Frame = 1
Query:   97 STPTGHKTPL-----KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            S P    TP      K+E+FL KL     +KKK +E+ +L  EGK AI SP++P + D+ P+   LEE EER +I+P ++E PK   LV +LL+WIN    E+RI+V+ LEEDLYDGQ+LQKL+EKL+  K++  EVTQSE+GQKQ+L+ V+E++   L  HG     +W V+ I+ K+LVAIL LLV+LA +++API +PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL LV+++LITF N +L K+NL VTDL+ QF DGV+L+LL+GLLE YFVPL++F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK+
Sbjct:    3 SAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINSPMAPALVDIHPEDTQLEENEERTMIDPTSREDPKFKELVKVLLDWINDVLAEERIIVKQLEEDLYDGQVLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGW--PLRWNVDSIHGKNLVAILHLLVSLAMHFRAPIHLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEIMMGRF--ERDAFDTLFDHAPDKLNLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYFVPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTKYKD 363          
BLAST of beta-parvin vs. Ensembl Mouse
Match: Parvg (parvin, gamma [Source:MGI Symbol;Acc:MGI:2158329])

HSP 1 Score: 201.445 bits (511), Expect = 1.111e-59
Identity = 115/303 (37.95%), Postives = 187/303 (61.72%), Query Frame = 1
Query:  262 PDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTY 1170
            P    L  G ++  + P +K +PK   L  +L+EWIN+  + + I+VR+LEED++DG IL  L +KL+ +K++  E++ +   Q+ +L +++E++NQ L        +KW+VE I++KDL+A L LLVALA+ ++  + +P+ V + V+ +      L   +Q E +T+      ++    QDAF  L   AP+K+  V+E +++F N  L+++ LSV  LD QF DGV L+LL+G LEG+F+ L  F+ TP++  + + NV LA  L+KD G+ S+    ED+VN D KS LR+LY LF  +
Sbjct:   19 PTEEELPRGGKKKYLSPNSKRNPKFEELQKVLMEWINTTLLPEHIVVRSLEEDMFDGLILHHLFQKLASLKLEVEEISLTSASQRHKLGVILEAVNQNLQVEEK--QAKWSVETIFNKDLLATLHLLVALAKRFQPDLPLPDNVQVEVIHIESTKTGLKSDKQVEQLTECKS---HKDQPLQDAFDELFKLAPEKVHAVQEAIVSFVNQKLERLGLSVQSLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPSSPTEMLHNVTLALDLLKDEGLFSYPVNPEDIVNKDAKSTLRILYSLFQKH 316          
BLAST of beta-parvin vs. UniProt/SwissProt
Match: sp|Q9HBI1|PARVB_HUMAN (Beta-parvin OS=Homo sapiens OX=9606 GN=PARVB PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.253e-103
Identity = 181/349 (51.86%), Postives = 249/349 (71.35%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            K+E+FL KL     +K++ +E+ +L  EGK AI SP+SP + D+ P+   LEE EER +I+P +KE PK   LV +LL+WIN   VE+RI+V+ LEEDLYDGQ+LQKL+EKL+G K++  EVTQSE+GQKQ+L+ V+E+++  L   G     +W+V+ I+ K+LVAIL LLV+LA +++APIR+PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLE YFVPL+ F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:   17 KDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGW--ALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRF--ERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYK 361          
BLAST of beta-parvin vs. UniProt/SwissProt
Match: sp|Q9NVD7|PARVA_HUMAN (Alpha-parvin OS=Homo sapiens OX=9606 GN=PARVA PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 6.209e-96
Identity = 167/330 (50.61%), Postives = 230/330 (69.70%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. UniProt/SwissProt
Match: sp|Q9EPC1|PARVA_MOUSE (Alpha-parvin OS=Mus musculus OX=10090 GN=Parva PE=1 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 1.922e-95
Identity = 166/330 (50.30%), Postives = 230/330 (69.70%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ E   EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+TL       + KW V+ +++K+LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSEFQEEGMNAINLPLSPISFELDPEDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPR--SIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. UniProt/SwissProt
Match: sp|Q9HB97|PARVA_RAT (Alpha-parvin OS=Rattus norvegicus OX=10116 GN=Parva PE=1 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 5.460e-95
Identity = 165/330 (50.00%), Postives = 229/330 (69.39%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ E   EG  AI  PLSP+  +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL   K++  EVTQSE+ QKQ+L+ V+E IN+ L       + KW V+ +++K+LVAIL LLVAL++Y++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPL+SF  TP + +Q++ NV  AF LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSEFQEEGMNAINLPLSPISFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINEALKLPPR--SIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. UniProt/SwissProt
Match: sp|Q9ES46|PARVB_MOUSE (Beta-parvin OS=Mus musculus OX=10090 GN=Parvb PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 6.649e-92
Identity = 184/365 (50.41%), Postives = 251/365 (68.77%), Query Frame = 1
Query:   97 STPTGHKTPL-----KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            S P    TP      K+E+FL KL     +KKK +E+ +L  EGK AI SP++P + D+ P+   LEE EER +I+P ++E PK   LV +LL+WIN    E+RI+V+ LEEDLYDGQ+LQKL+EKL+  K++  EVTQSE+GQKQ+L+ V+E++   L  HG     +W V+ I+ K+LVAIL LLV+LA +++API +PE V + V++VRK  G LH    +E +T  +  ++     E+DAF  L D APDKL LV+++LITF N +L K+NL VTDL+ QF DGV+L+LL+GLLE YFVPL++F+ TP + DQ++ NV  AF LM D G+     R EDVVN DLKS LRVLY LF+ YK+
Sbjct:    3 SAPPRSPTPRAPKMKKDESFLGKLGGTLARKKKTREVTDLQEEGKSAINSPMAPALVDIHPEDTQLEENEERTMIDPTSREDPKFKELVKVLLDWINDVLAEERIIVKQLEEDLYDGQVLQKLLEKLAHCKLNVAEVTQSEIGQKQKLQTVLEAVQDLLRPHGW--PLRWNVDSIHGKNLVAILHLLVSLAMHFRAPIHLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEIMMGRF--ERDAFDTLFDHAPDKLNLVKKSLITFVNKHLNKLNLEVTDLETQFADGVYLVLLLGLLEDYFVPLHNFYLTPDSFDQKVHNVAFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYTLFTKYKD 363          
