Dynein heavy chain 3, axonemal

Overview
NameDynein heavy chain 3, axonemal
Smed IDSMED30002712
Length (bp)455
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain 3, axonemal (SMED30002712) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain 3, axonemal (SMED30002712) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain 3, axonemal (SMED30002712) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain 3, axonemal (SMED30002712) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002712

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002712SMESG000040510.1 SMESG000040507.1 SmedASXL_018112SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30002712SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002712SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002712SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002712SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002712SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 71.633 bits (174), Expect = 1.126e-14
Identity = 40/92 (43.48%), Postives = 57/92 (61.96%), Query Frame = 1
Query:  142 SSSIPH--------KLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYP 393
            S SI H        +LPPL +  +A EE S +++  + HS +PP+M   S TLAAPFKEQ + R PS+SI NN++  A +L++K L K+  P
Sbjct:   43 SDSIHHMSHSQGQPELPPLPA--SANEEPSGLYQTVMSHSFYPPLMQRTSWTLAAPFKEQHHHRGPSDSIANNYSLMAQDLKLKDLLKVYQP 132          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 77.7962 bits (190), Expect = 6.806e-17
Identity = 38/87 (43.68%), Postives = 63/87 (72.41%), Query Frame = 1
Query:  121 SLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPK 381
            SL   ++S  +P  LPPL +  +++ E SE++++ +KHS +PP+M  +S T+AAPFKE ++ R+PS SIGNN++PTA +L++  + K
Sbjct:    8 SLYNMSHSRGLP-GLPPLPT--SSSTEPSELYQLVLKHSNYPPLMQSISWTVAAPFKEHRFHRSPSNSIGNNYSPTARDLKLTEMMK 91          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 77.7962 bits (190), Expect = 7.006e-17
Identity = 38/87 (43.68%), Postives = 63/87 (72.41%), Query Frame = 1
Query:  121 SLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPK 381
            SL   ++S  +P  LPPL +  +++ E SE++++ +KHS +PP+M  +S T+AAPFKE ++ R+PS SIGNN++PTA +L++  + K
Sbjct:    8 SLYNMSHSRGLP-GLPPLPT--SSSTEPSELYQLVLKHSNYPPLMQSISWTVAAPFKEHRFHRSPSNSIGNNYSPTARDLKLTEMMK 91          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 74.7146 bits (182), Expect = 1.642e-17
Identity = 41/98 (41.84%), Postives = 65/98 (66.33%), Query Frame = 1
Query:  106 MEGGRSLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPI 399
            ++   S+   ++S + P +LPPL    +A EE SE+++  + HS +PP+M   S TLA PFKEQ + R PS+SIGNN++ TA ++++K L K+ Y P+
Sbjct:    1 LDKSDSVHHMSHSQARP-ELPPLPV--SANEEPSELYKTVMSHSFYPPLMQRTSWTLAVPFKEQDHHRGPSDSIGNNYSLTARDMKLKDLLKV-YQPV 94          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 76.6406 bits (187), Expect = 1.266e-16
Identity = 42/99 (42.42%), Postives = 66/99 (66.67%), Query Frame = 1
Query:  103 KMEGGRSLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPI 399
            K++   S+   ++S + P +LPPL    +A EE SE+++  + HS +PP+M   S TLA PFKEQ + R PS+SIGNN++ TA ++++K L K+ Y P+
Sbjct:   10 KLDKSDSVHHMSHSQARP-ELPPLPV--SANEEPSELYKTVMSHSFYPPLMQRTSWTLAVPFKEQDHHRGPSDSIGNNYSLTARDMKLKDLLKV-YQPV 104          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 76.6406 bits (187), Expect = 1.329e-16
Identity = 42/99 (42.42%), Postives = 66/99 (66.67%), Query Frame = 1
