60S ribosomal protein L23a

Overview
Name60S ribosomal protein L23a
Smed IDSMED30002703
Length (bp)581
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L23a (SMED30002703) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L23a (SMED30002703) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L23a (SMED30002703) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L23a (SMED30002703) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002703

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002703SMESG000074545.1 SmedASXL_006669SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002703SMESG000074545.1 dd_Smed_v4_281_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002703SMESG000074545.1 Contig51231newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002703SMESG000074545.1 Contig51231uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30002703SMESG000074545.1 dd_Smed_v6_281_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002703SMESG000074545.1 dd_Smed_v6_281_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30002703SMESG000074545.1 dd_Smed_v6_281_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30002703SMESG000074545.1 dd_Smed_v6_281_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Match: RPL23A (ribosomal protein L23a [Source:HGNC Symbol;Acc:HGNC:10317])

HSP 1 Score: 139.428 bits (350), Expect = 1.277e-41
Identity = 72/125 (57.60%), Postives = 88/125 (70.40%), Query Frame = 3
Query:  156 ILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            +L G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   21 VLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 144          
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Match: RPL23A (ribosomal protein L23a [Source:HGNC Symbol;Acc:HGNC:10317])

HSP 1 Score: 139.813 bits (351), Expect = 1.356e-41
Identity = 72/125 (57.60%), Postives = 88/125 (70.40%), Query Frame = 3
Query:  156 ILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            +L G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   47 VLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 170          
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Match: RPL23A (ribosomal protein L23a [Source:HGNC Symbol;Acc:HGNC:10317])

HSP 1 Score: 138.658 bits (348), Expect = 6.181e-41
Identity = 72/125 (57.60%), Postives = 88/125 (70.40%), Query Frame = 3
Query:  156 ILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            +L G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   66 VLKGVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 189          
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Match: RPL23A (ribosomal protein L23a [Source:HGNC Symbol;Acc:HGNC:10317])

HSP 1 Score: 136.732 bits (343), Expect = 1.082e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Match: RPL23A (ribosomal protein L23a [Source:HGNC Symbol;Acc:HGNC:10317])

HSP 1 Score: 136.346 bits (342), Expect = 1.381e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   33 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 153          
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Match: rpl-25.1 (60S ribosomal protein L23a 1 [Source:UniProtKB/Swiss-Prot;Acc:P48162])

HSP 1 Score: 130.568 bits (327), Expect = 8.774e-39
Identity = 66/128 (51.56%), Postives = 90/128 (70.31%), Query Frame = 3
Query:  147 KSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            K K++ G      R++RT+  F+RPVT K  R  ++ R S+ + +K+D FRI++HPLTTESAMK IEE NTLVF V   A K+ IK A+ KLY+++++K+NTL       KKA+V+L ADYDALDVAN
Sbjct:   16 KKKVVKGKRTTHRRQVRTSVHFRRPVTLKTARQARFPRKSAPKTSKMDHFRIIQHPLTTESAMKKIEEHNTLVFIVSNDANKYQIKDAVHKLYNVQALKVNTL-ITPLQQKKAYVRLTADYDALDVAN 142          
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Match: rpl-25.2 (60S ribosomal protein L23a 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20647])

HSP 1 Score: 123.635 bits (309), Expect = 4.466e-36
Identity = 64/130 (49.23%), Postives = 88/130 (67.69%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            Q K  ++ G+     + +RT+  F+RP T    R P+Y R S+   +KLD F ++K P TTES+MK IE+ NTLVF VD+ A KH+IK A+  LY++K+VK+NTL       KKA+V+LA+DYDALDVAN
Sbjct:   13 QAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARDKLDSFAVIKAPHTTESSMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTL-ITPLQQKKAYVRLASDYDALDVAN 141          
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Match: rpl-25.2 (60S ribosomal protein L23a 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20647])

HSP 1 Score: 123.635 bits (309), Expect = 4.466e-36
Identity = 64/130 (49.23%), Postives = 88/130 (67.69%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            Q K  ++ G+     + +RT+  F+RP T    R P+Y R S+   +KLD F ++K P TTES+MK IE+ NTLVF VD+ A KH+IK A+  LY++K+VK+NTL       KKA+V+LA+DYDALDVAN
Sbjct:   13 QAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARDKLDSFAVIKAPHTTESSMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTL-ITPLQQKKAYVRLASDYDALDVAN 141          
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Match: rpl-25.2 (60S ribosomal protein L23a 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20647])

HSP 1 Score: 123.635 bits (309), Expect = 4.466e-36
Identity = 64/130 (49.23%), Postives = 88/130 (67.69%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            Q K  ++ G+     + +RT+  F+RP T    R P+Y R S+   +KLD F ++K P TTES+MK IE+ NTLVF VD+ A KH+IK A+  LY++K+VK+NTL       KKA+V+LA+DYDALDVAN
Sbjct:   13 QAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARDKLDSFAVIKAPHTTESSMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTL-ITPLQQKKAYVRLASDYDALDVAN 141          
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Match: rpl-25.2 (60S ribosomal protein L23a 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20647])

HSP 1 Score: 123.635 bits (309), Expect = 4.466e-36
Identity = 64/130 (49.23%), Postives = 88/130 (67.69%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            Q K  ++ G+     + +RT+  F+RP T    R P+Y R S+   +KLD F ++K P TTES+MK IE+ NTLVF VD+ A KH+IK A+  LY++K+VK+NTL       KKA+V+LA+DYDALDVAN
Sbjct:   13 QAKKAVVKGSKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARDKLDSFAVIKAPHTTESSMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTL-ITPLQQKKAYVRLASDYDALDVAN 141          
BLAST of 60S ribosomal protein L23a vs. Ensembl Fly
Match: RpL23A (gene:FBgn0026372 transcript:FBtr0474640)

HSP 1 Score: 129.413 bits (324), Expect = 8.750e-37
Identity = 67/131 (51.15%), Postives = 90/131 (68.70%), Query Frame = 3
Query:  138 EQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            ++V+ KI+ GA   R R+IRT   F+RP T K  R+PKY R S    N++D + I+K+PLTTE+AMK IE+ NTLVF     A K++++ A+RKLYDIK  K+N L       KKA+V+LA DYDALD+AN
Sbjct:  143 KKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVL-IRPDGQKKAYVRLARDYDALDIAN 272          
BLAST of 60S ribosomal protein L23a vs. Ensembl Fly
Match: RpL23A (gene:FBgn0026372 transcript:FBtr0072805)

HSP 1 Score: 129.413 bits (324), Expect = 8.750e-37
Identity = 67/131 (51.15%), Postives = 90/131 (68.70%), Query Frame = 3
Query:  138 EQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            ++V+ KI+ GA   R R+IRT   F+RP T K  R+PKY R S    N++D + I+K+PLTTE+AMK IE+ NTLVF     A K++++ A+RKLYDIK  K+N L       KKA+V+LA DYDALD+AN
Sbjct:  143 KKVQKKIIKGAFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVL-IRPDGQKKAYVRLARDYDALDIAN 272          
BLAST of 60S ribosomal protein L23a vs. Ensembl Zebrafish
Match: rpl23a (ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-030131-7479])

HSP 1 Score: 137.117 bits (344), Expect = 4.360e-41
Identity = 72/122 (59.02%), Postives = 85/122 (69.67%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRTTP F RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   27 GVHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 147          
BLAST of 60S ribosomal protein L23a vs. Ensembl Zebrafish
Match: rpl23a (ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-030131-7479])

HSP 1 Score: 136.732 bits (343), Expect = 5.796e-41
Identity = 72/122 (59.02%), Postives = 85/122 (69.67%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRTTP F RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   22 GVHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 142          
BLAST of 60S ribosomal protein L23a vs. Ensembl Zebrafish
Match: rpl23a (ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-030131-7479])

HSP 1 Score: 136.732 bits (343), Expect = 5.799e-41
Identity = 72/122 (59.02%), Postives = 85/122 (69.67%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRTTP F RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   30 GVHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 150          
BLAST of 60S ribosomal protein L23a vs. Ensembl Xenopus
Match: rpl23a (ribosomal protein L23a [Source:NCBI gene;Acc:448689])

HSP 1 Score: 133.65 bits (335), Expect = 1.657e-39
Identity = 70/122 (57.38%), Postives = 85/122 (69.67%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+   NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   30 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPTRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVQKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 150          
BLAST of 60S ribosomal protein L23a vs. Ensembl Xenopus
Match: rpl23a (ribosomal protein L23a [Source:NCBI gene;Acc:448689])

HSP 1 Score: 132.109 bits (331), Expect = 1.685e-38
Identity = 70/122 (57.38%), Postives = 85/122 (69.67%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+   NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   64 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPTRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVQKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 184          
BLAST of 60S ribosomal protein L23a vs. Ensembl Mouse
Match: Rpl23a (ribosomal protein L23A [Source:MGI Symbol;Acc:MGI:3040672])

HSP 1 Score: 136.732 bits (343), Expect = 7.426e-41
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Match: sp|P62752|RL23A_RAT (60S ribosomal protein L23a OS=Rattus norvegicus OX=10116 GN=Rpl23a PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.195e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Match: sp|P62751|RL23A_MOUSE (60S ribosomal protein L23a OS=Mus musculus OX=10090 GN=Rpl23a PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.195e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Match: sp|P62750|RL23A_HUMAN (60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.195e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Match: sp|Q24JY1|RL23A_BOVIN (60S ribosomal protein L23a OS=Bos taurus OX=9913 GN=RPL23A PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 5.195e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   31 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 151          
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Match: sp|P48162|R23A1_CAEEL (60S ribosomal protein L23a 1 OS=Caenorhabditis elegans OX=6239 GN=rpl-25.1 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.116e-37
Identity = 66/128 (51.56%), Postives = 90/128 (70.31%), Query Frame = 3
Query:  147 KSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            K K++ G      R++RT+  F+RPVT K  R  ++ R S+ + +K+D FRI++HPLTTESAMK IEE NTLVF V   A K+ IK A+ KLY+++++K+NTL       KKA+V+L ADYDALDVAN
Sbjct:   16 KKKVVKGKRTTHRRQVRTSVHFRRPVTLKTARQARFPRKSAPKTSKMDHFRIIQHPLTTESAMKKIEEHNTLVFIVSNDANKYQIKDAVHKLYNVQALKVNTL-ITPLQQKKAYVRLTADYDALDVAN 142          
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Match: A0A0U2LEL3 (60S ribosomal protein L23a OS=Acartia pacifica OX=335913 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 8.213e-42
Identity = 73/130 (56.15%), Postives = 94/130 (72.31%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            + K K++ G H  RV+++RT+ KF RP T+KP RNPKY R S+ + NK+D + I+KHPLTTESAMK IE+ NTLVF  D  A KH ++ A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   40 KTKKKVVKGLHGTRVKKVRTSVKFYRPKTFKPPRNPKYPRKSTPKRNKMDAYAIIKHPLTTESAMKKIEDNNTLVFICDIKANKHQVRAAVKKLYDINVAKVNTL-VRPDGQKKAYVRLAPDYDALDVAN 168          
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Match: A0A0U2M8Z7 (60S ribosomal protein L23a OS=Acartia pacifica OX=335913 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.161e-41
Identity = 72/130 (55.38%), Postives = 94/130 (72.31%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            + K K++ G H  RV+++RT+ KF RP T+KP RNPKY R S+ + NK+D + I++HPLTTESAMK IE+ NTLVF  D  A KH ++ A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   40 KTKKKVVKGLHGTRVKKVRTSVKFYRPKTFKPPRNPKYPRKSTPKRNKMDAYAIIRHPLTTESAMKKIEDNNTLVFICDIKANKHQVRAAVKKLYDINVAKVNTL-VRPDGQKKAYVRLAPDYDALDVAN 168          
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Match: A0A267G2U2 (Ribosomal_L23eN domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022537g1 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.339e-41
Identity = 75/130 (57.69%), Postives = 97/130 (74.62%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            + K + L G    R R+IRTTP+FKRP TY+P R PKY R S  R N LD F+I+++PLTTES+MK IEE+NTLVF VD+ A+K  IK A++KLYDI++ K+NTL       KKA+VKL+A++DALDVAN
Sbjct:    5 KAKGQQLKGTQQLRKRKIRTTPRFKRPETYRPPRAPKYARRSLPRRNALDAFKIMQYPLTTESSMKKIEEQNTLVFIVDKRASKPLIKDAVKKLYDIQASKVNTL-IRPDGLKKAYVKLSAEHDALDVAN 133          
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Match: A0A267F1T4 (Ribosomal_L23eN domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022537g2 PE=3 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.653e-41
Identity = 75/130 (57.69%), Postives = 97/130 (74.62%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            + K + L G    R R+IRTTP+FKRP TY+P R PKY R S  R N LD F+I+++PLTTES+MK IEE+NTLVF VD+ A+K  IK A++KLYDI++ K+NTL       KKA+VKL+A++DALDVAN
Sbjct:    2 KAKGQQLKGTQQLRKRKIRTTPRFKRPETYRPPRAPKYARRSLPRRNALDAFKIMQYPLTTESSMKKIEEQNTLVFIVDKRASKPLIKDAVKKLYDIQASKVNTL-IRPDGLKKAYVKLSAEHDALDVAN 130          
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Match: A0A0U2V8U3 (60S ribosomal protein L23a OS=Pseudodiaptomus poplesia OX=213370 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.817e-40
Identity = 71/130 (54.62%), Postives = 92/130 (70.77%), Query Frame = 3
Query:  141 QVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            + + +++ G H  RV+++RT+ KF RP T++P R PKY R S+ R N++D + I+KHPLTTESAMK IE+ NTLVF  D  A KH IK A+ KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   48 KTQKRVVKGVHGTRVKKVRTSVKFYRPKTFRPQRTPKYPRKSTPRRNRMDAYSIIKHPLTTESAMKKIEDNNTLVFITDIKANKHQIKAAVGKLYDISVSKVNTL-IRPDGQKKAYVRLAPDYDALDVAN 176          
BLAST of 60S ribosomal protein L23a vs. Ensembl Cavefish
Match: rpl23a (ribosomal protein L23a [Source:NCBI gene;Acc:103044345])

HSP 1 Score: 137.887 bits (346), Expect = 1.713e-41
Identity = 72/122 (59.02%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  R +++RT+P F+RP T +  R PKY R S+ R NKLD + IVK PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   30 GVHSQRKKKMRTSPTFRRPKTMRLRRQPKYPRKSAPRRNKLDHYAIVKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 150          
BLAST of 60S ribosomal protein L23a vs. Ensembl Sea Lamprey
Match: rpl23a (ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-030131-7479])

HSP 1 Score: 130.954 bits (328), Expect = 1.851e-39
Identity = 66/125 (52.80%), Postives = 86/125 (68.80%), Query Frame = 3
Query:  156 ILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            +L G H  R R++ T+P F+RP T +  R PKY R S+   NK+D + I+K PLTTE+AMK IE+ NTLVF  D  A KH IKLA++KLY+I  +K+NTL       KKA+V+L  D+DALDVAN
Sbjct:   27 VLRGVHAVRRRKVHTSPTFRRPHTLRLRRQPKYPRKSAPTRNKMDHYAIIKFPLTTEAAMKKIEDNNTLVFITDVRANKHQIKLAVKKLYNIGVMKVNTL-IRPDGEKKAYVRLTPDFDALDVAN 150          
BLAST of 60S ribosomal protein L23a vs. Ensembl Yeast
Match: RPL25 (Ribosomal 60S subunit protein L25; primary rRNA-binding ribosomal protein component of large ribosomal subunit; binds to 25S rRNA via a conserved C-terminal motif; homologous to mammalian ribosomal protein L23A and bacterial L23 [Source:SGD;Acc:S000005487])

HSP 1 Score: 108.612 bits (270), Expect = 4.771e-31
Identity = 52/122 (42.62%), Postives = 82/122 (67.21%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G +  +  ++RT+  F+ P T K  R PKY   +    N+LD +++++ P+T+E+AMK +E+ N LVF V   A K+ IK A+++LY++  +K+NTL    + TKKA+V+L ADYDALD+AN
Sbjct:   17 GTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTL-VRPNGTKKAYVRLTADYDALDIAN 137          
BLAST of 60S ribosomal protein L23a vs. Ensembl Nematostella
Match: EDO47563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM97])

HSP 1 Score: 134.035 bits (336), Expect = 2.119e-40
Identity = 70/131 (53.44%), Postives = 89/131 (67.94%), Query Frame = 3
Query:  138 EQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            ++ K  +  G    + +++RT+ KF RP T    RNPKY R+S+ R NKLD + I+KHPLTTESAMK IE+ NTLVF VD  A K  IK A++KLYDI   K+NTL       KKA+V+LA DYDALDV+N
Sbjct:   20 QKAKKAVQKGVRAAKTKKVRTSVKFHRPKTLSLRRNPKYPRTSAPRINKLDHYAIIKHPLTTESAMKKIEDNNTLVFIVDVRANKPQIKAAVKKLYDIVVSKVNTL-VRPDGQKKAYVRLAPDYDALDVSN 149          
BLAST of 60S ribosomal protein L23a vs. Ensembl Medaka
Match: rpl23a (ribosomal protein L23a [Source:NCBI gene;Acc:101172837])

HSP 1 Score: 136.346 bits (342), Expect = 1.163e-40
Identity = 71/122 (58.20%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  165 GAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            G H  + ++IRT+P F+RP T +  R PKY R S+ R NKLD + I+K PLTTESAMK IE+ NTLVF VD  A KH IK A++KLYDI   K+NTL       KKA+V+LA DYDALDVAN
Sbjct:   45 GVHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRNKLDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTL-IRPDGEKKAYVRLAPDYDALDVAN 165          
BLAST of 60S ribosomal protein L23a vs. Planmine SMEST
Match: SMESG000074545.1 (SMESG000074545.1)

HSP 1 Score: 291.967 bits (746), Expect = 3.567e-102
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 3
Query:   30 MAAKSHKEVVRNRRHVXXXXXXXXXXXXXXXXXXXXEQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 530
            MAAKSHKEVVRNRRHVKMALKKKEAKAKSATKAKVAEQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN
Sbjct:    1 MAAKSHKEVVRNRRHVKMALKKKEAKAKSATKAKVAEQVKSKILNGAHVGRVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTESAMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTKKAFVKLAADYDALDVAN 167          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L23a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL23A1.277e-4157.60ribosomal protein L23a [Source:HGNC Symbol;Acc:HGN... [more]
RPL23A1.356e-4157.60ribosomal protein L23a [Source:HGNC Symbol;Acc:HGN... [more]
RPL23A6.181e-4157.60ribosomal protein L23a [Source:HGNC Symbol;Acc:HGN... [more]
RPL23A1.082e-4058.20ribosomal protein L23a [Source:HGNC Symbol;Acc:HGN... [more]
RPL23A1.381e-4058.20ribosomal protein L23a [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl-25.18.774e-3951.5660S ribosomal protein L23a 1 [Source:UniProtKB/Sw... [more]
rpl-25.24.466e-3649.2360S ribosomal protein L23a 2 [Source:UniProtKB/Sw... [more]
rpl-25.24.466e-3649.2360S ribosomal protein L23a 2 [Source:UniProtKB/Sw... [more]
rpl-25.24.466e-3649.2360S ribosomal protein L23a 2 [Source:UniProtKB/Sw... [more]
rpl-25.24.466e-3649.2360S ribosomal protein L23a 2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpL23A8.750e-3751.15gene:FBgn0026372 transcript:FBtr0474640[more]
RpL23A8.750e-3751.15gene:FBgn0026372 transcript:FBtr0072805[more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl23a4.360e-4159.02ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rpl23a5.796e-4159.02ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rpl23a5.799e-4159.02ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl23a1.657e-3957.38ribosomal protein L23a [Source:NCBI gene;Acc:44868... [more]
rpl23a1.685e-3857.38ribosomal protein L23a [Source:NCBI gene;Acc:44868... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl23a7.426e-4158.20ribosomal protein L23A [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62752|RL23A_RAT5.195e-4058.2060S ribosomal protein L23a OS=Rattus norvegicus OX... [more]
sp|P62751|RL23A_MOUSE5.195e-4058.2060S ribosomal protein L23a OS=Mus musculus OX=1009... [more]
sp|P62750|RL23A_HUMAN5.195e-4058.2060S ribosomal protein L23a OS=Homo sapiens OX=9606... [more]
sp|Q24JY1|RL23A_BOVIN5.195e-4058.2060S ribosomal protein L23a OS=Bos taurus OX=9913 G... [more]
sp|P48162|R23A1_CAEEL1.116e-3751.5660S ribosomal protein L23a 1 OS=Caenorhabditis ele... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0U2LEL38.213e-4256.1560S ribosomal protein L23a OS=Acartia pacifica OX=... [more]
A0A0U2M8Z72.161e-4155.3860S ribosomal protein L23a OS=Acartia pacifica OX=... [more]
A0A267G2U22.339e-4157.69Ribosomal_L23eN domain-containing protein (Fragmen... [more]
A0A267F1T42.653e-4157.69Ribosomal_L23eN domain-containing protein (Fragmen... [more]
A0A0U2V8U31.817e-4054.6260S ribosomal protein L23a OS=Pseudodiaptomus popl... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl23a1.713e-4159.02ribosomal protein L23a [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl23a1.851e-3952.80ribosomal protein L23a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPL254.771e-3142.62Ribosomal 60S subunit protein L25; primary rRNA-bi... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO475632.119e-4053.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl23a1.163e-4058.20ribosomal protein L23a [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of 60S ribosomal protein L23a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000074545.13.567e-102100.00SMESG000074545.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002703 ID=SMED30002703|Name=60S ribosomal protein L23a|organism=Schmidtea mediterranea sexual|type=transcript|length=581bp
TTGTTTAAAAGCAATAAACTATATTTCAAATGGCAGCGAAGTCACATAAA
GAAGTTGTGAGAAACAGACGTCATGTTAAGATGGCTCTTAAGAAAAAGGA
AGCTAAAGCTAAATCAGCAACCAAAGCTAAAGTAGCTGAACAAGTTAAAT
CGAAAATTTTGAATGGTGCCCATGTTGGACGTGTTAGAAGAATTAGAACC
ACTCCTAAATTTAAACGTCCTGTTACTTATAAACCTTTAAGAAATCCTAA
ATATCAAAGATCATCTTCTACTAGAGAAAATAAACTTGATGAATTCCGAA
TTGTTAAACACCCATTAACAACTGAATCTGCAATGAAAATGATTGAAGAA
AAAAATACTTTGGTTTTCAGTGTTGATCAACACGCAACTAAACATAATAT
TAAATTGGCTATTCGCAAACTTTATGATATTAAATCAGTAAAGATTAACA
CTTTGAACTGCATTAGCAGTAACACAAAGAAAGCATTTGTGAAATTAGCA
GCTGATTACGATGCATTGGATGTTGCTAACAAAATTGGAATCATCTAAGT
TTACATAATATAATTTGGATATAAAAAAAAA
back to top

protein sequence of SMED30002703-orf-1

>SMED30002703-orf-1 ID=SMED30002703-orf-1|Name=SMED30002703-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=173bp
MAAKSHKEVVRNRRHVKMALKKKEAKAKSATKAKVAEQVKSKILNGAHVG
RVRRIRTTPKFKRPVTYKPLRNPKYQRSSSTRENKLDEFRIVKHPLTTES
AMKMIEEKNTLVFSVDQHATKHNIKLAIRKLYDIKSVKINTLNCISSNTK
KAFVKLAADYDALDVANKIGII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000039gamma neoblast
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013025Ribosomal_L25/23
IPR012677Nucleotide-bd_a/b_plait_sf
IPR005633Ribosomal_L23/L25_N
IPR001014Ribosomal_L23/L25_CS
IPR012678Ribosomal_L23/L15e_core_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013025Ribosomal protein L25/L23PFAMPF00276Ribosomal_L23coord: 91..160
e-value: 1.0E-13
score: 51.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 52..172
e-value: 5.2E-46
score: 157.6
IPR005633Ribosomal protein L23/L25, N-terminalPFAMPF03939Ribosomal_L23eNcoord: 34..80
e-value: 5.8E-6
score: 26.4
NoneNo IPR availablePANTHERPTHR11620:SF2RIBOSOMAL PROTEIN L23Acoord: 27..172
NoneNo IPR availablePANTHERPTHR1162060S RIBOSOMAL PROTEIN L23Acoord: 27..172
IPR001014Ribosomal protein L23/L25, conserved sitePROSITEPS00050RIBOSOMAL_L23coord: 150..165
IPR012678Ribosomal protein L23/L15e core domain superfamilySUPERFAMILYSSF54189Ribosomal proteins S24e, L23 and L15ecoord: 87..169