BLAST of beta-parvin vs. TrEMBL
Match: V3ZXG7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210692 PE=4 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 8.239e-120
Identity = 200/362 (55.25%), Postives = 262/362 (72.38%), Query Frame = 1
Query:   88 TTMSTPTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
             T    +G  TP K++           +KKK +E+ EL  EGK AIESP SP IPD+GP+GY L E EER +I+P +++ PK+  L+ +LL+WIN E  EQRILV+++EEDL+DGQILQKLIEKL GIKV  PEV+QSE+GQKQ+L++V++ IN+ LN  G ++  KW+V+ I+SK+LVAIL LLVALAR+++APIR+PE V + +++V+K +  L   R  E IT  +  +   A  E+DAF  L D APDKL +V++TL+TF N  L K+NL VTDLD QF DGVFL+++MGLLE YFVPLYSFH TPT  DQ++ NV  AF LM+DAG+P    R EDVVN DLKS LRVLY +F+ YK
Sbjct:    2 ATSPNTSGTLTPKKKDESFLDKIGTLGRKKKIKEVSELVEEGKHAIESPTSPTIPDIGPEGYVLGENEERSIIDPSSRDEPKLKELIKILLDWINDEMAEQRILVKDIEEDLFDGQILQKLIEKLQGIKVGAPEVSQSEIGQKQKLRVVLDYINRILNVGGGWNQQKWSVDSIHSKNLVAILHLLVALARHFRAPIRLPENVQVILIVVQKTDNLLQTRRVAEEITAYNDDI--GARFERDAFDTLFDHAPDKLNVVKKTLVTFVNKQLVKVNLEVTDLDTQFHDGVFLVIMMGLLEEYFVPLYSFHLTPTNFDQKVHNVHFAFELMQDAGLPQPKARVEDVVNHDLKSTLRVLYNIFTKYK 361          
BLAST of beta-parvin vs. TrEMBL
Match: A0A1S3HFH9 (beta-parvin OS=Lingula unguis OX=7574 GN=LOC106154095 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 8.797e-115
Identity = 201/357 (56.30%), Postives = 265/357 (74.23%), Query Frame = 1
Query:  103 PTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            P+G     KE++FL +      +KKKQ+E+ +L  EGK AIESP SP  PD+GP+ + LEE EER +IEP ++E  KV  L+ MLL+WIN E  EQRI+V+++EED++DGQILQKLIEKL+ ++V+ PEVTQSE+GQKQ+L+IV+++IN+ LN   +++  KWTV+ I+SK+LVAIL LLV LAR+++APIR+PE V +SV++V+K +G L   R  E IT  +  +   A  E+DAF  L D APDKL +V+ +LI F N  L K+NL VTDLDNQF DGV+L+LLMGLLEGYFVPL+ FH TPT+ +Q++ NV  AF LM DAG+P    R EDVVN DLKS LRVLY LF+ YK
Sbjct:    6 PSGTLKKQKEDSFLGEFIGTITRKKKQKEVVDLQEEGKNAIESPSSPTSPDMGPEAFMLEENEERSMIEPGSREDAKVKELIMMLLDWINDELAEQRIIVKDIEEDIFDGQILQKLIEKLARVRVEVPEVTQSEIGQKQKLRIVLDTINRILNLTPTWNQQKWTVDSIHSKNLVAILHLLVTLARHFRAPIRLPENVAVSVVVVQKRDGLLQTRRVIEEITGTNDDI--GARFERDAFDTLFDHAPDKLNVVKRSLIGFVNKWLNKVNLEVTDLDNQFHDGVYLVLLMGLLEGYFVPLHCFHLTPTSFEQKVHNVSFAFELMVDAGLPQPKARPEDVVNLDLKSTLRVLYNLFTKYK 360          
BLAST of beta-parvin vs. TrEMBL
Match: A0A0B7A9F1 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF100814 PE=4 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.338e-111
Identity = 178/332 (53.61%), Postives = 247/332 (74.40%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            +E+ EL  EGK AIESP SP IPD+GP+GY L + EER +IEP ++++PK+  L+ +LL+WIN E  + RI+V+++EEDL+DGQILQKLIEKL  ++V+  EVTQSE+GQKQ+L++V++ IN  L     +   KW+V+ ++SK+LVAIL LLVALA+++ API+MP+ V +++L+++K++G L      E IT     +  +   E+DAF  L D APDKL +V++TL+TF N +L ++NL VTDLDNQF DGVFLI+LMGLLEGYF PLY FH TP T +Q++ NV+ AF LM+DAG+     R ED+VN DLKS LRVLY +F+ YK +
Sbjct:   39 KEVSELQEEGKNAIESPTSPSIPDIGPEGYQLADYEERSMIEPTSRDNPKLMELIKILLDWINDELADHRIIVKDIEEDLFDGQILQKLIEKLCRVRVEAREVTQSEIGQKQKLRVVLDYINHILGVSPVWSQQKWSVDSVHSKNLVAILHLLVALAKHFHAPIKMPDNVTVTLLVIQKVDGILQTRYVPEEITTNYDDV--DGRGERDAFDTLFDHAPDKLNVVKKTLLTFVNKHLMRLNLEVTDLDNQFHDGVFLIMLMGLLEGYFTPLYQFHVTPITFEQKVHNVKFAFELMEDAGLQRPKARPEDIVNQDLKSTLRVLYNIFTKYKSS 368          
BLAST of beta-parvin vs. TrEMBL
Match: A0A3S1HQ96 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_008200 PE=4 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.165e-108
Identity = 188/363 (51.79%), Postives = 256/363 (70.52%), Query Frame = 1
Query:   88 TTMSTPTGHKTPLKEENFXXXXXXXXXXXXXQ-QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
             T  +P+   TP K+EN           +KK+ +E+ EL  EGK AIESP SP +PD+GP+GY L E EER +IEP ++E+PK+  LV  +L  IN E  + RI+V+++EEDL+DGQILQKLIEKL  ++V+  EVTQSE+GQKQ+L++V++ IN  L     +   KW+V+ ++SK+LVAIL LLVALAR++ APIR+PE V +++L+++K++  L      E IT     +  +   E+DAF  L D APDKL +V+++L+TF N++L K+NL VTDLDNQF DGVFLI+LMGLLEGYF PLY FH TPTT + R+ NV+ AF LM+DAG+     R ED+V+ DLKS LRVLY +F  YK
Sbjct:    2 ATSPSPSSTLTPKKKENESFLDKIGTMGRKKKAKEVSELQEEGKHAIESPTSPTVPDIGPEGYQLAENEERSMIEPTSRENPKLIELVQPIL-VINDELADHRIIVKDIEEDLFDGQILQKLIEKLCNVRVEAMEVTQSEVGQKQKLRVVLDYINHILGVPPLWSQHKWSVDSVHSKNLVAILHLLVALARHFNAPIRLPENVVVTLLVIQKVDNTLVTRTVPEEITGGHDDM--DGRGERDAFDTLFDHAPDKLNVVKKSLLTFVNTHLMKLNLEVTDLDNQFHDGVFLIMLMGLLEGYFTPLYQFHATPTTHEHRVHNVKFAFDLMEDAGLARPKARPEDIVHQDLKSTLRVLYHIFIKYK 361          
BLAST of beta-parvin vs. TrEMBL
Match: A0A0K8RPH1 (Putative alpha-parvin (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 8.992e-107
Identity = 181/332 (54.52%), Postives = 245/332 (73.80%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            +E+ EL  EGK AIE+P SP +PDL P  Y L+E EER +IEP + E P++  L+S+L+EWIN E    RI+V+++EEDLYDGQ+LQKL+E L+G ++D  EVTQSE GQKQ+L+ V++  NQ L     +   KWTVE I++K++V+I+ LLVALAR+++AP+R+PE V ++V++V+K NG LH     E +T     L      E+DAF  L D APDKLQ+V+++L+TF N +L KINL V+DLD QF DG++L+LLMGL+EGYFVPLYSF PTP++ +Q++ NV  AFSLM DAG+P    R ED+VN DLKS LRVLY LF+ YK+T
Sbjct:   39 KEVVELQEEGKNAIETPGSPTLPDLPPQDYILDEMEERAMIEPLSYEDPRLKELISVLIEWINDELASHRIIVKDIEEDLYDGQVLQKLLESLTGKRLDVVEVTQSEEGQKQKLRTVVDCANQILGL-PKWGQYKWTVESIHNKNIVSIIHLLVALARHFRAPVRLPENVVVNVVVVQKRNGILHPRTVQEELTSTYDDLGMRV--ERDAFDTLFDHAPDKLQVVKKSLMTFVNKHLNKINLEVSDLDTQFQDGIYLVLLMGLVEGYFVPLYSFFPTPSSFEQKVHNVAFAFSLMTDAGLPKPKARPEDLVNADLKSTLRVLYNLFTKYKDT 367          
BLAST of beta-parvin vs. Ensembl Cavefish
Match: parvab (parvin alpha [Source:NCBI gene;Acc:103040577])