Query:  103 KMEGGRSLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPI 399
            K++   S+   ++S + P +LPPL    +A EE SE+++  + HS +PP+M   S TLA PFKEQ + R PS+SIGNN++ TA ++++K L K+ Y P+
Sbjct:   10 KLDKSDSVHHMSHSQARP-ELPPLPV--SANEEPSELYKTVMSHSFYPPLMQRTSWTLAVPFKEQDHHRGPSDSIGNNYSLTARDMKLKDLLKV-YQPV 104          
BLAST of Dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 9.293e-16
Identity = 42/99 (42.42%), Postives = 66/99 (66.67%), Query Frame = 1
Query:  103 KMEGGRSLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPI 399
            K++   S+   ++S + P +LPPL    +A EE SE+++  + HS +PP+M   S TLA PFKEQ + R PS+SIGNN++ TA ++++K L K+ Y P+
Sbjct:   10 KLDKSDSVHHMSHSQARP-ELPPLPV--SANEEPSELYKTVMSHSFYPPLMQRTSWTLAVPFKEQDHHRGPSDSIGNNYSLTARDMKLKDLLKV-YQPV 104          
BLAST of Dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.409e-14
Identity = 40/92 (43.48%), Postives = 57/92 (61.96%), Query Frame = 1
Query:  142 SSSIPH--------KLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYP 393
            S SI H        +LPPL +  +A EE S +++  + HS +PP+M   S TLAAPFKEQ + R PS+SI NN++  A +L++K L K+  P
Sbjct:   43 SDSIHHMSHSQGQPELPPLPA--SANEEPSGLYQTVMSHSFYPPLMQRTSWTLAAPFKEQHHHRGPSDSIANNYSLMAQDLKLKDLLKVYQP 132          
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A267EIQ4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017039g5 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.108e-23
Identity = 58/117 (49.57%), Postives = 78/117 (66.67%), Query Frame = 1
Query:  100 LKMEGGRSLETPTYSSSIPHKLP---PLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQ--PAKKRK 435
            + +E  R LETPT+S+     LP   PL   + A    S ++EI  ++S+HPP+MN  S+T AAPFKEQK++RTPSESIGNNF+P A +L+IK+LP+ R  P    A Q  PA KR+
Sbjct:    1 MALEKARMLETPTFSTGFSRGLPTLRPLPQSEGAAAAPSALYEIVTRNSMHPPLMNQFSMTRAAPFKEQKHARTPSESIGNNFSPGARHLKIKKLPRSRSNPPATGASQEFPAAKRR 117          
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A267EPJ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017039g2 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.526e-23
Identity = 58/117 (49.57%), Postives = 78/117 (66.67%), Query Frame = 1
Query:  100 LKMEGGRSLETPTYSSSIPHKLP---PLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQ--PAKKRK 435
            + +E  R LETPT+S+     LP   PL   + A    S ++EI  ++S+HPP+MN  S+T AAPFKEQK++RTPSESIGNNF+P A +L+IK+LP+ R  P    A Q  PA KR+
Sbjct:    1 MALEKARMLETPTFSTGFSRGLPTLRPLPQSEGAAAAPSALYEIVTRNSMHPPLMNQFSMTRAAPFKEQKHARTPSESIGNNFSPGARHLKIKKLPRSRSNPPATGASQEFPAAKRR 117          
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Match: A0A1I8J3L2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.526e-23
Identity = 58/117 (49.57%), Postives = 78/117 (66.67%), Query Frame = 1
Query:  100 LKMEGGRSLETPTYSSSIPHKLP---PLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQ--PAKKRK 435
            + +E  R LETPT+S+     LP   PL   + A    S ++EI  ++S+HPP+MN  S+T AAPFKEQK++RTPSESIGNNF+P A +L+IK+LP+ R  P    A Q  PA KR+
Sbjct:    1 MALEKARMLETPTFSTGFSRGLPTLRPLPQSEGAAAAPSALYEIVTRNSMHPPLMNQFSMTRAAPFKEQKHARTPSESIGNNFSPGARHLKIKKLPRSRSNPPATGASQEFPAAKRR 117          
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Match: X1ZK09 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.106e-20
Identity = 50/130 (38.46%), Postives = 77/130 (59.23%), Query Frame = 1
Query:  100 LKMEGGRSLETPTYSSSIPHKLPPLTSVKTATEEN-SEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYP------------PIPEIAIQPAKKRKFWETE 450