HSP 1 Score: 301.982 bits (772), Expect = 7.189e-98
Identity = 166/330 (50.30%), Postives = 228/330 (69.09%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQSE+ QKQ+L+ V+E IN TL    S    KW ++ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL V++LD+QF DGV+L+LLMGLLEGYFVPLYSF  TP   D ++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSELQEEGMNAINLPLSPTPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLEKINDTLKV--SSRNIKWNIDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQVQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDSQFADGVYLVLLMGLLEGYFVPLYSFFLTPENFDHKVHNVSFSFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 369          
BLAST of beta-parvin vs. Ensembl Cavefish
Match: parvab (parvin alpha [Source:NCBI gene;Acc:103040577])

HSP 1 Score: 298.516 bits (763), Expect = 1.184e-96
Identity = 165/330 (50.00%), Postives = 227/330 (68.79%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQSE+ QKQ+L+ V+E IN TL    S    KW ++ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +     E    +DAF  L D APDKL +V++TLITF N +L K+NL V++LD+QF DGV+L+LLMGLLEGYFVPLYSF  TP   D ++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LF+ Y+
Sbjct:   44 KEVSELQEEGMNAINLPLSPTPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLEKINDTLKV--SSRNIKWNIDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQVQEEITGNT-----EYVFTRDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDSQFADGVYLVLLMGLLEGYFVPLYSFFLTPENFDHKVHNVSFSFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYR 366          
BLAST of beta-parvin vs. Ensembl Cavefish
Match: parvab (parvin alpha [Source:NCBI gene;Acc:103040577])

HSP 1 Score: 270.396 bits (690), Expect = 1.576e-85
Identity = 158/327 (48.32%), Postives = 222/327 (67.89%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAE 1107
            K+++FL KL     ++KK +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P ++  PK+  L+ +L++WIN   V +RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQSE+ QKQ+L+ V+E IN TL    S    KW ++ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +  L      E+DAF  L D APDKL +V++TLITF N +L K+NL V++LD+QF DGV+L+LLMGLLEGYFVPLYSF  TP   D ++ NV  +F LM+D G+     R E
Sbjct:   25 KDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPTPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLEKINDTLKV--SSRNIKWNIDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQVQEEITGNTEAL--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDSQFADGVYLVLLMGLLEGYFVPLYSFFLTPENFDHKVHNVSFSFELMQDGGLEKPKPRPE 347          
BLAST of beta-parvin vs. Ensembl Cavefish
Match: parvb (parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411])

HSP 1 Score: 266.159 bits (679), Expect = 2.018e-84
Identity = 162/331 (48.94%), Postives = 227/331 (68.58%), Query Frame = 1
Query:  190 IEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKV-TALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            + +L  EGK AI +PL P   DL P+   LEE  ER +++P ++E P + T    +L++WIN+E  E RI+V++LEEDLYD        EKLSG K++  EVTQSE+GQKQ+L+ V+E++N+ L   G   T +W V+ I+SK+LVAI+ LLVALA ++ APIR+PE V + V++V+K  G L      + +T  +   +   T E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L++QF DGV+L+LLMGLLE YFVPLY+F+ TP + +Q++ NV  AF LM+D G+     R EDVVN +LKS LRVLY LF+ YK +
Sbjct:   26 VSDLHEEGKNAINAPLLPSGVDLLPEDMLLEENAERSMLDPTSREDPNLRTCRRYVLIDWINNELEEDRIIVKDLEEDLYDA------CEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNEQLRPQGW--TIEWGVDSIHSKNLVAIVFLLVALAMHFMAPIRIPEHVSVQVVVVKKSEGILQTSHVTKELTTTTDMYIVVPT-ERDAFDTLLDHAPDKLNVVKTSLITFVNKHLNKLNLEVTELESQFADGVYLVLLMGLLEDYFVPLYNFYLTPESFEQKVHNVAFAFELMQDGGLKKPKARPEDVVNLNLKSTLRVLYNLFTNYKSS 347          
BLAST of beta-parvin vs. Ensembl Cavefish
Match: parvb (parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411])

HSP 1 Score: 213.386 bits (542), Expect = 2.943e-64
Identity = 156/357 (43.70%), Postives = 210/357 (58.82%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKV-DHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDX-----XXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            K+E FL KL     +KK+ +E+ +L  EGK AI +PL P   DL P+   LEE  ER +++P ++E PK   L  +L++WIN+E  E RI+V++LEEDLYDGQ+LQKL +K    K+   PEVTQSE+GQKQ+L+                  + WT+E     D       AI  LLVALA ++ APIR    +C S  ++     Q  H  + E+ T     ++     E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L  ++C  VF     GLLE YFVPLY+F     T  QR+ NV  AF LM+D G+     R EDVVN +LKS LRVLY LF+ YK +
Sbjct:   10 KDEGFLGKLGGTLARKKRSKEVSDLHEEGKNAINAPLLPSGADLLPEDMLLEENAERSMLDPTSREDPKFKDLQKVLIDWINNELEEDRIIVKDLEEDLYDGQVLQKLKKKNMLCKILIIPEVTQSEIGQKQKLQ------------------TGWTIEWGVDCDNPLPKNSAIRVLLVALAMHFMAPIRYLRCLCKSEGIL-----QTSHVTK-ELTTTTDMYIV--VPTERDAFDTLLDHAPDKLNVVKTSLITFVNKHLNKLNLEVTEL--EWC--VFGAA-NGLLEDYFVPLYNF-----TSRQRVHNVAFAFELMQDGGLKKPKARPEDVVNLNLKSTLRVLYNLFTNYKSS 330          
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Match: parvb (parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411])

HSP 1 Score: 303.138 bits (775), Expect = 5.242e-99
Identity = 169/330 (51.21%), Postives = 229/330 (69.39%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EGK AI SPLS  +PD+ P+   LEE EER +I+  +K  PK+  L+ +L++WIN    E RI+V++LE+DL+DGQ+LQKL+EKL   K++  EVTQSE+ QK +L+ V+E+++  L         KW VE I+SK+LV IL LLVALA  + APIR+PE V + V++V+K +G L   R  E IT  +  +  +   E+DAF  L D AP+KL +V+++LITF N  L K+NL VTDLD+QF DGV+L+LLMGLLE YFVPL++F+ TP   +Q++ NV  AF LM+DAG+     R EDVVN DLKS LRVLY LF+ YK
Sbjct:   44 KEVNELQEEGKNAINSPLSTTLPDIRPEDTFLEENEERTMIDAQSKRDPKLQELIKVLIDWINDVLAEDRIIVKSLEDDLFDGQVLQKLLEKLWKQKLNVAEVTQSEVAQKHKLQTVLEAVSTVLRPRNW--NIKWNVELIHSKNLVGILHLLVALAIQFHAPIRLPENVSVQVIVVQKRDGCLASHRVTEEITSTTEDMTGKY--ERDAFDTLFDHAPEKLNVVKKSLITFVNKQLNKLNLEVTDLDSQFADGVYLVLLMGLLEDYFVPLHNFYLTPEGFEQKVHNVSFAFELMQDAGLNKPKARPEDVVNLDLKSTLRVLYNLFTKYK 369          
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Match: PARVA (parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652])

HSP 1 Score: 263.462 bits (672), Expect = 9.392e-85
Identity = 148/298 (49.66%), Postives = 207/298 (69.46%), Query Frame = 1
Query:  280 EEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            EE EER +I+P  K+ PK+  L+ +L++WIN   V++RI+V+NLEEDLYDGQ+LQKL+E L   K++  EVTQSE+GQKQ+L+ V+ ++N  L       + KW+V+ I+SK+LVAIL LLVALA +Y+APIR+PE V I +L+V+K  G L   +  E IT  +  +      E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ QF DGV+L+LLMGLLEGYFVPLY F+ TP + DQ++ NV  AF LM+D G+     R ED+      S L  +Y+L++  +
Sbjct:    4 EENEERSIIDPNYKDEPKLQELIRVLIDWINDVLVDERIIVKNLEEDLYDGQVLQKLLEALGQQKLNVAEVTQSEIGQKQKLQTVLLAVNHILKPQQW--SIKWSVDLIHSKNLVAILHLLVALAIHYRAPIRLPEHVTIQLLVVQKRGGSLQTRQVQEKITTTTESMTGRF--ERDAFDTLFDHAPDKLNVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLYGFYLTPDSFDQKVHNVTFAFELMQDGGLAKPKARPEDI------STLEYIYLLWNRVR 291          
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002752.1 (pep scaffold:Pmarinus_7.0:GL477517:73851:92045:1 gene:ENSPMAG00000002506.1 transcript:ENSPMAT00000002752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 1.551e-49
Identity = 94/302 (31.13%), Postives = 180/302 (59.60%), Query Frame = 1
Query:  277 LEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQ-FCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            L+E E   +I+P A    +   L  +LL+W+N    E+ + VR++++D +DG +LQ L+EKL  +K+  PE+  SE  Q  +L ++++++++ L A       KWTV+ I+SK+ +A + LL+ + +++   + +P GV +   L+ K    L   +  +++ + +   ++      +   V+   +P+K+  V + L+ F N +L  ++L +TDL  Q +   V L+LL+G L GYFVPL+S++ +P + +Q++ NV+LA  LM+D G P    + E++V+ D K+ +++LYIL++ +K +
Sbjct:   12 LDENETTLVIQPNAYRDEQFLQLSEVLLDWVNCTLREENVKVRSVKDDFFDGLVLQHLLEKLGRVKLAVPEIALSEEIQTHKLNLILQNLDEQLCAQDP-SKVKWTVKSIHSKNTLATMHLLIRMVQHFSPKVLLPHGVSVKAYLLEKGKNTL---KAEQVMEELTPNHISRDNFSDNPIDVIFRVSPEKVPQVEQMLLAFANGHLAGLHLDITDLVTQEWAPTVMLVLLLGQLSGYFVPLHSYYLSPESREQKVHNVKLALELMEDDGNPMSPVQPEEIVDVDAKAAMKILYILYNKHKAS 309          
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Match: PARVA (parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652])

HSP 1 Score: 143.665 bits (361), Expect = 3.119e-40
Identity = 92/218 (42.20%), Postives = 139/218 (63.76%), Query Frame = 1
Query:  280 EEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQ 933
            EE EER +I P  K+ PK+  L+ +L +WIN   +E RI + N  E L+  QIL    E  +  K++  EVTQ E+ QKQ+L  V++++NQTL     +   +W+VE I+SK +VAIL LLVALA +++API +P+ V + +++V+K  G++   +  E+IT     +      E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ Q
Sbjct:    1 EENEERSIINPQHKDDPKLQELIKVLKDWINDVLIEDRIKITNQREKLHQVQILLFCQETPAHRKLNVAEVTQCEITQKQKLHTVLQAVNQTLKP-QQWGGVRWSVELIHSKHVVAILHLLVALAIHFRAPIHLPDHVTVQLVVVQKRGGKVLVQKSQEVITTTMESMAGHF--ERDAFDTLFDHAPDKLNVVKKSLITFVNKHLSKLNLEVTELETQ 215          
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Match: PARVA (parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652])

HSP 1 Score: 142.124 bits (357), Expect = 1.526e-39
Identity = 91/218 (41.74%), Postives = 138/218 (63.30%), Query Frame = 1
Query:  280 EEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQ 933
            EE EER +I P  K+ PK+  L+ +L +WIN   +E RI  +   E L+  QIL    E  +  K++  EVTQ E+ QKQ+L  V++++NQTL     +   +W+VE I+SK +VAIL LLVALA +++API +P+ V + +++V+K  G++   +  E+IT     +      E+DAF  L D APDKL +V+++LITF N +L K+NL VT+L+ Q
Sbjct:    1 EENEERSIINPQHKDDPKLQELIKVLKDWINDVLIEDRIXCKAAREKLHQVQILLFCQETPALRKLNVAEVTQCEITQKQKLHTVLQAVNQTLKPQ-QWGGVRWSVELIHSKHVVAILHLLVALAIHFRAPIHLPDHVTVQLVVVQKRGGKVLVQKSQEVITTTMESMAGHF--ERDAFDTLFDHAPDKLNVVKKSLITFVNKHLSKLNLEVTELETQ 215          
BLAST of beta-parvin vs. Ensembl Nematostella
Match: EDO40938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5V6])

HSP 1 Score: 214.157 bits (544), Expect = 3.397e-65
Identity = 143/331 (43.20%), Postives = 189/331 (57.10%), Query Frame = 1
Query:  187 EIEELTLEGKQAIESPLSP--LIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            E+++L  EGK AIESP +P  +IP   PD Y ++E EERF+IEP + E PKV  L ++LLEWIN E  ++RI+VRN+EEDLYDG IL  L                  MG                               I+SKD VAIL LLVALAR++    ++   V I  + V+K  G L   R  E IT            E+DAF  L D AP+KL +V+++L +F N +L K++L VTD+D QF DGVF I L+GLLEG+FVPLY FH  P + D++  NV LA  LM+D+G+  F  + ED++  DLKS LR++Y LF  YK
Sbjct:   47 EVDQLETEGKFAIESPTTPIHMIP---PDTYDMDENEERFMIEPRSLEDPKVMQLKTVLLEWINEELADKRIVVRNVEEDLYDGLILAHL------------------MG-------------------------------IHSKDTVAILHLLVALARHFNNQKKLTPDVKIHTMHVQKKGGVLVPQRVIEEIT------------ERDAFDALFDNAPEKLGVVKKSLQSFVNRHLGKLSLEVTDIDTQFHDGVFFIFLLGLLEGFFVPLYQFHTIPKSDDEKRQNVDLALDLMRDSGL-KFYAKTEDIIKRDLKSTLRIVYSLFQKYK 312          
BLAST of beta-parvin vs. Ensembl Nematostella
Match: EDO30199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G8])

HSP 1 Score: 114.775 bits (286), Expect = 2.056e-30
Identity = 53/101 (52.48%), Postives = 71/101 (70.30%), Query Frame = 1
Query:  874 TFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            +F N +L K++L VTD+D QF DGVF I L+GLLEG+FVPLY FH  P + D++  NV LA  LM+D+G+  F  + ED++  DLKS LR++Y LF  YK 
Sbjct:   24 SFVNRHLGKLSLEVTDIDTQFHDGVFFIFLLGLLEGFFVPLYQFHTIPKSDDEKRQNVDLALDLMRDSGL-KFYAKTEDIIKRDLKSTLRIVYSLFQKYKH 123          
BLAST of beta-parvin vs. Ensembl Nematostella
Match: EDO30624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T096])

HSP 1 Score: 95.1301 bits (235), Expect = 1.580e-23
Identity = 48/95 (50.53%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  898 KINLSVTDL--DNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            K+NL    L  D  F DGVF I L+GLLEG+FVPLY FH  P + D++  NV LA  LM+D+G+  F  + ED++  DLKS LR++Y LF  YK 
Sbjct:   24 KVNLKWDGLKEDYTFHDGVFFIFLLGLLEGFFVPLYQFHTIPKSDDEKRQNVDLALDLMRDSGL-KFYFKTEDIIKRDLKSTLRIVYSLFQKYKH 117          
BLAST of beta-parvin vs. Ensembl Nematostella
Match: EDO28185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T767])

HSP 1 Score: 74.3294 bits (181), Expect = 7.439e-16
Identity = 61/145 (42.07%), Postives = 85/145 (58.62%), Query Frame = 1
Query:  301 LIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQL 735
            +IEP + E PKV  L ++LLEWIN E  ++RI+VRN+EEDLYDG IL  L+ K     +            + +L ++I  IN+ L        +KWT E+I+SKD VAIL LLVALAR++    ++   V I  + V+K  G L
Sbjct:    1 MIEPRSLEDPKVMQLKTVLLEWINEELADKRIVVRNVEEDLYDGLILAHLMGKSMHTII---------YFFQAKLSVLIGEINKVLLV--PQHRAKWTPERIHSKDTVAILHLLVALARHFNNQKKLTPDVKIHTMHVQKKGGVL 134          
BLAST of beta-parvin vs. Ensembl Medaka
Match: parvb (parvin beta [Source:NCBI gene;Acc:101156404])

HSP 1 Score: 297.36 bits (760), Expect = 2.493e-96
Identity = 178/351 (50.71%), Postives = 247/351 (70.37%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            K+E+FL KL     +KKK +E+ +L  EGK AI +PL P   ++ P+   LEE  ER +++P + ++PK   LV  L EWINSE  E+RI+V++LEED YDGQ+LQKL EKLSG K++  EVTQSE+GQKQ+L+ V+E++N  L  HG   T +W+VE I+SK LV+I+ LLVALA +++A IR+PE V + V++V+KL G L      + +T  +  ++     E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L++QF DGV+LILLMGLLE YFVPLY+F  TP + +Q++ NV  AF LM+D G+     R EDVVN +LK+ LRVLY LF+ YK +
Sbjct:    8 KDESFLGKLGGSLVRKKKNKEVSDLHEEGKNAINAPLLPSGTEIHPEDALLEENAERIMLDPSSHDNPKFKDLVKTLTEWINSELEEERIIVKDLEEDCYDGQVLQKLFEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNSVLRPHGW--TVEWSVESIHSKYLVSIVYLLVALAMHFQAAIRLPEHVSVQVVVVKKLEGILQTAVLTKELTTTTEMMMGRF--ERDAFDTLLDHAPDKLNVVKSSLITFVNKHLNKLNLEVTELESQFADGVYLILLMGLLEDYFVPLYNFFLTPESFEQKVHNVAFAFELMQDGGLMKPKARPEDVVNLNLKATLRVLYNLFTNYKNS 354          
BLAST of beta-parvin vs. Ensembl Medaka
Match: parvaa (alpha-parvin [Source:NCBI gene;Acc:101161694])

HSP 1 Score: 297.745 bits (761), Expect = 3.126e-96
Identity = 166/330 (50.30%), Postives = 225/330 (68.18%), Query Frame = 1
Query:  184 QEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P +K  PK+  L  +L++WIN   V  RI+V++L EDLYDGQ+LQKL EKL G K++  EVTQSE+ QKQ+L+ V+E IN +L    S    +W V+ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +         E+DAF  L D APDKL +V++TLITF N +L K+NL V++LD QF DGV+L+LLMGLLEGYFVPLY+F  TP   DQ++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LFS Y+
Sbjct:   44 KEVSELQEEGINAINLPLSPSHYELDPEDTMLEENEVRTMVDPNSKHDPKLQELTKVLIDWINDVLVLDRIIVKDLAEDLYDGQVLQKLFEKLEGEKLNVAEVTQSEIAQKQKLQTVLERINDSLKL--STRNIRWNVDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAF--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDTQFADGVYLVLLMGLLEGYFVPLYNFFLTPENFDQKVHNVSFSFELMQDGGLERPKPRPEDIVNCDLKSTLRVLYNLFSRYR 369          
BLAST of beta-parvin vs. Ensembl Medaka
Match: parvb (parvin beta [Source:NCBI gene;Acc:101156404])

HSP 1 Score: 295.049 bits (754), Expect = 1.132e-95
Identity = 168/333 (50.45%), Postives = 236/333 (70.87%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            ++++ +L  EGK AI +PL P   ++ P+   LEE  ER +++P + ++PK   LV  L EWINSE  E+RI+V++LEED YDGQ+LQKL EKLSG K++  EVTQSE+GQKQ+L+ V+E++N  L  HG   T +W+VE I+SK LV+I+ LLVALA +++A IR+PE V + V++V+KL G L      + +T  +  ++     E+DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L++QF DGV+LILLMGLLE YFVPLY+F  TP + +Q++ NV  AF LM+D G+     R EDVVN +LK+ LRVLY LF+ YK +
Sbjct:   11 KKQVSDLHEEGKNAINAPLLPSGTEIHPEDALLEENAERIMLDPSSHDNPKFKDLVKTLTEWINSELEEERIIVKDLEEDCYDGQVLQKLFEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNSVLRPHGW--TVEWSVESIHSKYLVSIVYLLVALAMHFQAAIRLPEHVSVQVVVVKKLEGILQTAVLTKELTTTTEMMMGRF--ERDAFDTLLDHAPDKLNVVKSSLITFVNKHLNKLNLEVTELESQFADGVYLILLMGLLEDYFVPLYNFFLTPESFEQKVHNVAFAFELMQDGGLMKPKARPEDVVNLNLKATLRVLYNLFTNYKNS 339          
BLAST of beta-parvin vs. Ensembl Medaka
Match: parvb (parvin beta [Source:NCBI gene;Acc:101156404])

HSP 1 Score: 295.434 bits (755), Expect = 1.395e-95
Identity = 177/351 (50.43%), Postives = 242/351 (68.95%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            K+E+FL KL     +KKK +E+ +L  EGK AI +PL P   ++ P+   LEE  ER +++P + ++PK   LV  L EWINSE  E+RI+V++LEED YDGQ+LQKL EKLSG K++  EVTQSE+GQKQ+L+ V+E++N  L  HG   T +W+VE I+SK LV+I+ LLVALA +++A IR+PE V + V++V+KL G          I   +       T  +DAF  L+D APDKL +V+ +LITF N +L K+NL VT+L++QF DGV+LILLMGLLE YFVPLY+F  TP + +Q++ NV  AF LM+D G+     R EDVVN +LK+ LRVLY LF+ YK +
Sbjct:   18 KDESFLGKLGGSLVRKKKNKEVSDLHEEGKNAINAPLLPSGTEIHPEDALLEENAERIMLDPSSHDNPKFKDLVKTLTEWINSELEEERIIVKDLEEDCYDGQVLQKLFEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNSVLRPHGW--TVEWSVESIHSKYLVSIVYLLVALAMHFQAAIRLPEHVSVQVVVVKKLEG----------ILQTAVLTKELTTTTEDAFDTLLDHAPDKLNVVKSSLITFVNKHLNKLNLEVTELESQFADGVYLILLMGLLEDYFVPLYNFFLTPESFEQKVHNVAFAFELMQDGGLMKPKARPEDVVNLNLKATLRVLYNLFTNYKNS 356          
BLAST of beta-parvin vs. Ensembl Medaka
Match: parvaa (alpha-parvin [Source:NCBI gene;Acc:101161694])

HSP 1 Score: 274.248 bits (700), Expect = 3.049e-87
Identity = 165/349 (47.28%), Postives = 229/349 (65.62%), Query Frame = 1
Query:  127 KEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYK 1173
            K+++FL KL     ++KK +E+ EL  EG  AI  PLSP   +L P+   LEE E R +++P +K  PK+  L  +L++WIN   V  RI+V++L EDLYDGQ+LQKL   L+          +SE+ QKQ+L+ V+E IN +L    S    +W V+ +++K +VAIL LLVAL+++++APIR+P+ V I V++V+K  G L   +  E IT  +         E+DAF  L D APDKL +V++TLITF N +L K+NL V++LD QF DGV+L+LLMGLLEGYFVPLY+F  TP   DQ++ NV  +F LM+D G+     R ED+VN DLKS LRVLY LFS Y+
Sbjct:   25 KDDSFLGKLGGTLARRKKAKEVSELQEEGINAINLPLSPSHYELDPEDTMLEENEVRTMVDPNSKHDPKLQELTKVLIDWINDVLVLDRIIVKDLAEDLYDGQVLQKLFVLLNVAG------CESEIAQKQKLQTVLERINDSLKL--STRNIRWNVDSVHAKSIVAILHLLVALSQHFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEAF--SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVSELDTQFADGVYLVLLMGLLEGYFVPLYNFFLTPENFDQKVHNVSFSFELMQDGGLERPKPRPEDIVNCDLKSTLRVLYNLFSRYR 363          
BLAST of beta-parvin vs. Planmine SMEST
Match: SMESG000080798.1 (SMESG000080798.1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 361/362 (99.72%), Postives = 362/362 (100.00%), Query Frame = 1
Query:   94 MSTPTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            MSTPTGHKTPLKEENFLNKLTTLNRKKKKQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDLVAILRLLVALARYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAED+VNGDLKSILRVLYILFSTYKET
Sbjct:    1 MSTPTGHKTPLKEENFLNKLTTLNRKKKKQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDLVAILRLLVALARYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDMVNGDLKSILRVLYILFSTYKET 362          
BLAST of beta-parvin vs. Planmine SMEST
Match: SMESG000054735.1 (SMESG000054735.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 361/362 (99.72%), Postives = 361/362 (99.72%), Query Frame = 1
Query:   94 MSTPTGHKTPLKEENFXXXXXXXXXXXXXQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 1179
            MSTPTGHKTPLKEENFLNKLTTLNRKKKKQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDLVAILRLLVALARYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTN NLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET
Sbjct:    1 MSTPTGHKTPLKEENFLNKLTTLNRKKKKQQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLNAHGSFDTSKWTVEKIYSKDLVAILRLLVALARYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPDKLQLVRETLITFTNCNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKET 362          
BLAST of beta-parvin vs. Planmine SMEST
Match: SMESG000061495.1 (SMESG000061495.1)

HSP 1 Score: 212.231 bits (539), Expect = 1.485e-63
Identity = 120/337 (35.61%), Postives = 202/337 (59.94%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLN-AHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDE----QDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            +QE+E LTLEGK AIESP   ++ D+       E  ++  +++       +V  L  +L+ W+N     +RI+V+N+ +DL DGQIL +L + L G K++ PEVT SE+ QK +LK+V++ ++  +       +  KW V +IY  +++AIL LLV + +++   +R+P  V I    + K+N +L H +++  IT      + E  D+    +D+F  L   APDK+  V+ +L+ F N + +K+NL V D++++F DG++ I L+G+L  YFVP Y++       + R+ NV   + LM+D+G+P   +  ED+V GDLK+ +R+LY LFS +K+
Sbjct:   44 RQEVENLTLEGKNAIESPFKRVLNDV----VDYEIKDKTLIVDKIEMNREEVKTLFDILMNWMNRILEPKRIIVKNITDDLCDGQILHELAQHLCGTKIEFPEVTISEVSQKHKLKLVLDVLHNKMGIVESEIECLKWNVNEIYEGNVIAILCLLVRMVQFFDKDVRLPLKVVIDATKIVKVNDKLEHRKESYEITG-----IIEGGDQTKIGKDSFDTLFASAPDKIDDVKMSLLNFVNGHFKKLNLEVNDIESEFRDGIYFIYLLGVLGNYFVPNYAYSLPAQEFNVRLENVNFVYELMEDSGIPKPNSVPEDIVLGDLKATMRILYSLFSHFKD 371          
BLAST of beta-parvin vs. Planmine SMEST
Match: SMESG000061495.1 (SMESG000061495.1)

HSP 1 Score: 116.701 bits (291), Expect = 1.154e-27
Identity = 60/162 (37.04%), Postives = 95/162 (58.64%), Query Frame = 1
Query:  748 QNEIITDASFQ---------------LLNEATDE----QDAFSVLVDFAPDKLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVPLYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILRVLYILFSTYKE 1176
            Q EI+TD + Q               L N  TD+    +D+F  L   APDK+  V+ +L+ F N + +K+NL V D++++F DG++ I L+G+L  YFVP Y++       + R+ NV   + LM+D+G+P   +  ED+V GDLK+ +R+LY LFS +K+
Sbjct:  350 QQEIVTDETSQFKNAKRKNRPAFLVFLQNNVTDQTKIGKDSFDTLFASAPDKIDDVKMSLLNFVNGHFKKLNLEVNDIESEFRDGIYFIYLLGVLGNYFVPNYAYSLPAQEFNVRLENVNFVYELMEDSGIPKPNSVPEDIVLGDLKATMRILYSLFSHFKD 511          

HSP 2 Score: 111.694 bits (278), Expect = 6.069e-26
Identity = 68/196 (34.69%), Postives = 116/196 (59.18%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLN-AHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIIT 765
            +QE+E LTLEGK AIESP   ++ D+       E  ++  +++       +V  L  +L+ W+N     +RI+V+N+ +DL DGQIL +L + L G K++ PEVT SE+ QK +LK+V++ ++  +       +  KW V +IY  +++AIL LLV + +++   +R+P  V I    + K+N +L H +++  IT
Sbjct:   44 RQEVENLTLEGKNAIESPFKRVLNDV----VDYEIKDKTLIVDKIEMNREEVKTLFDILMNWMNRILEPKRIIVKNITDDLCDGQILHELAQHLCGTKIEFPEVTISEVSQKHKLKLVLDVLHNKMGIVESEIECLKWNVNEIYEGNVIAILCLLVRMVQFFDKDVRLPLKVVIDATKIVKVNDKLEHRKESYEIT 235          
BLAST of beta-parvin vs. Planmine SMEST
Match: SMESG000061495.1 (SMESG000061495.1)

HSP 1 Score: 109.383 bits (272), Expect = 1.098e-25
Identity = 68/196 (34.69%), Postives = 116/196 (59.18%), Query Frame = 1
Query:  181 QQEIEELTLEGKQAIESPLSPLIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQRILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIESINQTLN-AHGSFDTSKWTVEKIYSKDXXXXXXXXXXXXXYYKAPIRMPEGVCISVLLVRKLNGQLHHWRQNEIIT 765
            +QE+E LTLEGK AIESP   ++ D+       E  ++  +++       +V  L  +L+ W+N     +RI+V+N+ +DL DGQIL +L + L G K++ PEVT SE+ QK +LK+V++ ++  +       +  KW V +IY  +++AIL LLV + +++   +R+P  V I    + K+N +L H +++  IT
Sbjct:   44 RQEVENLTLEGKNAIESPFKRVLNDV----VDYEIKDKTLIVDKIEMNREEVKTLFDILMNWMNRILEPKRIIVKNITDDLCDGQILHELAQHLCGTKIEFPEVTISEVSQKHKLKLVLDVLHNKMGIVESEIECLKWNVNEIYEGNVIAILCLLVRMVQFFDKDVRLPLKVVIDATKIVKVNDKLEHRKESYEIT 235          
The following BLAST results are available for this feature:
BLAST of beta-parvin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PARVB1.302e-10351.86parvin beta [Source:HGNC Symbol;Acc:HGNC:14653][more]
PARVB2.894e-10252.74parvin beta [Source:HGNC Symbol;Acc:HGNC:14653][more]
PARVB2.752e-10152.57parvin beta [Source:HGNC Symbol;Acc:HGNC:14653][more]
PARVA1.293e-9650.61parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652][more]
PARVB9.151e-8248.56parvin beta [Source:HGNC Symbol;Acc:HGNC:14653][more]
back to top
BLAST of beta-parvin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pat-62.036e-7246.95Paralyzed arrest at two-fold protein 6 [Source:Un... [more]
fln-22.292e-634.29FiLamiN (Actin binding protein) homolog [Source:U... [more]
fln-22.438e-634.29FiLamiN (Actin binding protein) homolog [Source:U... [more]
back to top
BLAST of beta-parvin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvin2.706e-9249.03gene:FBgn0052528 transcript:FBtr0074793[more]
parvin2.706e-9249.03gene:FBgn0052528 transcript:FBtr0346042[more]
cher1.878e-628.04gene:FBgn0014141 transcript:FBtr0303364[more]
cher1.958e-628.04gene:FBgn0014141 transcript:FBtr0089471[more]
cher2.363e-628.04gene:FBgn0014141 transcript:FBtr0337101[more]
back to top
BLAST of beta-parvin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvb1.622e-9849.85parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411... [more]
parvaa7.796e-9549.70parvin, alpha a [Source:ZFIN;Acc:ZDB-GENE-040721-2... [more]
parvab1.933e-9449.09parvin, alpha b [Source:ZFIN;Acc:ZDB-GENE-070424-6... [more]
parvb1.556e-6046.43parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411... [more]
parvg7.262e-5335.69parvin, gamma [Source:ZFIN;Acc:ZDB-GENE-070410-67][more]
back to top
BLAST of beta-parvin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvb3.995e-9451.98parvin beta [Source:NCBI gene;Acc:448070][more]
parvb2.427e-9351.71parvin beta [Source:NCBI gene;Acc:448070][more]
parvb4.741e-9350.61parvin beta [Source:NCBI gene;Acc:448070][more]
parvb5.424e-8248.93parvin beta [Source:NCBI gene;Acc:448070][more]
parvb2.533e-8046.98parvin beta [Source:NCBI gene;Acc:448070][more]
back to top
BLAST of beta-parvin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Parva2.748e-9650.30parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144][more]
Parva2.748e-9650.30parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144][more]
Parva9.429e-9650.15parvin, alpha [Source:MGI Symbol;Acc:MGI:1931144][more]
Parvb9.506e-9350.41parvin, beta [Source:MGI Symbol;Acc:MGI:2153063][more]
Parvg1.111e-5937.95parvin, gamma [Source:MGI Symbol;Acc:MGI:2158329][more]
back to top
BLAST of beta-parvin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HBI1|PARVB_HUMAN6.253e-10351.86Beta-parvin OS=Homo sapiens OX=9606 GN=PARVB PE=1 ... [more]
sp|Q9NVD7|PARVA_HUMAN6.209e-9650.61Alpha-parvin OS=Homo sapiens OX=9606 GN=PARVA PE=1... [more]
sp|Q9EPC1|PARVA_MOUSE1.922e-9550.30Alpha-parvin OS=Mus musculus OX=10090 GN=Parva PE=... [more]
sp|Q9HB97|PARVA_RAT5.460e-9550.00Alpha-parvin OS=Rattus norvegicus OX=10116 GN=Parv... [more]
sp|Q9ES46|PARVB_MOUSE6.649e-9250.41Beta-parvin OS=Mus musculus OX=10090 GN=Parvb PE=1... [more]
back to top
BLAST of beta-parvin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZXG78.239e-12055.25Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3HFH98.797e-11556.30beta-parvin OS=Lingula unguis OX=7574 GN=LOC106154... [more]
A0A0B7A9F11.338e-11153.61Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A3S1HQ961.165e-10851.79Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0K8RPH18.992e-10754.52Putative alpha-parvin (Fragment) OS=Ixodes ricinus... [more]
back to top
BLAST of beta-parvin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvab7.189e-9850.30parvin alpha [Source:NCBI gene;Acc:103040577][more]
parvab1.184e-9650.00parvin alpha [Source:NCBI gene;Acc:103040577][more]
parvab1.576e-8548.32parvin alpha [Source:NCBI gene;Acc:103040577][more]
parvb2.018e-8448.94parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411... [more]
parvb2.943e-6443.70parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411... [more]
back to top
BLAST of beta-parvin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvb5.242e-9951.21parvin, beta [Source:ZFIN;Acc:ZDB-GENE-030131-4411... [more]
PARVA9.392e-8549.66parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652][more]
ENSPMAT00000002752.11.551e-4931.13pep scaffold:Pmarinus_7.0:GL477517:73851:92045:1 g... [more]
PARVA3.119e-4042.20parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652][more]
PARVA1.526e-3941.74parvin alpha [Source:HGNC Symbol;Acc:HGNC:14652][more]
back to top
BLAST of beta-parvin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-parvin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO409383.397e-6543.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301992.056e-3052.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306241.580e-2350.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281857.439e-1642.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-parvin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parvb2.493e-9650.71parvin beta [Source:NCBI gene;Acc:101156404][more]
parvaa3.126e-9650.30alpha-parvin [Source:NCBI gene;Acc:101161694][more]
parvb1.132e-9550.45parvin beta [Source:NCBI gene;Acc:101156404][more]
parvb1.395e-9550.43parvin beta [Source:NCBI gene;Acc:101156404][more]
parvaa3.049e-8747.28alpha-parvin [Source:NCBI gene;Acc:101161694][more]
back to top
BLAST of beta-parvin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080798.10.000e+099.72SMESG000080798.1[more]
SMESG000054735.10.000e+099.72SMESG000054735.1[more]
SMESG000061495.11.485e-6335.61SMESG000061495.1[more]
SMESG000061495.11.154e-2737.04SMESG000061495.1[more]
SMESG000061495.11.098e-2534.69SMESG000061495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002721 ID=SMED30002721|Name=beta-parvin|organism=Schmidtea mediterranea sexual|type=transcript|length=1598bp
ATTTAATTTCTCGAATTTAGATATTTTTTTATTGTTGACAAAACAGAAAT
TTTTGGTCTTTCTGAAATTTATATTCTACTAATTGAAACAACAATGAGTA
CTCCAACTGGCCATAAAACTCCTTTGAAAGAAGAAAATTTTTTAAACAAA
TTGACAACATTAAATCGTAAAAAAAAGAAGCAACAAGAAATTGAAGAATT
AACACTTGAAGGAAAACAAGCTATTGAATCTCCTCTAAGTCCTTTAATAC
CAGACTTAGGACCAGATGGGTATCATTTAGAAGAAGGCGAAGAAAGATTT
TTGATTGAACCTTTTGCCAAAGAATCACCAAAAGTTACTGCACTCGTATC
AATGCTATTGGAATGGATTAATTCTGAATTCGTTGAACAAAGAATTCTAG
TAAGAAATCTTGAAGAAGATCTTTATGATGGTCAGATTTTGCAAAAATTA
ATCGAGAAATTGTCTGGAATAAAAGTTGATCACCCTGAAGTTACGCAATC
TGAAATGGGACAAAAACAACGATTAAAAATAGTGATTGAATCTATTAATC
AAACACTCAACGCTCACGGGTCTTTTGATACGTCAAAATGGACAGTTGAA
AAAATCTATTCTAAAGATTTGGTTGCAATTCTCCGATTGCTGGTTGCATT
AGCGCGGTATTATAAAGCTCCAATCAGAATGCCAGAGGGCGTTTGTATCA
GTGTTTTGTTGGTTCGCAAGCTTAACGGCCAACTACATCATTGGAGACAA
AATGAAATCATTACCGATGCCAGCTTTCAATTACTAAATGAAGCTACCGA
TGAACAAGACGCATTTAGTGTATTAGTGGACTTTGCTCCTGATAAATTAC
AGCTTGTCCGTGAAACTCTAATAACTTTTACCAATTCCAACTTACAAAAA
ATTAATCTTTCAGTCACCGATCTCGATAATCAGTTTTGTGATGGTGTCTT
TCTGATTCTTCTCATGGGTTTGTTAGAAGGATATTTTGTTCCTCTCTACA
GCTTTCACCCAACACCTACAACAATGGATCAACGAATTAGCAATGTTCAA
TTAGCTTTTAGTCTTATGAAAGATGCCGGCGTCCCATCATTTACAACTCG
AGCAGAAGATGTGGTCAATGGAGATTTGAAGTCGATTTTAAGAGTTCTTT
ATATTCTATTCTCTACATACAAGGAGACCTAATTATTTATTATTATTATT
ATCAGTATAGTCAATGAATTTATTGCCTTTATTTTATGAAATCCTTTTCA
CTATTCATCCAATTGACATTCACGTCGTCAGTCATGATATGATTTGGGAT
TTGTGCAATGTGATGAAAATGAGTTGCTATTGACAATGATCTCTATAATT
TTTTATTATTTAATATATAAATTTTTATTGGGGGTTATATATTATGCATG
TGACCATAATCTTTCATATCTTTTACTTATGCTTTATGAAATTTTAAAAA
TTTATAATATAATTGTTTTCAAATGATATGAGCGTTTCGATTAAATCTTG
AAATTGTTCTAGATTTGATATTTTGCTTTAATTTTGTACTTCAATTTGAA
TATTATTACTATAGAAGAATAATTTTTGTAGTTTTAATTAAATATTCG
back to top

protein sequence of SMED30002721-orf-1

>SMED30002721-orf-1 ID=SMED30002721-orf-1|Name=SMED30002721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MSTPTGHKTPLKEENFLNKLTTLNRKKKKQQEIEELTLEGKQAIESPLSP
LIPDLGPDGYHLEEGEERFLIEPFAKESPKVTALVSMLLEWINSEFVEQR
ILVRNLEEDLYDGQILQKLIEKLSGIKVDHPEVTQSEMGQKQRLKIVIES
INQTLNAHGSFDTSKWTVEKIYSKDLVAILRLLVALARYYKAPIRMPEGV
CISVLLVRKLNGQLHHWRQNEIITDASFQLLNEATDEQDAFSVLVDFAPD
KLQLVRETLITFTNSNLQKINLSVTDLDNQFCDGVFLILLMGLLEGYFVP
LYSFHPTPTTMDQRISNVQLAFSLMKDAGVPSFTTRAEDVVNGDLKSILR
VLYILFSTYKET*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008610lipid biosynthetic process
GO:0031532actin cytoskeleton reorganization
GO:0007155cell adhesion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR028433Parvin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 19..46
NoneNo IPR availablePANTHERPTHR12114:SF7BETA-PARVINcoord: 12..361
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 255..358
e-value: 4.2E-4
score: 29.6
coord: 84..186
e-value: 0.04
score: 21.9
IPR001715Calponin homology domainPFAMPF00307CHcoord: 87..191
e-value: 6.8E-14
score: 52.0
coord: 256..360
e-value: 1.2E-13
score: 51.2
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 253..360
score: 17.638
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 82..191
score: 16.153
IPR028433ParvinPIRSFPIRSF039131Parvincoord: 1..362
e-value: 1.6E-136
score: 453.1
IPR028433ParvinPANTHERPTHR12114PARVINcoord: 12..361
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 66..192
e-value: 7.0E-18
score: 66.6
coord: 232..361
e-value: 3.0E-27
score: 96.9
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 27..361