            + +E  R  ETP YS S    LP L  + ++++ + S ++++ ++HS HPPIM   S T AAP+KEQK+ R+PSESI NN+TPTA++L++K +PK R              P+P + + P  K +    E
Sbjct:    1 MALERQRFTETPLYSCSKTKGLPGLPPLPSSSDRDPSHLYQVVLRHSEHPPIMKSTSWTKAAPYKEQKHHRSPSESIANNYTPTASDLKLKDIPKHRVALKVNKDAFNPPKPLPAVRLSPRNKTRAQRAE 130          
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Match: R7V9Q6 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_187201 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.199e-20
Identity = 50/130 (38.46%), Postives = 77/130 (59.23%), Query Frame = 1
Query:  100 LKMEGGRSLETPTYSSSIPHKLPPLTSVKTATEEN-SEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYP------------PIPEIAIQPAKKRKFWETE 450
            + +E  R  ETP YS S    LP L  + ++++ + S ++++ ++HS HPPIM   S T AAP+KEQK+ R+PSESI NN+TPTA++L++K +PK R              P+P + + P  K +    E
Sbjct:    1 MALERQRFTETPLYSCSKTKGLPGLPPLPSSSDRDPSHLYQVVLRHSEHPPIMKSTSWTKAAPYKEQKHHRSPSESIANNYTPTASDLKLKDIPKHRVALKVNKDAFNPPKPLPAVRLSPRNKTRAQRAE 130          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000049378.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000306.1:105662:121325:-1 gene:ENSAMXG00000040938.1 transcript:ENSAMXT00000049378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 8.622e-8
Identity = 33/84 (39.29%), Postives = 45/84 (53.57%), Query Frame = 1
Query:  142 SSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYP 393
            SSS    LP L S    T   S+++++       PP+M     TLA P+KE  + RTPSESI NN++P A +L+I  L     P
Sbjct:    8 SSSPGCALPSLPS----TAAPSQLYQVCSHQ--FPPLMQNTCRTLAVPYKEVWHCRTPSESIANNYSPRAQHLKIPHLQHRHTP 85          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000046164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000306.1:105662:121325:-1 gene:ENSAMXG00000040938.1 transcript:ENSAMXT00000046164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.222e-7
Identity = 32/78 (41.03%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  142 SSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRL 375
            SSS    LP L S    T   S+++++       PP+M     TLA P+KE  + RTPSESI NN++P A +L+I  L
Sbjct:    8 SSSPGCALPSLPS----TAAPSQLYQVCSHQ--FPPLMQNTCRTLAVPYKEVWHCRTPSESIANNYSPRAQHLKIPHL 79          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000808.1 (pep scaffold:Pmarinus_7.0:GL477024:11658:25103:1 gene:ENSPMAG00000000735.1 transcript:ENSPMAT00000000808.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 9.577e-14
Identity = 30/62 (48.39%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  217 EIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIP 402
            ++ +  + HPPIM   S T A P+KEQ Y RTPSESI NN+TP+ ++LR++ L +   PP P
Sbjct:    1 QMVMHSNAHPPIMLSASWTQAVPYKEQSYHRTPSESIANNYTPSVSSLRLQALARRYEPPAP 62          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000806.1 (pep scaffold:Pmarinus_7.0:GL477024:11649:21896:1 gene:ENSPMAG00000000735.1 transcript:ENSPMAT00000000806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.926e-13
Identity = 30/62 (48.39%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  217 EIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIP 402
            ++ +  + HPPIM   S T A P+KEQ Y RTPSESI NN+TP+ ++LR++ L +   PP P
Sbjct:    4 QMVMHSNAHPPIMLSASWTQAVPYKEQSYHRTPSESIANNYTPSVSSLRLQALARRYEPPAP 65          
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 78.5666 bits (192), Expect = 8.197e-18
Identity = 41/84 (48.81%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  130 TPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIMNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPK 381
            +P +S S    LP L  +  + E  SE+++I ++HS HPPIM   S T AAPFKE  ++RTPSESI NN++P A+NLR++ LP+
Sbjct:   51 SPLFSCSQTKGLPGLPPLPPSNESPSELYQIVLRHSEHPPIMKDPSWTRAAPFKETSFARTPSESIANNYSPAASNLRLRSLPR 134          
BLAST of Dynein heavy chain 3, axonemal vs. Planmine SMEST
Match: SMESG000040507.1 (SMESG000040507.1)

HSP 1 Score: 141.354 bits (355), Expect = 3.516e-40
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
Query:  253 MNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQPAKKRKFWETED 453
            MNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQPAKKRKFWETED
Sbjct:    1 MNPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPEIAIQPAKKRKFWETED 67          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DNAH31.126e-1443.48dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttc21a6.806e-1743.68tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a7.006e-1743.68tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dnah31.642e-1741.84dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah31.266e-1642.42dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah31.329e-1642.42dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8BW94|DYH3_MOUSE9.293e-1642.42Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q8TD57|DYH3_HUMAN5.409e-1443.48Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EIQ42.108e-2349.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EPJ62.526e-2349.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J3L22.526e-2349.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
X1ZK091.106e-2038.46Uncharacterized protein OS=Capitella teleta OX=283... [more]
R7V9Q61.199e-2038.46Uncharacterized protein (Fragment) OS=Capitella te... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000049378.18.622e-839.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046164.11.222e-741.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000808.19.577e-1448.39pep scaffold:Pmarinus_7.0:GL477024:11658:25103:1 g... [more]
ENSPMAT00000000806.12.926e-1348.39pep scaffold:Pmarinus_7.0:GL477024:11649:21896:1 g... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO347278.197e-1848.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain 3, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000040507.13.516e-40100.00SMESG000040507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002712 ID=SMED30002712|Name=Dynein heavy chain 3, axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=455bp
TAAAATTCAAATTACGCAATAGATAATTATTCAGAAATTTAATTATTAAA
TTTAATAATTAAATTTATATTCCATTTTTCTTAAATCAAATAATAAATAT
TAAAAATGGAAGGCGGAAGGTCTCTGGAAACTCCAACGTACAGTTCCAGT
ATTCCTCACAAGCTTCCTCCACTGACATCGGTTAAAACTGCTACCGAAGA
AAACTCTGAAATATTTGAAATTGCCATCAAACATAGTATTCATCCACCAA
TTATGAATCCAGTCTCATTGACGTTGGCGGCTCCTTTCAAAGAGCAAAAA
TATTCCAGAACTCCGAGTGAATCAATTGGTAATAATTTCACGCCAACTGC
TAATAATTTGCGAATAAAACGATTGCCGAAAATGCGATATCCTCCAATTC
CAGAAATTGCAATTCAACCAGCAAAAAAACGAAAGTTTTGGGAAACGGAA
GATTC
back to top

protein sequence of SMED30002712-orf-1

>SMED30002712-orf-1 ID=SMED30002712-orf-1|Name=SMED30002712-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MEGGRSLETPTYSSSIPHKLPPLTSVKTATEENSEIFEIAIKHSIHPPIM
NPVSLTLAAPFKEQKYSRTPSESIGNNFTPTANNLRIKRLPKMRYPPIPE
IAIQPAKKRKFWETED
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex