HEAT repeat-containing protein 5B-like Protein

Overview
NameHEAT repeat-containing protein 5B-like Protein
Smed IDSMED30002690
Length (bp)4371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HEAT repeat-containing protein 5B-like Protein (SMED30002690) t-SNE clustered cells

Violin plots show distribution of expression levels for HEAT repeat-containing protein 5B-like Protein (SMED30002690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HEAT repeat-containing protein 5B-like Protein (SMED30002690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HEAT repeat-containing protein 5B-like Protein (SMED30002690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002690SMESG000028228.1 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Match: HEATR5B (HEAT repeat containing 5B [Source:HGNC Symbol;Acc:HGNC:29273])

HSP 1 Score: 837.41 bits (2162), Expect = 0.000e+0
Identity = 517/1086 (47.61%), Postives = 678/1086 (62.43%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSV---GKSVRSDPTASDILQAALLSK-GLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGK--------SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVA--------------VSNSSMR-------------DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLW-------------------LADHSQNITID-----------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G++N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+TL+ G L N NPILRCAAGE LGRMAQV+G+++FIA MAQYSFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN     ++R SC V C+I Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +   + N  D + S  N S    G S R+D       Q   +++ GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL L K+V+ A          S  KDE+ +K            + +DD +  +  ++D  KPF   RW T+VFAA+C  +++ +C  +     HF++  ARS       +D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++ A AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++     S Q      +++E LAVL+AWAE+Y+VA              + N+                 L+ LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T  D  ++ Y+  W  IL A +LW                   L   S ++ ++                 D++ LILG+ +  +C    ++  E +  CL+A +T+   P  R  IAE+ L+ +EL++V+HR+LLT +   + L     + QI+ +    + E R    E         +L            KS VFA +E+++  L R++PHL      DSP+
Sbjct:  686 EGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGATTSTIRSSCLVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-SLAKNTGDKESSSANVSPFAPGVSSRTDIHCRH--QGVNITETGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSDMSTATLLSSGKDEEAEKKD----------EMDDDTMFTTLGEEDKSKPFVAPRWATRVFAADCLCRIINLCENADQA--HFDLALARSAKLRNPTNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDKVQAGKGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEAESKPKRAIKNTDDDDDDCGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNSTGFTCSESTEAAAISGLQKRSTSVNLNQASGAVGSAKSLPEINKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLDSPYARVHIAEDQLIGVELLSVLHRLLLTWNPSSVQLLVTGVVQQIVRAAQDYLQEKRNTLNEDDMEKEACTVLGEGGDSGGLIPGKSLVFATMELLMFILVRHMPHLSTKVS-DSPS 1739          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 449/1085 (41.38%), Postives = 618/1085 (56.96%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDK----------LRNEDSPQFLSSIEGLAVLRAWAEIYIVAV----------------------SNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------AD--------------------HSQNITID-------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRT 3155
            +G    +LREL A+ T  +     +T LL  +CH DD +IL  +LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    RL ILE   + I+  K  RQQ  Q+++ ++V   ++ +A +K   G E  +K+ A+TL+ G+L + NP+LRCAA E   R+AQV+ D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G + S QHL++ +GIL  LAQD+ SP VQ W+LH+L+LI DS GP++  ++E T++LI+ LLLN PP+  +VHQ LG+ L ALITTLGPELQGNST I +LR SC + C+++Q +PD LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H +    ++R++       + VG                     LEGAL  LLD E D +LC D+++TL  +L S   E+L+ WL+L K+V+ A    T        ++E+GDK     G  A            +  +D+   PF   RW T+VFAAEC  +++  C  ++    HF+I  A+       R+D L+LHL+D+I  AF+AAT   D+LRL GL  L  +I  FA V EPEFP  VILEQYQA VGAALRPAF   T P+VTA AC+VCS+WIASGV  DL+DLRRVHQLLV+SL K          L NE +    S++E LAVL+AWAE+YI+AV                       + S   L++LV   L TLS  W   L  +A+L LP+E +  L    GA    F + +T+ +N ++ Y   W +IL A +LWL       AD                     S   TI        D+  LILG+ ++ +C L S  T E+I  CL A   +   P  R  I  +  + IEL+NV+HR++LTR+   I L +L+ + QII +  E+   K  S+E                 +D   L+  KS VFA LE+ VC L R +P L       SP  K T
Sbjct:  318 EGNLCAILRELAADLTAPDIQVAASTFLLPPLCHQDDLLILSPFLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGARQQVVQLHVVSSVSSFLKYVAGSKGCLGPE-EMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTAGLAQVSFDKLKSARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLSLIIDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTSISTLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAVMLAKDSREELTPDANIREVG---------------------LEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWLKLCKDVLAASADFTAVTCVDTMQEEEGDK-----GDDASV---------LTTRRDEKSHPFTNPRWATRVFAAECVCRIINQCENANSA--HFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATDHSDQLRLSGLEMLLVVIRRFATVPEPEFPGHVILEQYQANVGAALRPAFTSETPPDVTAKACQVCSAWIASGVVSDLNDLRRVHQLLVSSLTKIQAGKEALSHLYNESA----STMEILAVLKAWAEVYIIAVQRHKNHRQPLKTTTCLEDGIRNGSCSSDGLLDLVYADLGTLSRLWLAALQDFALLTLPSEFASQLPAEGGA----FYTAETS-ENAKLHYYNSWALILHATALWLTSTGFVVADPDEGASNLSRPVTPTSMCQGSSSGATIKSPEDVYTDRFHLILGISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDLGIELLNVLHRVILTRESPSIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGAAEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILVRQLPELNPKLT-GSPGVKAT 1344          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 449/1085 (41.38%), Postives = 618/1085 (56.96%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDK----------LRNEDSPQFLSSIEGLAVLRAWAEIYIVAV----------------------SNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------AD--------------------HSQNITID-------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRT 3155
            +G    +LREL A+ T  +     +T LL  +CH DD +IL  +LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    RL ILE   + I+  K  RQQ  Q+++ ++V   ++ +A +K   G E  +K+ A+TL+ G+L + NP+LRCAA E   R+AQV+ D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G + S QHL++ +GIL  LAQD+ SP VQ W+LH+L+LI DS GP++  ++E T++LI+ LLLN PP+  +VHQ LG+ L ALITTLGPELQGNST I +LR SC + C+++Q +PD LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H +    ++R++       + VG                     LEGAL  LLD E D +LC D+++TL  +L S   E+L+ WL+L K+V+ A    T        ++E+GDK     G  A            +  +D+   PF   RW T+VFAAEC  +++  C  ++    HF+I  A+       R+D L+LHL+D+I  AF+AAT   D+LRL GL  L  +I  FA V EPEFP  VILEQYQA VGAALRPAF   T P+VTA AC+VCS+WIASGV  DL+DLRRVHQLLV+SL K          L NE +    S++E LAVL+AWAE+YI+AV                       + S   L++LV   L TLS  W   L  +A+L LP+E +  L    GA    F + +T+ +N ++ Y   W +IL A +LWL       AD                     S   TI        D+  LILG+ ++ +C L S  T E+I  CL A   +   P  R  I  +  + IEL+NV+HR++LTR+   I L +L+ + QII +  E+   K  S+E                 +D   L+  KS VFA LE+ VC L R +P L       SP  K T
Sbjct:  690 EGNLCAILRELAADLTAPDIQVAASTFLLPPLCHQDDLLILSPFLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGARQQVVQLHVVSSVSSFLKYVAGSKGCLGPE-EMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTAGLAQVSFDKLKSARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLSLIIDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTSISTLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAVMLAKDSREELTPDANIREVG---------------------LEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWLKLCKDVLAASADFTAVTCVDTMQEEEGDK-----GDDASV---------LTTRRDEKSHPFTNPRWATRVFAAECVCRIINQCENANSA--HFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATDHSDQLRLSGLEMLLVVIRRFATVPEPEFPGHVILEQYQANVGAALRPAFTSETPPDVTAKACQVCSAWIASGVVSDLNDLRRVHQLLVSSLTKIQAGKEALSHLYNESA----STMEILAVLKAWAEVYIIAVQRHKNHRQPLKTTTCLEDGIRNGSCSSDGLLDLVYADLGTLSRLWLAALQDFALLTLPSEFASQLPAEGGA----FYTAETS-ENAKLHYYNSWALILHATALWLTSTGFVVADPDEGASNLSRPVTPTSMCQGSSSGATIKSPEDVYTDRFHLILGISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDLGIELLNVLHRVILTRESPSIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGAAEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILVRQLPELNPKLT-GSPGVKAT 1716          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 422.55 bits (1085), Expect = 2.249e-128
Identity = 264/609 (43.35%), Postives = 375/609 (61.58%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNI 1976
            +G    +LREL A+ T  +     +T LL  +CH DD +IL  +LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    RL ILE   + I+  K  RQQ  Q+++ ++V   ++ +A +K   G E  +K+ A+TL+ G+L + NP+LRCAA E   R+AQV+ D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G + S QHL++ +GIL  LAQD+ SP VQ W+LH+L+LI DS GP++  ++E T++LI+ LLLN PP+  +VHQ LG+ L ALITTLGPELQGNST I +LR SC + C+++Q +PD LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H +    ++R++       + V                     GLEGAL  LLD E D +LC D+++TL  +L S   E+L+ WL+L K+V+ A    T        ++E+GDK     G  A            +  +D+   PF   RW T+VFAAEC  +++  C  ++    HF+I
Sbjct:  333 EGNLCAILRELAADLTAPDIQVAASTFLLPPLCHQDDLLILSPFLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGARQQVVQLHVVSSVSSFLKYVAGSKGCLGPE-EMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTAGLAQVSFDKLKSARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLSLIIDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTSISTLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAVMLAKDSREELTPDANIREV---------------------GLEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWLKLCKDVLAASADFTAVTCVDTMQEEEGDK-----GDDASV---------LTTRRDEKSHPFTNPRWATRVFAAECVCRIINQCENANSA--HFDI 893          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 143.28 bits (360), Expect = 4.075e-38
Identity = 99/208 (47.60%), Postives = 128/208 (61.54%), Query Frame = 3
Query: 1119 DVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYE---------GLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWL 1715
            +VHQ LG+ L ALITTLGPELQGNST I +LR SC + C+++Q +PD LVQA+A+SCLQQLHMFAP+HVNLS+L+  L E          L SP+LLLRRAV+ACLRQL Q+E      EV  H +    ++R++       + V                     GLEGAL  LLD E D +LC D+++TL  +L S   E+L+ WL
Sbjct:   17 EVHQSLGRCLNALITTLGPELQGNSTSISTLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCEILLDNSVLVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAVMLAKDSREELTPDANIREV---------------------GLEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWL 199          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Celegans
Match: soap-1 (Sorting Of Apical Proteins [Source:UniProtKB/TrEMBL;Acc:O01485])

HSP 1 Score: 516.538 bits (1329), Expect = 2.761e-154
Identity = 361/1058 (34.12%), Postives = 585/1058 (55.29%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNT-TTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQ-PNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSL-RQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA----GKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSF-MTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED-----SPQFLSSIEGLAVLRAWAEIYIVAVSNSSMRD----------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID-----------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRC------IIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQII------ISISENR---TPKTESSESTRDVKILL-----------------KSPVFACLEIVVCGLTRYVPHL 3113
            +G+Y  LLRELVA+ TL++N  +T TTSL  S     + +++      TD+  +ED LQ P S+   G +E D + L  +  S  ++    T+P      +  +++++  +G +FP + +KH++QI EHF + I+++K+  R+QA  +N  TA L + + L E +        L++ +  LI  SL N  P+ R    E L R++Q +    F+A +AQY FD+L + +D  NR+G+ LALGCLHR+VGSLGSGQHL+T V ++LALA+++  P VQ  +L A+ALIA++G  MF  ++E T++  L LL++TP  ++DV Q + K L ALIT +GPEL     +I  +R S   +C+I   H D  VQAEA+S LQQ+H+FAP++V+++ L+  +   LSS HL++R                ++    +  +++ +S   ++  Q    Q +  + +         + AL   GLEGALF +LD E + +L   L++TL+ L+Q    E L  WL L KE++      G    K+EK D+   +A     +D  +D ++   ++  +  K     RWPTKVF  E   +L+ +C T   +  H ++  A+   +TS G++D L+LHLSD++  +F+AAT +   LR+ GL +L+++I  F+   EPEFP  +ILEQ+QAQVGAALRPAF   T   VT+ AC+VCS+WI SGVARDLSDL+RVHQLLV+SL+KL++         +  +++E L++L+AWAE+Y+ A+    M++                L++LVEP  N+L  +W   L+  A+LALP   S+   +R GA    F +  + +  ++  Y+  WP IL A S WL+ ++  +                     + +L++G+ ++++     +  DETI+  +K+   +     + C      ++++ P V IE++ V+HR +LTRDC    LQ ++ +  II      I I  +R       ES ++ R +  +L                 K+  +A LE+ VC + + +P +
Sbjct:  700 EGSYAALLRELVADITLSDNSQSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIEEDLSNLIRA--SASQIGD--TWPENDSEPLTCLNTALLTYGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQAILVNALTAKLLSYKTLCEQRGHKLDNETLQRASFDLISSSLSNSCPMTRLVGAEALARLSQAVNSPPFVASIAQYCFDKLNSCKDEINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQTCALVAMALIAETGSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGISKCLTALITCVGPELSCPG-VIDGVRTSLLAACAIQLSHSDPFVQAEAISGLQQMHLFAPRYVHMAQLVVDISSLLSSTHLVIR----------------RQSVSCLRQLVQRESKEVRNHAQVLVPQGIVDTNKK--------KFALPESGLEGALFGMLDTEVNKELRCHLQETLISLVQGTSGELLNNWLMLSKEILATSNDHGLVRKKEEKKDRGEDDADDDDDEDGDDDTNLAGISSLMEEDKGKVQPRWPTKVFTMEIVNRLMSVCDT---ERAHLDMALAKELQITSAGKNDYLVLHLSDLVRMSFMAATSDNSLLRIAGLKSLEEVIIRFSSCPEPEFPGHMILEQFQAQVGAALRPAFTDDTPSNVTSVACQVCSTWIGSGVARDLSDLKRVHQLLVSSLNKLKHGSINVQLYSESAATLEKLSILKAWAEVYVTAIEQDRMKNENVEARDHYDYNGSGSLLSLVEPEANSLIAYWLAMLNDSALLALPAHYSDQFLNRGGA----FFNAHSAEACREY-YQICWPPILLACSTWLSKNNFELPSGIELSSETAAVWRDEGNVSRFYLLIGIAVESLSNKTRQIEDETIQMSVKSLTRL-----LSCEWCQLHLMSDVPAV-IEILYVLHRSVLTRDCLSTQLQCIECVGSIIDAAQLAIRICASRDISNGNLESEDTLRKIPNVLFAGEEGGKDGNINKDGVKTISYAILELAVCAIFKQMPQI 1714          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335229)

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 468/1081 (43.29%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALY-------------------------LSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEV----IQAG----KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNE-DSPQF----LSSIEGLAVLRAWAEIYIVA--------------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID--------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLK-----------SPVFACLEIVVCGLTRYVPHL 3113
            + +Y  LLR LV+EFTL++N +NTT SLLR++CH DDS+ILG+WLQET+H+ IEDQLQPNSA+GSGALEHDP  LY                             ++ ++      P PLPLGVAVID +V L+G +FPK+ +KHRLQ+LEHF+ECIRQAKS RQ+A QMNIFTA+LCA++ L ++K+S G E +++K A  LI  SL + N  +RCAAGE LGR+AQV+GDS F AE+AQ SFD+LK+ RDV  RTG+S ALGCLHRYVG +GS QHLSTSV ILLAL QD+ SPVVQ WSL+ALA IADSGGPMF  Y+E T+ L L LLL  P + +DVHQC+G+V+ ALITT+GPELQG    + ++R S   S ++LQ H D LVQAEA+ CLQQLH+FA K + L  L+P L   L+  + +LR+A V+CLRQLA +E  KE+ E+   I                             A  +    +   GL G LF LLD E D ++  ++ DTL  +LQ    + L+ WL L K V    ++ G     +  +  K  +          ++++ DD  ++ A ++ S  P    RWPT+VFAA+C R+++  C  +     HF+++ A+       R D LILHL+++I  +F+AAT + D+LRL GL  LQ+II+ FA V EPEFP  ++LEQ+QAQVGAALRPAFA  T   VTAAACEVCS+WI SGVARD+ DL+RVHQLLV+SLDKL ++ +S Q     ++++E L++L+AWAE+YIVA                                V +S    L+ LV+P L+ LS HW   +  +A+L LP E    L H  GA    F + DT + ++   Y T WP IL A++LWL D      +D                    D+  +I G+CM+A+C + S +    I  CL++ +++F     R  + ++  + IEL +V+HR +LTRD   + L  ++ L Q I +  E+   K + + ++ D K   +           S V+A LE+ +C   R +P +
Sbjct:  744 EASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQE-DVRKSATALIVASLTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHRE-AKEVCELALTI----------------------------NAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAA--SSVHFDLLQAKEQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAPDTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGA----FYTTDTINSSKP-HYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERPRNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTM 1787          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0300916)

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 468/1081 (43.29%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALY-------------------------LSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEV----IQAG----KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNE-DSPQF----LSSIEGLAVLRAWAEIYIVA--------------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID--------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLK-----------SPVFACLEIVVCGLTRYVPHL 3113
            + +Y  LLR LV+EFTL++N +NTT SLLR++CH DDS+ILG+WLQET+H+ IEDQLQPNSA+GSGALEHDP  LY                             ++ ++      P PLPLGVAVID +V L+G +FPK+ +KHRLQ+LEHF+ECIRQAKS RQ+A QMNIFTA+LCA++ L ++K+S G E +++K A  LI  SL + N  +RCAAGE LGR+AQV+GDS F AE+AQ SFD+LK+ RDV  RTG+S ALGCLHRYVG +GS QHLSTSV ILLAL QD+ SPVVQ WSL+ALA IADSGGPMF  Y+E T+ L L LLL  P + +DVHQC+G+V+ ALITT+GPELQG    + ++R S   S ++LQ H D LVQAEA+ CLQQLH+FA K + L  L+P L   L+  + +LR+A V+CLRQLA +E  KE+ E+   I                             A  +    +   GL G LF LLD E D ++  ++ DTL  +LQ    + L+ WL L K V    ++ G     +  +  K  +          ++++ DD  ++ A ++ S  P    RWPT+VFAA+C R+++  C  +     HF+++ A+       R D LILHL+++I  +F+AAT + D+LRL GL  LQ+II+ FA V EPEFP  ++LEQ+QAQVGAALRPAFA  T   VTAAACEVCS+WI SGVARD+ DL+RVHQLLV+SLDKL ++ +S Q     ++++E L++L+AWAE+YIVA                                V +S    L+ LV+P L+ LS HW   +  +A+L LP E    L H  GA    F + DT + ++   Y T WP IL A++LWL D      +D                    D+  +I G+CM+A+C + S +    I  CL++ +++F     R  + ++  + IEL +V+HR +LTRD   + L  ++ L Q I +  E+   K + + ++ D K   +           S V+A LE+ +C   R +P +
Sbjct:  744 EASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQE-DVRKSATALIVASLTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHRE-AKEVCELALTI----------------------------NAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAA--SSVHFDLLQAKEQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAPDTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGA----FYTTDTINSSKP-HYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERPRNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTM 1787          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0300917)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 468/1081 (43.29%), Postives = 645/1081 (59.67%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALY-------------------------LSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEV----IQAG----KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNE-DSPQF----LSSIEGLAVLRAWAEIYIVA--------------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID--------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLK-----------SPVFACLEIVVCGLTRYVPHL 3113
            + +Y  LLR LV+EFTL++N +NTT SLLR++CH DDS+ILG+WLQET+H+ IEDQLQPNSA+GSGALEHDP  LY                             ++ ++      P PLPLGVAVID +V L+G +FPK+ +KHRLQ+LEHF+ECIRQAKS RQ+A QMNIFTA+LCA++ L ++K+S G E +++K A  LI  SL + N  +RCAAGE LGR+AQV+GDS F AE+AQ SFD+LK+ RDV  RTG+S ALGCLHRYVG +GS QHLSTSV ILLAL QD+ SPVVQ WSL+ALA IADSGGPMF  Y+E T+ L L LLL  P + +DVHQC+G+V+ ALITT+GPELQG    + ++R S   S ++LQ H D LVQAEA+ CLQQLH+FA K + L  L+P L   L+  + +LR+A V+CLRQLA +E  KE+ E+   I                             A  +    +   GL G LF LLD E D ++  ++ DTL  +LQ    + L+ WL L K V    ++ G     +  +  K  +          ++++ DD  ++ A ++ S  P    RWPT+VFAA+C R+++  C  +     HF+++ A+       R D LILHL+++I  +F+AAT + D+LRL GL  LQ+II+ FA V EPEFP  ++LEQ+QAQVGAALRPAFA  T   VTAAACEVCS+WI SGVARD+ DL+RVHQLLV+SLDKL ++ +S Q     ++++E L++L+AWAE+YIVA                                V +S    L+ LV+P L+ LS HW   +  +A+L LP E    L H  GA    F + DT + ++   Y T WP IL A++LWL D      +D                    D+  +I G+CM+A+C + S +    I  CL++ +++F     R  + ++  + IEL +V+HR +LTRD   + L  ++ L Q I +  E+   K + + ++ D K   +           S V+A LE+ +C   R +P +
Sbjct:  696 EASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQE-DVRKSATALIVASLTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHRE-AKEVCELALTI----------------------------NAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAA--SSVHFDLLQAKEQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAPDTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGA----FYTTDTINSSKP-HYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERPRNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTM 1739          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335230)

HSP 1 Score: 780.4 bits (2014), Expect = 0.000e+0
Identity = 468/1092 (42.86%), Postives = 645/1092 (59.07%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQ-----------LQPNSASGSGALEHDPTALY-------------------------LSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEV----IQAG----KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNE-DSPQF----LSSIEGLAVLRAWAEIYIVA--------------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID--------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLK-----------SPVFACLEIVVCGLTRYVPHL 3113
            + +Y  LLR LV+EFTL++N +NTT SLLR++CH DDS+ILG+WLQET+H+ IEDQ           LQPNSA+GSGALEHDP  LY                             ++ ++      P PLPLGVAVID +V L+G +FPK+ +KHRLQ+LEHF+ECIRQAKS RQ+A QMNIFTA+LCA++ L ++K+S G E +++K A  LI  SL + N  +RCAAGE LGR+AQV+GDS F AE+AQ SFD+LK+ RDV  RTG+S ALGCLHRYVG +GS QHLSTSV ILLAL QD+ SPVVQ WSL+ALA IADSGGPMF  Y+E T+ L L LLL  P + +DVHQC+G+V+ ALITT+GPELQG    + ++R S   S ++LQ H D LVQAEA+ CLQQLH+FA K + L  L+P L   L+  + +LR+A V+CLRQLA +E  KE+ E+   I                             A  +    +   GL G LF LLD E D ++  ++ DTL  +LQ    + L+ WL L K V    ++ G     +  +  K  +          ++++ DD  ++ A ++ S  P    RWPT+VFAA+C R+++  C  +     HF+++ A+       R D LILHL+++I  +F+AAT + D+LRL GL  LQ+II+ FA V EPEFP  ++LEQ+QAQVGAALRPAFA  T   VTAAACEVCS+WI SGVARD+ DL+RVHQLLV+SLDKL ++ +S Q     ++++E L++L+AWAE+YIVA                                V +S    L+ LV+P L+ LS HW   +  +A+L LP E    L H  GA    F + DT + ++   Y T WP IL A++LWL D      +D                    D+  +I G+CM+A+C + S +    I  CL++ +++F     R  + ++  + IEL +V+HR +LTRD   + L  ++ L Q I +  E+   K + + ++ D K   +           S V+A LE+ +C   R +P +
Sbjct:  744 EASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQMEPNRKVDGEHLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQE-DVRKSATALIVASLTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHRE-AKEVCELALTI----------------------------NAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAA--SSVHFDLLQAKEQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAPDTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGA----FYTTDTINSSKP-HYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERPRNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTM 1798          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0081818)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 468/1092 (42.86%), Postives = 645/1092 (59.07%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQ-----------LQPNSASGSGALEHDPTALY-------------------------LSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEV----IQAG----KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNE-DSPQF----LSSIEGLAVLRAWAEIYIVA--------------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID--------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLK-----------SPVFACLEIVVCGLTRYVPHL 3113
            + +Y  LLR LV+EFTL++N +NTT SLLR++CH DDS+ILG+WLQET+H+ IEDQ           LQPNSA+GSGALEHDP  LY                             ++ ++      P PLPLGVAVID +V L+G +FPK+ +KHRLQ+LEHF+ECIRQAKS RQ+A QMNIFTA+LCA++ L ++K+S G E +++K A  LI  SL + N  +RCAAGE LGR+AQV+GDS F AE+AQ SFD+LK+ RDV  RTG+S ALGCLHRYVG +GS QHLSTSV ILLAL QD+ SPVVQ WSL+ALA IADSGGPMF  Y+E T+ L L LLL  P + +DVHQC+G+V+ ALITT+GPELQG    + ++R S   S ++LQ H D LVQAEA+ CLQQLH+FA K + L  L+P L   L+  + +LR+A V+CLRQLA +E  KE+ E+   I                             A  +    +   GL G LF LLD E D ++  ++ DTL  +LQ    + L+ WL L K V    ++ G     +  +  K  +          ++++ DD  ++ A ++ S  P    RWPT+VFAA+C R+++  C  +     HF+++ A+       R D LILHL+++I  +F+AAT + D+LRL GL  LQ+II+ FA V EPEFP  ++LEQ+QAQVGAALRPAFA  T   VTAAACEVCS+WI SGVARD+ DL+RVHQLLV+SLDKL ++ +S Q     ++++E L++L+AWAE+YIVA                                V +S    L+ LV+P L+ LS HW   +  +A+L LP E    L H  GA    F + DT + ++   Y T WP IL A++LWL D      +D                    D+  +I G+CM+A+C + S +    I  CL++ +++F     R  + ++  + IEL +V+HR +LTRD   + L  ++ L Q I +  E+   K + + ++ D K   +           S V+A LE+ +C   R +P +
Sbjct:  744 EASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDDSIILGTWLQETNHRTIEDQMEPNRKVDGEHLQPNSAAGSGALEHDPCCLYRPRSAQGNGSSSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHRLQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQE-DVRKSATALIVASLTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLHRYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTLCLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSDPLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHRE-AKEVCELALTI----------------------------NAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLSSWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTSTHPAVQPRWPTRVFAAQCVRRIIASCEAA--SSVHFDLLQAKEQQLIRSRGDYLILHLAELIRMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAPDTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATLEKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGLVQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGA----FYTTDTINSSKP-HYMTSWPPILYASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERPRNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQTIRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTM 1798          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 510/1044 (48.85%), Postives = 671/1044 (64.27%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSA-NKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFL------SSIEGLAVLRAWAEIYIVAV---SNSSMR----------------------DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID-------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISEN----RTPKTESSE-------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            +G++N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV++GSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      +V  +   P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+ECI+QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+ L+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD     VQ W+LH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGALITT+GPELQGNS  I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQ+AQ+E   E+ E    + R ++ + KD   +  N                    +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL+L K+V+ A          D    +    +   D  DDDI F++  +D+ +K     RW T+VFAAEC  +++ +C  +     HF++  AR        +D L+LHL D+I  AF+AAT   ++LR+ GL AL+DII  FA V +PEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++   S          +++E LAVL+AWAE+++VA+     S  R                       LM LV+P L +LS  W + L  YA+L LP E S  L    GA    F + +T  D  ++ Y++ W  +L A +LWL+     IT D                   D++ L+LG+ ++ +C   +++  E +  CL+A  T+   P  R  IAE+ L+ +EL+NV+HR+LLTRD   + LQ    + + I +  E+    R+ K   +E          D   LL  KS VFA +E++V  L R++P L
Sbjct:  685 EGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLMGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RVPAVEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECIKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGLE-EVRKSALALVMGALDNSNPILRCAAGEALGRMAQVVGEASFIARMAQHSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDATCHEVQTWALHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGALITTVGPELQGNSVSISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQMAQRE-AAEVCEYAMSLAR-RAGDTKDNSTTNLN--------------------ITETGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLKLCKDVLAATTEVGGAVASDSRRKDDDEDSEKKDEMDDDIMFTSLGQDEKMKATVAPRWVTRVFAAECLCRIIHLCENADHA--HFHLAEARIAKIKNPEADFLVLHLCDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFAAVPDPEFPSHVILEQYQANVGAALRPAFSPDTPSDITAKACQVCSAWIGSGVVSDLNDLRRVHNLLVSSLDKVQTGKSSSSQLYSESATTMEKLAVLKAWAEVFVVAMDIKQESRARPVRPPAGEDEDEDEAADVLPPDSLMVLVQPELPSLSRLWLELLRDYALLTLPAEFSSQLPADGGA----FYTPETI-DTARLHYRSSWASVLHAEALWLSSTGFGITEDSAASGAAVQPAKHPEELVKDRLHLLLGISIEFLCFPRAEEPIEDVMSCLRAVCTLLDSPIARTHIAEDQLLAVELLNVLHRLLLTRDPSSVQLQVTAVVQKTIHAAQEHLEQRRSNKGGVNEDGVCVLGEGADSGELLPGKSLVFAAMELLVFILVRHLPQL 1692          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 427/764 (55.89%), Postives = 543/764 (71.07%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSA-NKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFL------SSIEGLAVLRAWAEIYIVAV 2444
            +G +N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV++GSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      +V  +   P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+ECI+QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+ L+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD     VQ W+LH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGALITT+GPELQGNS  I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQ+AQ+E   E+ E    + R ++ + KD   +  N                    +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL+L K+V+ A          D    +    +   D  DDDI F++  +D+ +K     RW T+VFAAEC  +++ +C  +     HF++  AR        +D L+LHL D+I  AF+AAT   ++LR+ GL AL+DII  FA V +PEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++   S          +++E LAVL+AWAE+++VA+
Sbjct:  685 EGDFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLMGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RVPAVEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECIKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGLE-EVRKSALALVMGALDNSNPILRCAAGEALGRMAQVVGEASFIARMAQHSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDATCHEVQTWALHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGALITTVGPELQGNSVSISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQMAQRE-AAEVCEYAMSLAR-RAGDTKDNSTTNLN--------------------ITETGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLKLCKDVLAATTEVGGAVASDSRRKDDDEDSEKKDEMDDDIMFTSLGQDEKMKATVAPRWVTRVFAAECLCRIIHLCENADHA--HFHLAEARIAKIKNPEADFLVLHLCDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFAAVPDPEFPSHVILEQYQANVGAALRPAFSPDTPSDITAKACQVCSAWIGSGVVSDLNDLRRVHNLLVSSLDKVQTGKSSSSQLYSESATTMEKLAVLKAWAEVFVVAM 1417          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Match: BX465838.3 (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 407/1063 (38.29%), Postives = 587/1063 (55.22%), Query Frame = 3
Query:  180 TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKS-------ETK-DEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDR-HFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR-NEDSPQFLS-----SIEGLAVLRAWAEIYIVAVSNSSMRD----------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------------ADHSQNITI-------------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            ++ T+L++L+ + T  E  +    +LL S+C+  D  +LG  LQ+ D + IE+QL     SG G LE+D   ++     V         P+PLP   A+  ++VQLFG++FP +  + R Q+LE F E +RQ K  RQQ  Q+++  A  C ++ LA ++S  G E  +++ A++L+ G+L   NP+LRC A E L R+ QV+ D  F   +   SFD+LK  RD   RTG++LALG ++RY+G + S Q+LS  VG+L  L+QD  SP V++W+LHAL+ + D  GP++ ++LE +  L+L LLL+TP + ++V Q LG+ L ALIT++GP+LQG    + ++R SC V C+++Q   D LVQA+A+SCLQQLHMFAP+ VNLS+L+P L   L S +L LRRAVVACLRQLAQ+E      EV  H +                  V +  R D T  D+    +   GLEGALF LLD E D +LC D+++TL+ ++ S  E +L  WL+L K+V+ A          ET+ +E GD+   ++               F A K +S  PFN  RW T+VF+ EC  +++  C    ++D  HFN+  A+        +D L+LHL+D+I  AF+A+T   D+LRL GL  L  II  F+ V EPEFP  VILEQYQA VGAALRPAF +   P VTA AC+VCS+WIASGV  DL DLRRVHQLL +SL K++   D P  L      ++E LAVL+AWAE+YI AV  S  RD                      L+ LV+  L TLS  W   L  +A+L LP   S  L    G+    F + +T +  +   Y + W  IL A +LWL            A+ S+ +T                     D++ LILG+ ++ +C   S    E I  CL+A   +   P  R  +  +  + +EL++++HR+++TR+   I L  L+ + QII +  E+   K  S+E                 RD   L+  +S VF  LE+ +C L R +P L
Sbjct:  688 SFGTVLKQLLNDLTGPEITACAERNLLPSLCYSQDLALLGPGLQDMDQRYIEEQLH-GGGSGGGTLEYDSFTIFEKSQEV---------PTPLPPASALTVAAVQLFGVIFPHLSVQQRAQVLEQFCEFVRQLKGARQQTVQIHVTAAFFCTLKSLASSRSELGPE-EVQRPALSLLLGALEGSNPLLRCMAAEGLARLVQVLNDPGFTVSLTLMSFDKLKTARDAITRTGHALALGTVYRYLGGISSPQYLSACVGVLFTLSQDNTSPEVKMWALHALSTVVDLAGPLYHSHLEASFTLVLRLLLSTPHTHMEVQQSLGRCLNALITSVGPDLQGEGAGVCAVRTSCLVGCAVMQDSQDCLVQAQAISCLQQLHMFAPRFVNLSSLVPSLCINLCSSYLSLRRAVVACLRQLAQREAV----EVSEHAV----------------ALVKELPRRDNTQLDV---TIKEVGLEGALFSLLDRESDPRLCRDIQETLVHMMSSAAESKLAHWLKLCKDVLSASADSAAAASVETQQEEDGDRYDDSSA--------------FHA-KSESSGPFNNLRWSTRVFSMECVCRIIAQC---ENRDSAHFNMALAQEQRLHES-TDFLVLHLADLIRMAFMASTDHSDQLRLAGLQTLLVIIRKFSNVPEPEFPGHVILEQYQANVGAALRPAFHVDAPPNVTAKACQVCSAWIASGVISDLRDLRRVHQLLASSLAKVQVGRDVPSQLYNESTFTMESLAVLKAWAEVYITAVQGSRQRDSPVSHQQQQSEEAGTAGQAGAGLLKLVQTDLATLSRLWLAALQDHALLTLPPHYSSHLPSTGGS----FYTAETVEQARP-HYYSAWATILHATALWLNSTGFIVVDEGPANLSRPVTPTSMGQSTSLSNVKSPEDINSDRLHLILGISVEFLCSPHSGDQMENIHSCLQALQALLEVPWPRSKVGNDQALSVELLSILHRLIVTRESPSIQLAVLELVQQIICAAQEHVREKRHSAEVDDGAAEKETVPEFGEGRDTGGLVPGRSLVFGALELCLCTLVRKLPQL 1692          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 394/1064 (37.03%), Postives = 580/1064 (54.51%), Query Frame = 3
Query:  180 TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSV-RSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKS-------ET-KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDR-HFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR-NEDSPQFLS-----SIEGLAVLRAWAEIYIVAVSNSSMRD----------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------------ADHSQNITI-------------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            ++ T+L++L+ + T  E  +    +LL S+C+  D  +LG  LQ+ D + IE+QL     SG G LE+D   ++     V         P+PLP   A+  ++VQLFG++FP +  + R Q+LE F E +RQ K  RQQ  Q+++  A  C ++ LA ++S  G E  +++ A++L+ G+L   NP+LRC A E L R+ QV+ D  F   +   SFD+LK  RD   RTG++LALG ++RY+G + S Q+LS  VG+L  L+QD  SP V++W+LHAL+ + D  GP++ ++LE +  L+L LLL+TP + ++V Q LG+ L ALIT++GP+LQG    + ++R SC V C+++Q   D LVQA+A+SCLQQLHMFAP+ VNLS+L+P L E L    +L+                   L   +   +R Q   R+  + S+   ++ K + R D T  D+    +   GLEGALF LLD E D +LC D+++TL+ ++ S  E +L  WL+L K+V+ A          ET ++E GD+   ++               F A K +S  PFN  RW T+VF+ EC  +++  C    ++D  HFN+  A+        +D L+LHL+D+I  AF+A+T   D+LRL GL  L  II  F+ V EPEFP  VILEQYQA VGAALRPAF +   P VTA AC+VCS+WIASGV  DL DLRRVHQLL +SL K++   D P  L      ++E LAVL+AWAE+YI AV  S  RD                      L+ LV+  L TLS  W   L  +A+L LP   S  L    G+    F + +T +  +   Y + W  IL A +LWL            A+ S+ +T                     D++ LILG+ ++ +C   S    E I  CL+A   +   P  R  +  +  + +EL++++HR+++TR+   I L  L+ + QII +  E+   K  S+E                 RD   L+  +S VF  LE+ +C L R +P L
Sbjct:  688 SFGTVLKQLLNDLTGPEITACAERNLLPSLCYSQDLALLGPGLQDMDQRYIEEQLH-GGGSGGGTLEYDSFTIFEKSQEV---------PTPLPPASALTVAAVQLFGVIFPHLSVQQRAQVLEQFCEFVRQLKGARQQTVQIHVTAAFFCTLKSLASSRSELGPE-EVQRPALSLLLGALEGSNPLLRCMAAEGLARLVQVLNDPGFTVSLTLMSFDKLKTARDAITRTGHALALGTVYRYLGGISSPQYLSACVGVLFTLSQDNTSPEVKMWALHALSTVVDLAGPLYHSHLEASFTLVLRLLLSTPHTHMEVQQSLGRCLNALITSVGPDLQGEGAGVCAVRTSCLVGCAVMQDSQDCLVQAQAISCLQQLHMFAPRFVNLSSLVPSLCEILLDYSVLINLCSSYL-----------SLRRAVVACLR-QLAQREAVEVSEHAVALVKELPRRDNTQLDV---TIKEVGLEGALFSLLDRESDPRLCRDIQETLVHMMSSAAESKLAHWLKLCKDVLSASADSAAAASVETQQEEDGDRYDDSSA--------------FHA-KSESSGPFNNLRWSTRVFSMECVCRIIAQC---ENRDSAHFNMALAQEQRLHES-TDFLVLHLADLIRMAFMASTDHSDQLRLAGLQTLLVIIRKFSNVPEPEFPGHVILEQYQANVGAALRPAFHVDAPPNVTAKACQVCSAWIASGVISDLRDLRRVHQLLASSLAKVQVGRDVPSQLYNESTFTMESLAVLKAWAEVYITAVQGSRQRDSPVSHQQQQSEEAGTAGQAGAGLLKLVQTDLATLSRLWLAALQDHALLTLPPHYSSHLPSTGGS----FYTAETVEQARP-HYYSAWATILHATALWLNSTGFIVVDEGPANLSRPVTPTSMGQSTSLSNVKSPEDINSDRLHLILGISVEFLCSPHSGDQMENIHSCLQALQALLEVPWPRSKVGNDQALSVELLSILHRLIVTRESPSIQLAVLELVQQIICAAQEHVREKRHSAEVDDGAAEKETVPEFGEGRDTGGLVPGRSLVFGALELCLCTLVRKLPQL 1701          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 561.222 bits (1445), Expect = 3.128e-170
Identity = 397/1063 (37.35%), Postives = 568/1063 (53.43%), Query Frame = 3
Query:  180 TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKS-------ETK-DEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDR-HFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR-NEDSPQFLS-----SIEGLAVLRAWAEIYIVAVSNSSMRD----------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------------ADHSQNITI-------------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            ++ T+L++L+ + T  E  +    +LL S+C+  D  +LG  LQ+ D + IE+QL     SG G LE+D                                     F I F K Q     ++LE F E +RQ K  RQQ  Q+++  A  C ++ LA ++S  G E  +++ A++L+ G+L   NP+LRC A E L R+ QV+ D  F   +   SFD+LK  RD   RTG++LALG ++RY+G + S Q+LS  VG+L  L+QD  SP V++W+LHAL+ + D  GP++ ++LE +  L+L LLL+TP + ++V Q LG+ L ALIT++GP+LQG    + ++R SC V C+++Q   D LVQA+A+SCLQQLHMFAP+ VNLS+L+P L   L S +L LRRAVVACLRQLAQ+E      EV  H +                  V +  R D T  D+    +   GLEGALF LLD E D +LC D+++TL+ ++ S  E +L  WL+L K+V+ A          ET+ +E GD+   ++               F A K +S  PFN  RW T+VF+ EC  +++  C    ++D  HFN+  A+        +D L+LHL+D+I  AF+A+T   D+LRL GL  L  II  F+ V EPEFP  VILEQYQA VGAALRPAF +   P VTA AC+VCS+WIASGV  DL DLRRVHQLL +SL K++   D P  L      ++E LAVL+AWAE+YI AV  S  RD                      L+ LV+  L TLS  W   L  +A+L LP   S  L    G+    F + +T +  +   Y + W  IL A +LWL            A+ S+ +T                     D++ LILG+ ++ +C   S    E I  CL+A   +   P  R  +  +  + +EL++++HR+++TR+   I L  L+ + QII +  E+   K  S+E                 RD   L+  +S VF  LE+ +C L R +P L
Sbjct:  688 SFGTVLKQLLNDLTGPEITACAERNLLPSLCYSQDLALLGPGLQDMDQRYIEEQLH-GGGSGGGTLEYDS------------------------------------FTI-FEKSQ-----EVLEQFCEFVRQLKGARQQTVQIHVTAAFFCTLKSLASSRSELGPE-EVQRPALSLLLGALEGSNPLLRCMAAEGLARLVQVLNDPGFTVSLTLMSFDKLKTARDAITRTGHALALGTVYRYLGGISSPQYLSACVGVLFTLSQDNTSPEVKMWALHALSTVVDLAGPLYHSHLEASFTLVLRLLLSTPHTHMEVQQSLGRCLNALITSVGPDLQGEGAGVCAVRTSCLVGCAVMQDSQDCLVQAQAISCLQQLHMFAPRFVNLSSLVPSLCINLCSSYLSLRRAVVACLRQLAQREAV----EVSEHAV----------------ALVKELPRRDNTQLDV---TIKEVGLEGALFSLLDRESDPRLCRDIQETLVHMMSSAAESKLAHWLKLCKDVLSASADSAAAASVETQQEEDGDRYDDSSA--------------FHA-KSESSGPFNNLRWSTRVFSMECVCRIIAQC---ENRDSAHFNMALAQEQRLHES-TDFLVLHLADLIRMAFMASTDHSDQLRLAGLQTLLVIIRKFSNVPEPEFPGHVILEQYQANVGAALRPAFHVDAPPNVTAKACQVCSAWIASGVISDLRDLRRVHQLLASSLAKVQVGRDVPSQLYNESTFTMESLAVLKAWAEVYITAVQGSRQRDSPVSHQQQQSEEAGTAGQAGAGLLKLVQTDLATLSRLWLAALQDHALLTLPPHYSSHLPSTGGS----FYTAETVEQARP-HYYSAWATILHATALWLNSTGFIVVDEGPANLSRPVTPTSMGQSTSLSNVKSPEDINSDRLHLILGISVEFLCSPHSGDQMENIHSCLQALQALLEVPWPRSKVGNDQALSVELLSILHRLIVTRESPSIQLAVLELVQQIICAAQEHVREKRHSAEVDDGAAEKETVPEFGEGRDTGGLVPGRSLVFGALELCLCTLVRKLPQL 1659          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 528/1128 (46.81%), Postives = 690/1128 (61.17%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIYIVAVS---------------------NSSMRD------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDD----------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            +G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + + + + N  D + S  N ++  +                  GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A            GK   SE KDE  D       G                  DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  AR+      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE+Y VA++                     + S  D      L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D                                  ++ LILG+ +   C    ++  E +  CL+A + +   P  R  IAE+ ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  686 EGNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPEE-VRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-NLAKNAGDKESSGLNINITDT------------------GLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAASSDVGTTGPVSGGKDDESEKKDEMDDDTMFTTLG-----------------DDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQARAARLKNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVYAVAMNIKKEAENNPKKALKTSDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVAGSQKRTASATLNQPASTPQGTKSLMEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1750          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 528/1121 (47.10%), Postives = 685/1121 (61.11%), Query Frame = 3
Query:  177 GTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIY--------IVAVSNSSMRD-----------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDD----------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENP--LVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +    N  K+A               D  +SDI    +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A            GK   SE KDE  D       G                  DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  AR+      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE+          +  S+    D           L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D                                  ++ LILG+ +   C    ++  E +  CL+A + +   P  R  IAE+   ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  672 GNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPEE-VRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHLLLRRAAVACLRQLAQREA----AEVCEYAM----NLAKNA--------------GDKESSDI---NITDTGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAASSDVGTTGPVSGGKDDESEKKDEMDDDTMFTTLG-----------------DDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQARAARLKNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVLPAENNPKKALKTSDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVAGSQKRTASATLNQPASTPQGTKSLMEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVDVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1727          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 528/1121 (47.10%), Postives = 685/1121 (61.11%), Query Frame = 3
Query:  177 GTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIY--------IVAVSNSSMRD-----------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDD----------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENP--LVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +    N  K+A               D  +SDI    +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A            GK   SE KDE  D       G                  DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  AR+      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE+          +  S+    D           L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D                                  ++ LILG+ +   C    ++  E +  CL+A + +   P  R  IAE+   ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  631 GNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPEE-VRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHLLLRRAAVACLRQLAQREA----AEVCEYAM----NLAKNA--------------GDKESSDI---NITDTGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAASSDVGTTGPVSGGKDDESEKKDEMDDDTMFTTLG-----------------DDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQARAARLKNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVLPAENNPKKALKTSDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVAGSQKRTASATLNQPASTPQGTKSLMEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVDVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1686          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 528/1121 (47.10%), Postives = 685/1121 (61.11%), Query Frame = 3
Query:  177 GTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIY--------IVAVSNSSMRD-----------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDD----------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENP--LVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +    N  K+A               D  +SDI    +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A            GK   SE KDE  D       G                  DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  AR+      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE+          +  S+    D           L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D                                  ++ LILG+ +   C    ++  E +  CL+A + +   P  R  IAE+   ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  647 GNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPEE-VRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHLLLRRAAVACLRQLAQREA----AEVCEYAM----NLAKNA--------------GDKESSDI---NITDTGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAASSDVGTTGPVSGGKDDESEKKDEMDDDTMFTTLG-----------------DDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQARAARLKNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVLPAENNPKKALKTSDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVAGSQKRTASATLNQPASTPQGTKSLMEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVDVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1702          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 491/1086 (45.21%), Postives = 652/1086 (60.04%), Query Frame = 3
Query:  177 GTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIP-----HLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIYIVAVSNSSMRD------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDDK--VFLIL----------------------GLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQ++    + S         L+LS  +V         P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P      L+  L + ++       A +  L Q    +E  EV  + +    N  K+A   +                          GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A  S   +    K T                I+   + DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  A          D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE++     + S  D      L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D   +FL+L                      G+ +   C    ++  E +  CL+A + +   P  R  IAE+ ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  674 GNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQVRNWIQNHSMGF-----ILHLSGEAV---------PGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPE-EVRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVSTLFFFLITLYISHLLLRRAAVACLRQLAQ-REAAEVCEYAM----NLAKNAGDKENT------------------------GLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAA--SSVAEPFRIKRTAK--------------IRSEHSYDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQAH---------DLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVFDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVLFLVLTLLCRPHGKKNTKDYIWMYLSAGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1674          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Mouse
Match: Heatr5b (HEAT repeat containing 5B [Source:MGI Symbol;Acc:MGI:2444098])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 522/1092 (47.80%), Postives = 675/1092 (61.81%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQ---SVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVAV-----SNSSMRDLMN----------------------LVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------ADHSQNITID-----------------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G++N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQYSFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN+  I ++R SC V C+I Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +   + N  D + S  N    + G S RSD          +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL L K+V+ A            GK   SE KDE  D       G                 ++D  KPF   RW T+VFAA+C  +++ +C  S     HF++  ARS      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++ A AC+VCS+WI SGV  DL+DLRRVH LLV+SLD ++     S Q      +++E LAVL+AWAE+Y+VA+     + S  +  MN                      LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T  D  ++ Y+  W  IL A +LWL        + ++  T+                              D++ LILG+ +  +C    ++  E +  CL+A +T+   P  R  IAE+ L+ +EL++V+HR+LLT +   I L     + QI+ +    + E R    E          L            KS VFA +E+++  L R++PHL     +DSP+
Sbjct:  686 EGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNAATISTIRSSCLVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-SLAKNAGDKEISGGNVNPFTPGVSSRSDVHCRH-QGVNITDTGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSDMSAATLLSSGKDEESEKKDEMDDDAMFTTLG-----------------EEDKSKPFVAPRWATRVFAADCLCRIINLCENSDQA--HFDLALARSAKLRNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDTVQAGKGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEAESKPKRAMNNPDDDDDDYGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNSTGFISQESTEATTVSGVQKRSPAVSLNQVPGAMASAKPLPEVNKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLGSPYARIHIAEDQLIGVELLSVLHRLLLTWNPPSIQLLVTGVVQQIVRAAQDYLQEKRNALNEEDMEKESCPTLGEGGDTGGLIPGKSLVFATMELLMFILVRHMPHLSTKM-LDSPS 1739          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Mouse
Match: Heatr5a (HEAT repeat containing 5A [Source:MGI Symbol;Acc:MGI:2444133])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 430/1066 (40.34%), Postives = 604/1066 (56.66%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVAV---------------SNSSMRD-------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------------ADHSQNIT---------------------IDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            KG    +L+EL AE T  +  +  +T LL ++CH DD +IL   LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    R+ ILE     I+  K  RQQ  Q+++ +A+   ++ +A +K S G E  +++  +TL+ G+L +  P+LRCAA E   R+AQV  D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G +G  QHLS+ +G+L  L+QD+ SP VQ W+LH+L+L  DS G ++  ++E T++LI+ LLLN PP+   VHQ LG+ L ALITTLGPELQG++T + +LR SC + C+++Q HP  LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H I    + R  A  +   +   +                           LLD E D  LC D+ +TL  +L S    +LT WL+L K+V+ A    T        ++E+GD+   +A  + R               DD   PF+  RW T+VFAA+C  +++  C  ++    HF+I  A+       R+D L+LHL+D+I  AF+AAT   D+LRL GL  L  +I  FA ++EPEFP  VILEQYQA VGAALRPAF   T P++TA AC+VCS+WIASGV  DLSDLRRVHQLLV+SL K++   E   Q      S++E LAVLRAWAE+YI+AV               S  SMR+       L++LV   L TLS  W   L  +A+L LP E +  L    GA    F + +T+  + ++ Y   W +IL AA+LWL            A+ S+ +T                       D+  LILG+ ++ +C L S  + E+I  CL+A   +   P  R  I  +  + IEL+NV+HR++LTR+   I L +L+ + QII +  E+   K  S+E                 +D   L+  KS VFA LE+ VC L R +P L
Sbjct:  689 KGNLCVILKELAAELTAPDTQAAASTCLLPALCHPDDLLILSPLLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCATVDEAQRVLILEQLLNSIKHTKGARQQTVQLHVVSAISNLLKYVAGSKQSLGPE--VRRLVLTLVLGALESPTPLLRCAASEAWARLAQVADDGAFTAGLAQLSFDKLKSARDVVTRTGHSLALGSLHRYLGGIGP-QHLSSCIGVLYTLSQDSTSPDVQTWALHSLSLTIDSAGALYHVHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTSVSALRTSCLLGCAVMQDHPGCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAIMLARDGRDAAADANLREVGLEGALL----------------------ALLDRETDESLCQDIRETLHHMLTSMAVGKLTLWLKLCKDVLAASADFTAVTCVDTMQEEEGDRGD-DASVLTR--------------GDDKPHPFSNPRWATRVFAADCVCRIINQCENANRA--HFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATDHSDQLRLSGLDTLLVVIRRFADIAEPEFPGHVILEQYQANVGAALRPAFTSETPPDITAKACQVCSAWIASGVVSDLSDLRRVHQLLVSSLTKIQAGKEALSQLYNESASTMEILAVLRAWAEVYIIAVQRHKNHKQALKTTVNSEDSMRNGSSSAAGLLDLVCTDLATLSKLWLAALQDFALLTLPAEFASQLPTEGGA----FYTAETS-KSAKLHYHDSWALILHAAALWLTSTGFADPDEGGANLSRPVTPTSMCQGSSSSGAAVKSPEDVYTDRFHLILGISVEFLCSLRSDASLESIMACLRALQALLDVPWPRWRIGSDQDLGIELLNVLHRVILTRESPAIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGASEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILVRQLPEL 1697          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Mouse
Match: Heatr5a (HEAT repeat containing 5A [Source:MGI Symbol;Acc:MGI:2444133])

HSP 1 Score: 179.874 bits (455), Expect = 3.024e-50
Identity = 122/226 (53.98%), Postives = 161/226 (71.24%), Query Frame = 3
Query:  852 DVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYE---------GLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAK 1502
            DV  RTG+SLALG LHRY+G +G  QHLS+ +G+L  L+QD+ SP VQ W+LH+L+L  DS G ++  ++E T++LI+ LLLN PP+   VHQ LG+ L ALITTLGPELQG++T + +LR SC + C+++Q HP  LVQA+A+SCLQQLHMFAP+HVNLS+L+  L E          L SP+LLLRRAV+ACLRQL Q+E   E+ E    + RD  +   DA 
Sbjct:    2 DVVTRTGHSLALGSLHRYLGGIGP-QHLSSCIGVLYTLSQDSTSPDVQTWALHSLSLTIDSAGALYHVHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTSVSALRTSCLLGCAVMQDHPGCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCEILLDNSVLVNLCSPYLLLRRAVLACLRQLVQRE-AAEVSEHAIMLARDGRDAAADAN 225          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Mouse
Match: Heatr5b (HEAT repeat containing 5B [Source:MGI Symbol;Acc:MGI:2444098])

HSP 1 Score: 78.1814 bits (191), Expect = 5.669e-14
Identity = 79/278 (28.42%), Postives = 123/278 (44.24%), Query Frame = 3
Query: 2463 DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------ADHSQNITID-----------------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
             L+ LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T D   ++ Y+  W  IL A +LWL        + ++  T+                              D++ LILG+ +  +C    ++  E +  CL+A +T+   P  R  IAE+ L+ +EL++V+HR+LLT +   I L     + QI+ +    + E R    E          L            KS VFA +E+++  L R++PHL     +DSP+
Sbjct:   46 SLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGA----FYTPETID-TARLHYRNSWAPILHAVALWLNSTGFISQESTEATTVSGVQKRSPAVSLNQVPGAMASAKPLPEVNKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLGSPYARIHIAEDQLIGVELLSVLHRLLLTWNPPSIQLLVTGVVQQIVRAAQDYLQEKRNALNEEDMEKESCPTLGEGGDTGGLIPGKSLVFATMELLMFILVRHMPHLSTKM-LDSPS 317          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Match: sp|A1A5F2|HTR5B_XENTR (HEAT repeat-containing protein 5B OS=Xenopus tropicalis OX=8364 GN=heatr5b PE=2 SV=1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 528/1128 (46.81%), Postives = 690/1128 (61.17%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNED--SPQFLS----SIEGLAVLRAWAEIYIVAVS---------------------NSSMRD------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITIDD----------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQ---KSLNVICQLINAMSNLLKL 3248
            +G +N LLRELVAEFTLT+N SNTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KSS G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN   I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + + + + N  D + S  N ++  +                  GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WLQL K+V+ A            GK   SE KDE  D       G                  DD  KPF   RW T+VFAA+C  +++ +C  S DK  HF++  AR+      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA V AALRPAF+  T  ++TA AC+VCS+WI S V  DL+DLRRVH LLV+SLDK++     S Q       ++E L+VL+AWAE+Y VA++                     + S  D      L+ LVEP L TLS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL     S + T +D                                  ++ LILG+ +   C    ++  E +  CL+A + +   P  R  IAE+ ++ +EL+NV+HR+LLT D   + L+    + QI+ +    I E R  + +   S ++ ++LL            KS VFA +E+++  L R++P L      DSP+         +VS + Q   +S+ ++   +  +S L  L
Sbjct:  686 EGNFNVLLRELVAEFTLTDNSSNTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSSLGPEE-VRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQFSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLGSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-NLAKNAGDKESSGLNINITDT------------------GLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLQLCKDVLAASSDVGTTGPVSGGKDDESEKKDEMDDDTMFTTLG-----------------DDDKSKPFVAPRWATRVFAADCLCRIILLCENS-DK-VHFDLAQARAARLKNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVSAALRPAFSQDTPSDITAKACQVCSTWIGSRVVSDLNDLRRVHNLLVSSLDKIQKGKGASSQLYRESAMTMEKLSVLKAWAEVYAVAMNIKKEAENNPKKALKTSDEDEDDYSTTDELPPDCLITLVEPELPTLSRLWLAALKDYALLTLPPEFASQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNCTGFSNSDTAEDGAVAGSQKRTASATLNQPASTPQGTKSLMEVNKNRMHLILGISIQFFCAPRPEEPIEHVTACLQALHILLESPFARNHIAEDQVIGVELLNVLHRLLLTWDTSSVQLRVTTVVQQIVRAAQHNIQEQRNAQNKDDTSEKETQVLLGEGEESGGLIPGKSLVFASMELLMFILVRHMPQLSSKLS-DSPSH--------IVSKSQQLSEESMRLVASTVTILSELPSL 1750          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Match: sp|Q8C547|HTR5B_MOUSE (HEAT repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Heatr5b PE=1 SV=3)

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 522/1092 (47.80%), Postives = 675/1092 (61.81%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQ---SVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA------------GK---SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVAV-----SNSSMRDLMN----------------------LVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------ADHSQNITID-----------------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G++N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+TL+ G+L N NPILRCAAGE LGRMAQV+G++SFIA MAQYSFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN+  I ++R SC V C+I Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +   + N  D + S  N    + G S RSD          +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL L K+V+ A            GK   SE KDE  D       G                 ++D  KPF   RW T+VFAA+C  +++ +C  S     HF++  ARS      ++D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++ A AC+VCS+WI SGV  DL+DLRRVH LLV+SLD ++     S Q      +++E LAVL+AWAE+Y+VA+     + S  +  MN                      LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T  D  ++ Y+  W  IL A +LWL        + ++  T+                              D++ LILG+ +  +C    ++  E +  CL+A +T+   P  R  IAE+ L+ +EL++V+HR+LLT +   I L     + QI+ +    + E R    E          L            KS VFA +E+++  L R++PHL     +DSP+
Sbjct:  686 EGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALTLVMGALDNPNPILRCAAGEALGRMAQVVGEASFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNAATISTIRSSCLVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-SLAKNAGDKEISGGNVNPFTPGVSSRSDVHCRH-QGVNITDTGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSDMSAATLLSSGKDEESEKKDEMDDDAMFTTLG-----------------EEDKSKPFVAPRWATRVFAADCLCRIINLCENSDQA--HFDLALARSAKLRNPKNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDTVQAGKGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEAESKPKRAMNNPDDDDDDYGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNSTGFISQESTEATTVSGVQKRSPAVSLNQVPGAMASAKPLPEVNKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLGSPYARIHIAEDQLIGVELLSVLHRLLLTWNPPSIQLLVTGVVQQIVRAAQDYLQEKRNALNEEDMEKESCPTLGEGGDTGGLIPGKSLVFATMELLMFILVRHMPHLSTKM-LDSPS 1739          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Match: sp|Q9P2D3|HTR5B_HUMAN (HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2)

HSP 1 Score: 837.41 bits (2162), Expect = 0.000e+0
Identity = 517/1086 (47.61%), Postives = 678/1086 (62.43%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSV---GKSVRSDPTASDILQAALLSK-GLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGK--------SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVA--------------VSNSSMR-------------DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLW-------------------LADHSQNITID-----------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G++N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      ++      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+TL+ G L N NPILRCAAGE LGRMAQV+G+++FIA MAQYSFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  SP VQ WSLH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGA+ITT+GPELQGN     ++R SC V C+I Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV  + +   + N  D + S  N S    G S R+D       Q   +++ GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL L K+V+ A          S  KDE+ +K            + +DD +  +  ++D  KPF   RW T+VFAA+C  +++ +C  +     HF++  ARS       +D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++ A AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++     S Q      +++E LAVL+AWAE+Y+VA              + N+                 L+ LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T  D  ++ Y+  W  IL A +LW                   L   S ++ ++                 D++ LILG+ +  +C    ++  E +  CL+A +T+   P  R  IAE+ L+ +EL++V+HR+LLT +   + L     + QI+ +    + E R    E         +L            KS VFA +E+++  L R++PHL      DSP+
Sbjct:  686 EGSFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLLGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RIPAGEAVPGPLPLGVSVIDASVALFGVVFPHVSYKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIARMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSPEVQTWSLHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGAIITTVGPELQGNGATTSTIRSSCLVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVHLCSSHLLLRRAAVACLRQLAQREA----AEVCEYAM-SLAKNTGDKESSSANVSPFAPGVSSRTDIHCRH--QGVNITETGLEGLLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLMLCKDVLAASSDMSTATLLSSGKDEEAEKKD----------EMDDDTMFTTLGEEDKSKPFVAPRWATRVFAADCLCRIINLCENADQA--HFDLALARSAKLRNPTNDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSQDTPSDIIAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDKVQAGKGSSSQLYRESATTMEKLAVLKAWAEVYVVAMNIKKEAESKPKRAIKNTDDDDDDCGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPDGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLNSTGFTCSESTEAAAISGLQKRSTSVNLNQASGAVGSAKSLPEINKDRMHLILGVSIQFLCSPRPEEPIEHVTACLQALHTLLDSPYARVHIAEDQLIGVELLSVLHRLLLTWNPSSVQLLVTGVVQQIVRAAQDYLQEKRNTLNEDDMEKEACTVLGEGGDSGGLIPGKSLVFATMELLMFILVRHMPHLSTKVS-DSPS 1739          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Match: sp|Q86XA9|HTR5A_HUMAN (HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 449/1085 (41.38%), Postives = 618/1085 (56.96%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDK----------LRNEDSPQFLSSIEGLAVLRAWAEIYIVAV----------------------SNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL-------AD--------------------HSQNITID-------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRT 3155
            +G    +LREL A+ T  +     +T LL  +CH DD +IL  +LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    RL ILE   + I+  K  RQQ  Q+++ ++V   ++ +A +K   G E  +K+ A+TL+ G+L + NP+LRCAA E   R+AQV+ D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G + S QHL++ +GIL  LAQD+ SP VQ W+LH+L+LI DS GP++  ++E T++LI+ LLLN PP+  +VHQ LG+ L ALITTLGPELQGNST I +LR SC + C+++Q +PD LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H +    ++R++       + VG                     LEGAL  LLD E D +LC D+++TL  +L S   E+L+ WL+L K+V+ A    T        ++E+GDK     G  A            +  +D+   PF   RW T+VFAAEC  +++  C  ++    HF+I  A+       R+D L+LHL+D+I  AF+AAT   D+LRL GL  L  +I  FA V EPEFP  VILEQYQA VGAALRPAF   T P+VTA AC+VCS+WIASGV  DL+DLRRVHQLLV+SL K          L NE +    S++E LAVL+AWAE+YI+AV                       + S   L++LV   L TLS  W   L  +A+L LP+E +  L    GA    F + +T+ +N ++ Y   W +IL A +LWL       AD                     S   TI        D+  LILG+ ++ +C L S  T E+I  CL A   +   P  R  I  +  + IEL+NV+HR++LTR+   I L +L+ + QII +  E+   K  S+E                 +D   L+  KS VFA LE+ VC L R +P L       SP  K T
Sbjct:  684 EGNLCAILRELAADLTAPDIQVAASTFLLPPLCHQDDLLILSPFLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCAHVGETQRLLILEQLLDSIKHTKGARQQVVQLHVVSSVSSFLKYVAGSKGCLGPE-EMKRFALTLVMGALESPNPLLRCAAAESWARLAQVVDDGAFTAGLAQVSFDKLKSARDVVTRTGHSLALGSLHRYLGGISSSQHLNSCIGILYTLAQDSTSPDVQTWALHSLSLIIDSAGPLYYVHVEPTLSLIIMLLLNVPPTHAEVHQSLGRCLNALITTLGPELQGNSTSISTLRTSCLLGCAVMQDNPDCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAVMLAKDSREELTPDANIREVG---------------------LEGALLILLDKETDERLCHDIKETLNYMLTSMAVEKLSLWLKLCKDVLAASADFTAVTCVDTMQEEEGDK-----GDDASV---------LTTRRDEKSHPFTNPRWATRVFAAECVCRIINQCENANSA--HFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATDHSDQLRLSGLEMLLVVIRRFATVPEPEFPGHVILEQYQANVGAALRPAFTSETPPDVTAKACQVCSAWIASGVVSDLNDLRRVHQLLVSSLTKIQAGKEALSHLYNESA----STMEILAVLKAWAEVYIIAVQRHKNHRQPLKTTTCLEDGIRNGSCSSDGLLDLVYADLGTLSRLWLAALQDFALLTLPSEFASQLPAEGGA----FYTAETS-ENAKLHYYNSWALILHATALWLTSTGFVVADPDEGASNLSRPVTPTSMCQGSSSGATIKSPEDVYTDRFHLILGISVEFLCSLRSDATMESITACLHALQALLDVPWPRSKIGSDQDLGIELLNVLHRVILTRESPSIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGAAEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILVRQLPELNPKLT-GSPGVKAT 1710          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Match: sp|Q5PRF0|HTR5A_MOUSE (HEAT repeat-containing protein 5A OS=Mus musculus OX=10090 GN=Heatr5a PE=1 SV=2)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 430/1066 (40.34%), Postives = 604/1066 (56.66%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSET--------KDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFL----SSIEGLAVLRAWAEIYIVAV---------------SNSSMRD-------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------------ADHSQNIT---------------------IDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
            KG    +L+EL AE T  +  +  +T LL ++CH DD +IL   LQETDH+ IE+QL   +    G+LE+DP ++Y        V+G  + P PLP  ++VI S+ +LFG++   +    R+ ILE     I+  K  RQQ  Q+++ +A+   ++ +A +K S G E  +++  +TL+ G+L +  P+LRCAA E   R+AQV  D +F A +AQ SFD+LK+ RDV  RTG+SLALG LHRY+G +G  QHLS+ +G+L  L+QD+ SP VQ W+LH+L+L  DS G ++  ++E T++LI+ LLLN PP+   VHQ LG+ L ALITTLGPELQG++T + +LR SC + C+++Q HP  LVQA+A+SCLQQLHMFAP+HVNLS+L+  L   L SP+LLLRRAV+ACLRQL Q+E      EV  H I    + R  A  +   +   +                           LLD E D  LC D+ +TL  +L S    +LT WL+L K+V+ A    T        ++E+GD+   +A  + R               DD   PF+  RW T+VFAA+C  +++  C  ++    HF+I  A+       R+D L+LHL+D+I  AF+AAT   D+LRL GL  L  +I  FA ++EPEFP  VILEQYQA VGAALRPAF   T P++TA AC+VCS+WIASGV  DLSDLRRVHQLLV+SL K++   E   Q      S++E LAVLRAWAE+YI+AV               S  SMR+       L++LV   L TLS  W   L  +A+L LP E +  L    GA    F + +T+  + ++ Y   W +IL AA+LWL            A+ S+ +T                       D+  LILG+ ++ +C L S  + E+I  CL+A   +   P  R  I  +  + IEL+NV+HR++LTR+   I L +L+ + QII +  E+   K  S+E                 +D   L+  KS VFA LE+ VC L R +P L
Sbjct:  689 KGNLCVILKELAAELTAPDTQAAASTCLLPALCHPDDLLILSPLLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEK-----DVEGD-SVPKPLPPALSVISSASKLFGVVCATVDEAQRVLILEQLLNSIKHTKGARQQTVQLHVVSAISNLLKYVAGSKQSLGPE--VRRLVLTLVLGALESPTPLLRCAASEAWARLAQVADDGAFTAGLAQLSFDKLKSARDVVTRTGHSLALGSLHRYLGGIGP-QHLSSCIGVLYTLSQDSTSPDVQTWALHSLSLTIDSAGALYHVHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNTSVSALRTSCLLGCAVMQDHPGCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPYLLLRRAVLACLRQLVQREA----AEVSEHAIMLARDGRDAAADANLREVGLEGALL----------------------ALLDRETDESLCQDIRETLHHMLTSMAVGKLTLWLKLCKDVLAASADFTAVTCVDTMQEEEGDRGD-DASVLTR--------------GDDKPHPFSNPRWATRVFAADCVCRIINQCENANRA--HFDIALAQEMKKRDSRNDFLVLHLADLIRMAFMAATDHSDQLRLSGLDTLLVVIRRFADIAEPEFPGHVILEQYQANVGAALRPAFTSETPPDITAKACQVCSAWIASGVVSDLSDLRRVHQLLVSSLTKIQAGKEALSQLYNESASTMEILAVLRAWAEVYIIAVQRHKNHKQALKTTVNSEDSMRNGSSSAAGLLDLVCTDLATLSKLWLAALQDFALLTLPAEFASQLPTEGGA----FYTAETS-KSAKLHYHDSWALILHAAALWLTSTGFADPDEGGANLSRPVTPTSMCQGSSSSGAAVKSPEDVYTDRFHLILGISVEFLCSLRSDASLESIMACLRALQALLDVPWPRWRIGSDQDLGIELLNVLHRVILTRESPAIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGASEKETLPEFGEGKDTGGLVPGKSLVFATLELCVCILVRQLPEL 1697          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Match: R7TVV8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_154771 PE=4 SV=1)

HSP 1 Score: 932.554 bits (2409), Expect = 0.000e+0
Identity = 549/1052 (52.19%), Postives = 697/1052 (66.25%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQ-----------LQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQA--GKSETKDEKGDKNTMNAG---GIARXXXXXXXXIKFSANKDDSV-KPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKL-RNED-SPQF---LSSIEGLAVLRAWAEIYIVAVSNSSMR------------------------DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLAD-----------HSQNITID----DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKIL-----------LKSPVFACLEIVVCGLTRYVPHL 3113
            + +++ LLRELVAEFTLT+NP+NTTTSLLRS+CH DDSVILGSWLQETDHK IEDQ           LQPNSASGSGALEHD  +LYL+      V G  + P PLPLGVAVIDSSV+L+G +FP++  KHRLQ+L+HFSECI+QAKS RQQA Q+NIF AVLCA++ LAE K+ FG+   ++K AV L+ G+L + NPILRCA+GE LGRM+QV+GDS FIAEMAQYSFD+LK+ RDV  RTG+SLALGCLHRYVG +GSG HL+TSV ILLALAQD+ SPVVQVW+LHALALIADSGGPMF  ++E T++L+L LLL+ PPS  DVHQCLGK L ALITT+GPELQGN++ I + R+SC V C+I+Q HPDS VQAEA+SCLQQLH+FAP+HVNL+TL+PHL E L+S HLLLRRA V+CLRQLAQ+E      EV  H +     N++  ++  R  +VG++                  GLEGALF LLD E D  LCS + DTLL +LQ+   + LT+WL L+K+V+QA  G   +K    + + +N+    G A   D EDD     A  D  + KP    RWPT+VFA +C  K++  C  +     HF++I AR     + + D L+LHLS+++  AFIAAT + DKLRL GL ALQ+II  F +V EPEFP  VILEQYQAQVGAALRPAFA  T P+VTAAACEVCS WI SGVARDL+DLRRVHQLLV+SL KL R +D SP F    S++E LAVLRAWAE+YIVA+     R                         L++LV+P + TLS HW   L  +A+L+LP + S  L    GA    F + DT D ++   Y+  WP IL A SLWL +              N+  D    D+  L+LG+C++A+C   S Q  ET+  CLKA  T+      R  + ++  + IEL NV+HR+LLTR+  +     +D +  +I +  EN   + E  ++ +   +L            KS VFA LE+ +C L R+VP+L
Sbjct:  695 EASFSALLRELVAEFTLTDNPANTTTSLLRSLCHADDSVILGSWLQETDHKAIEDQMEPNRKVDNDHLQPNSASGSGALEHDAASLYLNF-----VPG-ESVPGPLPLGVAVIDSSVRLYGFVFPRVAHKHRLQMLQHFSECIKQAKSSRQQAVQINIFAAVLCALKGLAENKTGFGNI-EVRKAAVNLVLGALGSSNPILRCASGEALGRMSQVVGDSKFIAEMAQYSFDKLKSARDVVTRTGHSLALGCLHRYVGGMGSGHHLNTSVSILLALAQDSTSPVVQVWALHALALIADSGGPMFRGFVEPTLSLVLQLLLSVPPSNTDVHQCLGKCLAALITTIGPELQGNTSSIATARLSCLVCCAIMQDHPDSQVQAEAISCLQQLHLFAPRHVNLTTLVPHLCETLTSTHLLLRRAAVSCLRQLAQREA----REVSEHALSLAQENKEFREKLGRMGAVGET------------------GLEGALFGLLDRETDNVLCSHVRDTLLSMLQAMASDCLTRWLLLVKDVLQASTGDRSSKVASTESSALNSPADEGDAGVKDEEDDGGVLHAGSDSQMNKPTVAPRWPTRVFAIDCLLKIMAACDGT---PIHFDLIKARELRLKS-KVDFLVLHLSELVRMAFIAATSDSDKLRLAGLAALQEIITKFCRVPEPEFPGHVILEQYQAQVGAALRPAFAPETAPDVTAAACEVCSRWIGSGVARDLNDLRRVHQLLVSSLAKLERGKDSSPLFSESASTMERLAVLRAWAEVYIVAMKQEKERCQKDASQVDEEDEDARSTVSSVGESLLSLVQPEMATLSRHWLAALKDHALLSLPQDYSSQLPSDGGA----FYTYDTMDSSRP-HYRRAWPAILYAVSLWLKETGFTSVDKDDSRPANMKADRSDSDRFHLLLGICVEALCSPASVQPIETVVLCLKAICTLLDDSWPRSKLGQDKSLVIELFNVMHRLLLTRESAECLCLIMDVVKHVIRAAQENLEHERELQKAIKKAVVLGEGAESGDILAGKSLVFAALEVCLCVLVRHVPNL 1708          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Match: V4A0F3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164458 PE=4 SV=1)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 543/1081 (50.23%), Postives = 706/1081 (65.31%), Query Frame = 3
Query:  183 YNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDS-----PQFLSSIEGLAVLRAWAEIYIVAV---------------------SNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLAD--------------------HSQNITID--------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISEN----RTPKTESSESTRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTV-LPLVVSNNHQKSLNVICQLINAMSNLLKL 3248
            Y +LLRELV EFTLT+NP+NTTTS+LRSMCHVDDSVILGSWLQETDHK IEDQLQPNSASGSGALEHD  +LY    + C     +  P PLPLGVAVIDSSV+L+G++FP++  KHRLQ+L+HF+ECI+QAKS+RQQA QMNIF+AVLCA++ L+E K + G + ++KK A +LI G+L N NPILRCA+GE LGRMAQV+GDS FIAEMAQYSFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL+TSV ILLALA+D NSPVVQVW+LHALALIADSGGPMF +Y+E T+ L+L LLL  PPS +DVHQCLGK L ALIT++GPELQGN+  + + R+ C V C+I+  HPDSLVQAEA+SCLQQLHMFAP+HVNL++L+P L + L S HLLLRRA VACLRQL  +E  KE+ E    +  +  + +K    S                           GLEG LF +LD E D KL SD++DT++ LLQS     L++W++LLK+V+ A    T        +M      + D+ E+DD  F+ +  D   P    RWPT+VFA EC  K++  C    + D  F++  A+  +  TG  + L LHL D+I  AFIAAT + ++LRL GL AL+ +I  FA V EPEFP  VILEQYQAQVGAALRPAF+  T  +VTAAACEVCS+WI SGVARDL+DLRRVHQLLV+SL KL    S      +  S++E LAV+RAWAE+YIVAV                     S  S   L++LV+P L+ LSNHW+  L  +A+L+LP+E S  L    GA    F   DT +  +   Y+  WP IL A SLWL +                    H  N   +        +K+FLILG+CM+++C   S  +D T++ CL+    +      R  +AE+P++  EL+NV+HR++LTRD  +IH  AL+ + Q++++  EN    R  +    E+T D+ +  KS VFA LE+ +C + R VP L       +P++  T   +P  ++   ++S+ ++   I  M  L KL
Sbjct:  686 YPSLLRELVGEFTLTDNPANTTTSMLRSMCHVDDSVILGSWLQETDHKAIEDQLQPNSASGSGALEHDAQSLY----ARCPAGEPI--PGPLPLGVAVIDSSVKLYGMIFPRVAHKHRLQMLQHFNECIKQAKSVRQQAVQMNIFSAVLCALKSLSENKLNLGPD-DVKKAAFSLIMGALGNSNPILRCASGEALGRMAQVVGDSKFIAEMAQYSFDKLKSARDVVSRTGHSLALGCLHRYVGGMGSGQHLNTSVSILLALAKDFNSPVVQVWALHALALIADSGGPMFRSYVEPTLALVLQLLLTVPPSTVDVHQCLGKCLSALITSIGPELQGNTASLATARLYCMVCCAIMYDHPDSLVQAEAISCLQQLHMFAPRHVNLTSLVPQLCDTLMSSHLLLRRAAVACLRQLVTRE-AKEISEQAVSLAGEGIHGKKCEYISD-------------------------TGLEGTLFGMLDTEIDEKLISDVKDTIVSLLQSLAITNLSRWIKLLKDVLSASTDAT------STSMIQSNDDKGDEDEEDDATFTTSTPDVTHPTVAPRWPTRVFAVECLMKIIAAC---EEDDSQFDLSKAKEILEKTGNGNYLALHLPDLIRMAFIAATSDSNELRLAGLSALEKVITRFATVPEPEFPGHVILEQYQAQVGAALRPAFSPETPSDVTAAACEVCSTWIGSGVARDLNDLRRVHQLLVSSLAKLNTGKSHTQIYNESASTMEKLAVIRAWAEVYIVAVNREKEKHQKTQQKFDEDDEEFSEYSTESLLSLVQPELSALSNHWFNALKDHALLSLPSEYSSQLPPDGGA----FYHPDTIESAKH-HYRAAWPPILYALSLWLNEKGFAELSDKMLSKESSNNNSHPANAPANMNPEELHQEKLFLILGICMESLCSPTSMLSDTTVQQCLQGLCALLDTKWPRTQLAEDPVLCRELLNVMHRVILTRDGVEIHSLALNVVKQVVLAAEENLETERLQQKGEGETTGDI-VPDKSVVFATLEVCLCVMVRQVPAL-------NPSAPSTGFQMPTNLTKLSEESVALMGSSITVMCGLPKL 1711          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Match: A0A1S3H0J5 (HEAT repeat-containing protein 5B-like isoform X4 OS=Lingula unguis OX=7574 GN=LOC106151010 PE=4 SV=1)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 549/1098 (50.00%), Postives = 712/1098 (64.85%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAG-KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFL-----SSIEGLAVLRAWAEIYIVAVSNSSMRD------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITI----------------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISEN----RTPKTESSESTRD--------VKIL-------------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKL 3248
            +G +N LLRELVAEFTLT+NP+NTTTS+LRSMCH+DDSVILGSWLQETDHK IEDQLQPNSASGSGALEHD  +LYL      +++     P PLPLGVAVIDSSV+L+G++FP++  KHRL++L+HF++CI+ AKS RQQA Q+NIFTAVLCA++ LAE K+ FG +  ++KEAV L+ G+L + NPILRCAAGE LGRMAQV+ DS FIAEMAQ+SFD+LK+ RDV  RTG+SLALGCLHRYVG +GSGQHL+ SV ILLALAQDT SPVVQVWSLHALALIADSGGPM+  Y+E T++L+LSLLL+ PPS  DVHQCLGK L ALITT+GPELQGN+  I + R+ C V C+I+Q HPDSLVQAEA++CLQQLHMFAP+HVNL+TL+PHL   L+S HLLLRRA VAC+RQLAQ+E  +     ++  + D++N                          I+   +   GLEGALF+LLD E D +LC D+ DTL+ +L S  EE LT+W  L+K V+ A  +S T  +   + T        DDD EDDD +F A + D   P    RWPT+VFA EC R+++ +C      + +F++  AR    + G+ D L+LHLS+++  AFIAAT + D+LRL GL  LQDII+ F+KV EPEFP  VILEQYQAQVGAALRPAF+  T  +VTAAACEVCS+WI SGVARDL+DLRRVHQLLV+SL+KL++      L     S++E LAVL+AWAE+YIVA +    RD                  L++LV+P L TLS HW   L  +A+L+LP ELS  L    G     F   DT D + ++ YK  W  +L A +LWL    H+ N                         DD+ FL++G+CM+AMC   S Q  E ++ CLK+   +  +P  R  + ++  + IE++NV+HR++LTR+        L  + Q++ +  E+    RT  T+      D         K++              KS V+A LE+ +C L RY+P L        P++  T   P  V+N  ++   +I   +N M  L  L
Sbjct:  684 EGAFNALLRELVAEFTLTDNPANTTTSMLRSMCHIDDSVILGSWLQETDHKAIEDQLQPNSASGSGALEHDAISLYL------RLQPGEGKPGPLPLGVAVIDSSVKLYGLIFPRVPHKHRLKMLQHFADCIKHAKSHRQQAVQINIFTAVLCALKFLAENKTGFG-QLEVRKEAVKLVLGALGSANPILRCAAGEALGRMAQVVEDSRFIAEMAQFSFDKLKSARDVVTRTGHSLALGCLHRYVGGMGSGQHLNMSVSILLALAQDTTSPVVQVWSLHALALIADSGGPMYRGYVEPTLSLVLSLLLSVPPSNTDVHQCLGKCLAALITTIGPELQGNTGSIATARLYCLVCCAIMQDHPDSLVQAEAIACLQQLHMFAPRHVNLATLVPHLCATLNSNHLLLRRAAVACMRQLAQREAREVSEHALTLAVEDRTNK-----------------------PGII---ITETGLEGALFELLDSETDAQLCKDVHDTLISMLHSLAEENLTRWFMLVKNVLAAATESGTPVDSPMQETATGNEDDDDDDDEDDDTEFKAAEADITHPLIAPRWPTRVFATECMRRIVGVC---EGNNANFDLALARELKRTNGKGDYLVLHLSELVRVAFIAATADSDQLRLAGLATLQDIIHKFSKVPEPEFPGHVILEQYQAQVGAALRPAFSPDTPSDVTAAACEVCSTWIGSGVARDLNDLRRVHQLLVSSLEKLKSGKGKAQLYNEGASTMEKLAVLKAWAEVYIVAENRERERDTTIKEEEDEFGDAINGESLLSLVKPELPTLSKHWLSALKDHALLSLPPELSSQLPAEGGT----FYWADTIDSS-RLHYKKSWAPMLYAVALWLNEGGHATNPKESSSAATTPVEPPPANMQPDELDDDRFFLLIGICMEAMCSPASVQPLENVEMCLKSMYALLDKPWPRSRLGKDSALSIEVLNVMHRLILTRENPSTQQLVLGVVQQVVKAAQEHFEAERTRATDEDTGAEDQENPPANSEKVVNLGEGGESGEITPGKSVVYATLEVNLCVLIRYIPALNPAL----PSTGFTQ--PHRVNNMSEEVAQLIASTLNIMMELPGL 1734          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Match: A0A1S3H0R3 (HEAT repeat-containing protein 5B-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106151010 PE=4 SV=1)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 549/1098 (50.00%), Postives = 712/1098 (64.85%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAG-KSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFL-----SSIEGLAVLRAWAEIYIVAVSNSSMRD------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL--ADHSQNITI----------------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISEN----RTPKTESSESTRD--------VKIL-------------LKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKL 3248
            +G +N LLRELVAEFTLT+NP+NTTTS+LRSMCH+DDSVILGSWLQETDHK IEDQLQPNSASGSGALEHD  +LYL      +++     P PLPLGVAVIDSSV+L+G++FP++  KHRL++L+HF++CI+ AKS RQQA Q+NIFTAVLCA++ LAE K+ FG +  ++KEAV L+ G+L + NPILRCAAGE LGRMAQV+ DS FIAEMAQ+SFD+LK+ RDV  RTG+SLALGCLHRYVG +GSGQHL+ SV ILLALAQDT SPVVQVWSLHALALIADSGGPM+  Y+E T++L+LSLLL+ PPS  DVHQCLGK L ALITT+GPELQGN+  I + R+ C V C+I+Q HPDSLVQAEA++CLQQLHMFAP+HVNL+TL+PHL   L+S HLLLRRA VAC+RQLAQ+E  +     ++  + D++N                          I+   +   GLEGALF+LLD E D +LC D+ DTL+ +L S  EE LT+W  L+K V+ A  +S T  +   + T        DDD EDDD +F A + D   P    RWPT+VFA EC R+++ +C      + +F++  AR    + G+ D L+LHLS+++  AFIAAT + D+LRL GL  LQDII+ F+KV EPEFP  VILEQYQAQVGAALRPAF+  T  +VTAAACEVCS+WI SGVARDL+DLRRVHQLLV+SL+KL++      L     S++E LAVL+AWAE+YIVA +    RD                  L++LV+P L TLS HW   L  +A+L+LP ELS  L    G     F   DT D + ++ YK  W  +L A +LWL    H+ N                         DD+ FL++G+CM+AMC   S Q  E ++ CLK+   +  +P  R  + ++  + IE++NV+HR++LTR+        L  + Q++ +  E+    RT  T+      D         K++              KS V+A LE+ +C L RY+P L        P++  T   P  V+N  ++   +I   +N M  L  L
Sbjct:  685 EGAFNALLRELVAEFTLTDNPANTTTSMLRSMCHIDDSVILGSWLQETDHKAIEDQLQPNSASGSGALEHDAISLYL------RLQPGEGKPGPLPLGVAVIDSSVKLYGLIFPRVPHKHRLKMLQHFADCIKHAKSHRQQAVQINIFTAVLCALKFLAENKTGFG-QLEVRKEAVKLVLGALGSANPILRCAAGEALGRMAQVVEDSRFIAEMAQFSFDKLKSARDVVTRTGHSLALGCLHRYVGGMGSGQHLNMSVSILLALAQDTTSPVVQVWSLHALALIADSGGPMYRGYVEPTLSLVLSLLLSVPPSNTDVHQCLGKCLAALITTIGPELQGNTGSIATARLYCLVCCAIMQDHPDSLVQAEAIACLQQLHMFAPRHVNLATLVPHLCATLNSNHLLLRRAAVACMRQLAQREAREVSEHALTLAVEDRTNK-----------------------PGII---ITETGLEGALFELLDSETDAQLCKDVHDTLISMLHSLAEENLTRWFMLVKNVLAAATESGTPVDSPMQETATGNEDDDDDDDEDDDTEFKAAEADITHPLIAPRWPTRVFATECMRRIVGVC---EGNNANFDLALARELKRTNGKGDYLVLHLSELVRVAFIAATADSDQLRLAGLATLQDIIHKFSKVPEPEFPGHVILEQYQAQVGAALRPAFSPDTPSDVTAAACEVCSTWIGSGVARDLNDLRRVHQLLVSSLEKLKSGKGKAQLYNEGASTMEKLAVLKAWAEVYIVAENRERERDTTIKEEEDEFGDAINGESLLSLVKPELPTLSKHWLSALKDHALLSLPPELSSQLPAEGGT----FYWADTIDSS-RLHYKKSWAPMLYAVALWLNEGGHATNPKESSSAATTPVEPPPANMQPDELDDDRFFLLIGICMEAMCSPASVQPLENVEMCLKSMYALLDKPWPRSRLGKDSALSIEVLNVMHRLILTRENPSTQQLVLGVVQQVVKAAQEHFEAERTRATDEDTGAEDQENPPANSEKVVNLGEGGESGEITPGKSVVYATLEVNLCVLIRYIPALNPAL----PSTGFTQ--PHRVNNMSEEVAQLIASTLNIMMELPGL 1735          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Match: A0A0L8GGE6 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033803mg PE=4 SV=1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 553/1104 (50.09%), Postives = 705/1104 (63.86%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKE--DPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFL-----SSIEGLAVLRAWAEIYIVAVS--------NSSMR------------DLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLAD----------------HSQNITI--------------DDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISEN-------------RTPKTESSESTRDV---------------KILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAM 3230
            + TY TLLRELVAEFTLT+NP+NTTTS LRSMCHVDDSVILGSWLQETDHK IEDQLQPNSASGSGALEHD  +LY  +                 LGVAVIDSSV+L+G++F K+  KHR Q+L+HF+ECI+QAKS RQQA QMNIFTAVLCA++ LA+TK+S G + ++KK A  LI G+L + NPILRCAAGE LGRMAQV+GDS FIAEMAQYSFDRLK+ RDV +RTG+SLALGCLHRYVG +GSGQHL+TSV ILLALAQD NSPVVQVW+LHALALIADSGGPMF  Y+E T++L+L LLL  PP+ +DVHQCLGK L ALIT++GPELQGN   I   R+ C + C+++Q HPDSLVQAEA++CLQQLHMFAP+HVNL+TL+PHL E L+S HLLLRRA VACLRQL  +E  +  EL   +     D  NN KD  +S                       +   GLEG LF +LD E D KL SD++DTLL LLQS     L++WL LLKEV+ A    T      + T+       + D EDDD    A + D   P    RWPT+VFA +C RK++  C     +D  F+++ AR F   TG+S+ L+LHLS+++  AF+AAT + ++LRL GL ALQDII  FA V EPEFP  VILEQ+QAQVGAALRPAF+  T  +VTAAACEVCS+WI SGVARDL+DLRRVHQLLV+SL KL+       L     S++E L+VL+AWAE+YIVAV         N+S++             L++LV+P L+ LS HW   L  YA+L+LP E S  L    G   + +Q+   T D+ +I YK  WP IL A S+WL +                 ++N+ +               D+++LILG+CM+++C   S  ++ET+  CL+A + +      R  I E+ ++  EL+NV+HRILLTR+    HL  ++ + Q+I +  EN             +TP  + S  + D                 I  KS V+A LE+ +C L R +P L       +P +  T      V  +  K  +  CQLI+++
Sbjct:  158 EATYTTLLRELVAEFTLTDNPANTTTSHLRSMCHVDDSVILGSWLQETDHKAIEDQLQPNSASGSGALEHDAASLYARIQPTDPPIPGPLP-----LGVAVIDSSVRLYGLVFYKVAHKHRYQMLQHFNECIKQAKSSRQQAVQMNIFTAVLCALKNLADTKTSLGPD-DVKKAAFNLIMGALGSSNPILRCAAGEALGRMAQVVGDSRFIAEMAQYSFDRLKSARDVVSRTGHSLALGCLHRYVGGMGSGQHLNTSVSILLALAQDFNSPVVQVWALHALALIADSGGPMFRGYVEPTLSLVLQLLLTVPPATVDVHQCLGKCLSALITSIGPELQGNMASIAVARLYCLICCAVMQDHPDSLVQAEAIACLQQLHMFAPRHVNLTTLVPHLSEILTSSHLLLRRAAVACLRQLVTREAREVSELALALPGSTFDLGNNSKDPSKS-----------------------MYESGLEGTLFSMLDTEVDNKLTSDVQDTLLSLLQSLAVRNLSRWLMLLKEVLSAS---TDTSSTIQETIPEENYLTEKDEEDDDSALKATETDITHPSVAPRWPTRVFATDCLRKIISTC---EGQDGQFDLVKAREFREQTGKSNYLVLHLSELVRMAFMAATSDSNQLRLAGLAALQDIILRFADVPEPEFPGHVILEQFQAQVGAALRPAFSPETPSDVTAAACEVCSTWIGSGVARDLNDLRRVHQLLVSSLAKLKTGKFTPLLYNESASTMEKLSVLKAWAEVYIVAVKRDKEKAGVNASLKSEELDVQDFPVESLLSLVQPELSNLSEHWMSALKDYALLSLPPEYSSQLPPEGG---TFYQA--ETMDSSRIHYKKSWPPILYALSIWLNEAGFLSVNREFGGESNKSAKNVPLASTMPANMKPEEVNADRLYLILGICMESLCCPTSLLSEETVNTCLRALHILLDTRWPRKQIGEDMILAKELLNVMHRILLTRENVQTHLLVMEVVKQVIKASHENLDSEGRKTKENSVQTPSKDGSTESMDTIDSNYVIGEGGESGEIIKGKSVVYATLEVCLCVLVRQIPAL-------NPTAANTG---FQVPTHLTKMTDEACQLISSV 1211          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Cavefish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 514/1083 (47.46%), Postives = 679/1083 (62.70%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFLS----SIEGLAVLRAWAEIYIVAVSNSSMRD----------------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLA----------DHSQNITID-------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIIS----ISENRTPKTESSESTRDVKILL------------KSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNN 3185
            +G+++ LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV++GSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL      +V      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+ECI+QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+ L+ G+L N NPILRCAAGE LGRMAQV+G+++FIA MAQ+SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD  S  VQ W+LH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGALITT+GPELQGNS  I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E      EV ++ +                 S+ K    D   S  +   +   GLEG LF +LD E D KLCSD+ DTL  +L S   E+L+ WL+L K+V+ A  +E       +         + D+ +DD +      DD  KP    RW T+VFAA+C  +++ +C  + DK  HF++ +ARS      + D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++     S Q  S    ++E LAVL+AWAE+Y+VA+      +                            L+ LV+P L +LS  W   L  YA+L LP E +  L    GA    F + +T  D  ++ Y+  W  IL A +LWL+          +  Q  T                     D++ L+LG+ ++ +C    ++  E +  CL+A  T+   P  R  IAE+ L+ +EL+NV+HR+LLTRD   + LQ    + + I S    + + R+ K       ++   +L            KS VFA +E++V  L R++P  ++    DSP+   T   PL   +N
Sbjct:  702 EGSFSALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLMGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYL------RVPVGEAIPGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECIKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALALVMGALDNPNPILRCAAGEALGRMAQVVGEATFIASMAQHSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGTSHEVQTWALHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGALITTVGPELQGNSPTISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLCSSHLLLRRAAVACLRQLAQREA----AEVCAYAM-----------------SLAKKA-GDSKESTTINLNITETGLEGVLFGMLDRETDRKLCSDIHDTLGHMLSSLAVEKLSHWLKLCKDVL-AASTEVGGALAFEVEKEEEDSEKKDEMDDDTMFTGLGDDDKTKPSVAPRWVTRVFAADCLCRIIHLCENA-DKA-HFDLATARSAKAKNPKGDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFASVPEPEFPGHVILEQYQANVGAALRPAFSPDTPSDITAKACQVCSAWIGSGVVSDLNDLRRVHNLLVSSLDKVQAGKGSSSQLYSESATTMEKLAVLKAWAEVYVVAMKIKKEAESRPARPVRSGEDDDEDMGDEGDILPPDSLITLVQPELPSLSRLWLAALRDYALLTLPAEFASQLPPEGGA----FYTPETI-DTARLHYRNSWAPILHAVALWLSNTDFGAAEGPEEPQTGTTSPAYPQGPPAPIKNPDELAKDRMHLLLGISIEFLCFPRPEEPIERVMSCLQALCTLLETPQARNHIAEDQLLAVELLNVLHRLLLTRDPPSVQLQVTAVVQETIRSAQDHLDQRRSSKGVEDGGEKESASVLAEGGDTGELQPGKSLVFAAMELLVFLLVRHLPQ-VNTKASDSPSHLPTKPQPLPEHSN 1746          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Cavefish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 564.303 bits (1453), Expect = 1.886e-171
Identity = 395/1064 (37.12%), Postives = 564/1064 (53.01%), Query Frame = 3
Query:  186 NTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKS-------ETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR-NEDSPQFLS-----SIEGLAVLRAWAEIYIVAVSNSSMRD--------------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDD--------------------------------KVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSE---------------STRDVKILL--KSPVFACLEIVVCGLTRYVPHL 3113
             TLL+ L  + T  EN +    SLL  +CH  D  ++G  LQ+ D   IE+QL   +  G G+LE+DP A++                                          +  LQ+LE  SE +R  K  RQQ   +++  A  C +  LA  + + G E  ++K  ++L+ G+L + NP+LRC A E L R+AQV+ + +F   +A  SFDRLK  RD   RTG+SL LG L+RY+G + S QHLS  VG+L  L+QD  SP VQ+WSLH+L+L+ D  GP++ +++E ++ L+L LLL TP + ++V Q LG+ L ALIT+LGP+LQG    +  LR SC V C+++Q  PD LVQA+A++CLQQLHMF+P+HVNL+TL+P L   L S +L LRRAVVACLRQLAQ+E      EV  H +                  V +  R D T  D+    +   GLEGALF LLD E D +L  D++DTL+ ++ S  E +L  WL+L K+V+ A          ET  E+ D +   A               F A ++ S  PFN  RW T+VFA EC  +++  C        HF+++ A+        +D L+LHL++++  AF+AAT   ++LRL GL  L  II  FA V EPEFP  VILEQYQA VGAALRPAF+    P+VTA AC+VCS+WIASGV  DL DLRRVHQLL +SL K++   D P  L      ++E LAVL+AWAE+YIVAV ++  ++                          L+ LV+  L TLS  W   L  YA+L LP   +  L    G+    F + +T  + +Q  Y   W  +L A +LWL + ++ I +D+                                ++ LILG+ ++ +C   S+   E I  CL A   +F  P  R  +  +  + +EL++V+HR+++TR+  +I L  L+ + Q++ +  E+   K  S+E                 RD   L+  KS VF  LE+ +C L R +P L
Sbjct:  690 GTLLKLLQNDLTGPENMACAELSLLPPLCHNQDLALMGPALQDMDQHYIEEQLHGGTIGG-GSLEYDPYAIF------------------------------------------EKDLQVLEKCSETVRLLKGNRQQTVHIHVTAAFCCTLMNLASGRETLGPE-EVQKPGLSLLMGALESSNPLLRCVAAEGLARLAQVLNEPNFTVSLAMMSFDRLKTARDAITRTGHSLVLGALYRYLGGISSPQHLSACVGVLFTLSQDNTSPEVQMWSLHSLSLVVDLAGPLYRSHVEASLTLVLRLLLVTPHTHVEVQQSLGRCLNALITSLGPDLQGEGPGVCVLRNSCLVGCAVMQDSPDCLVQAQAITCLQQLHMFSPRHVNLATLVPSLCVNLCSLYLSLRRAVVACLRQLAQRETV----EVSEHAV----------------ALVKELPRRDNTQLDV---TIKEVGLEGALFSLLDRESDPRLRRDIKDTLIHMMSSAAESELAHWLKLCKDVLSASSDSAAVSLIETNQEE-DTDDCAA---------------FQAKREHS-GPFNNLRWSTRVFAVECVCRIIVQCENGDPA--HFDMVLAQEQRLHES-TDFLVLHLANLVRMAFMAATDHSEQLRLAGLQMLLVIIRKFASVPEPEFPGHVILEQYQANVGAALRPAFSADAPPDVTAKACQVCSAWIASGVVSDLRDLRRVHQLLASSLVKVQAGRDVPSSLYNESTFTMETLAVLKAWAEVYIVAVESTKQKESPAGQHLEQQLEQCEEPETAGPAGAGLLKLVQGDLATLSRLWLAALQDYALLTLPPAYANQLPTSGGS----FYTAETVKEARQ-HYFVAWASVLHATALWL-NSTEFIMVDEGPANLSRPVTPTSMGQSTTLSSIKSPEDISTERLNLILGISVEFLCSPHSQNQMENIASCLHALQALFDVPWPRSKVGNDQALSVELLSVLHRLIVTRESPEIQLAVLELVRQVVCAAQEHVKEKRHSAEVDDGAAEKETVPEFGEGRDTGGLVPGKSLVFGALELCLCVLVRKLPQL 1660          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Sea Lamprey
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 481/1061 (45.33%), Postives = 634/1061 (59.75%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDK----------LRNEDSPQFLSSIEGLAVLRAWAEIYIVA------------------------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITID------------------------------DKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVK-----------------ILLKSPVFACLEIVVCGLTRYVPHL 3113
            +G ++ LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV+LGSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL       V      P PLPLGV+VID+SV LFG++FP +  KHRLQ+LEHF+ECI+QAK +RQQA Q+NIFTAVL A++   E + SF +  ++ +E  T+  G +I  N +  C     +    QV    S    + +Y   +LKA RDV +RTG+SLALGCLHRYVG +GSGQH+ TSV ILLALAQD  SP VQ W+LH+LALI DS GPM+ +Y+E T++L L+LLL  PPS ++VHQCLG+ LGALITTLGPELQG   +I + R SC V C+I+Q H DSLVQA+A+SCLQQLHMFAP+HVNLS+L+P+L   L SPHLLLRRA VACLRQLAQ+E   E+ E    + RD      +A+       +  +VR   +  DI   A+   GLEG LF +LD E D KLC D+ DTL  +L S   E L+ WL+L K+V+ A        K D      G   + D  +DD +  S++ ++  +P    RW T+VFAA+C  +++  C +      HF++  AR       + D L+LHLSD+I  AF+AAT   ++LR+ GL AL+D+I  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCSSWI SGV  D + L+RVH LLV+SL K          L +E S     ++E LAVL+AWA++YIVA                        V   S   L+NLV+P + TLS  W   L  +A+L LP E S  L    G     F + +T  D  ++ Y+  W  IL A  LWL  HS    +                               D+  LI+G+ ++ +C    ++  E +  CL+A  T+   P  R  I  + ++ +EL+NV+HR+LLTRD   + L  +D ++Q I +  E+   K  S+E                       +  KS VFA LE+ +C L R +P L
Sbjct:  686 EGNFSALLRELVAEFTLTDNAANTTTSLLRSLCHCDDSVLLGSWLQETDHKLIEDQLQPNSASGSGALEHDPSSIYLRAAEGEAV------PGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLEHFAECIKQAKGIRQQAVQLNIFTAVLSALKPTPEDRGSFNA-LDVDREICTIFTGKVIKTNGVQLC-----MHFFPQVNNVFSLKCYILEYRVFKLKAARDVVSRTGHSLALGCLHRYVGGIGSGQHIKTSVSILLALAQDNTSPEVQTWALHSLALIVDSSGPMYRSYVEPTLSLALTLLLTVPPSHVEVHQCLGRCLGALITTLGPELQGAGLLISTARSSCLVGCAIMQDHSDSLVQAQAISCLQQLHMFAPRHVNLSSLVPNLCVNLGSPHLLLRRAAVACLRQLAQRE-ASEVCEYALRLARD-----TEAQAGAYKIDISDNVRVHCSFPDI---AISETGLEGVLFGMLDRETDRKLCCDIRDTLGHMLSSLAVEDLSHWLKLCKDVLAASTEIGGGSKVDSTQQEEG--EKGDGMDDDTMFKSSHTEEKSRPQIAPRWATRVFAADCLCRIIAQCESGDPA--HFDLGKARDKKLKDAKGDYLVLHLSDLIRMAFMAATDHSNQLRMVGLQALEDVIKKFAAVDEPEFPGHVILEQYQANVGAALRPAFSADTPSDITAKACQVCSSWICSGVVNDSNGLQRVHSLLVSSLSKVLAGKGGACQLYSESS----GTMERLAVLKAWAKVYIVAMKTQQDATAKVSRDTEEEEEGSREVDQLSADSLLNLVQPEIPTLSRLWQAALQDHALLTLPLEFSSQLPAEAGGA---FYTPETI-DAARMHYRASWATILRAVCLWL--HSSGFAVGELEDFPVALPGTELASGPEVPICSPEDLNTDRFHLIIGISIEFLCSPRVEEPIECVTECLEALKTLLDSPWPRTKIGNDQMLAVELLNVLHRLLLTRDVPVVQLAVVDVVTQTIRATLEHIKEKRRSAEVDDGAAEKETLPEFGEGEETGELVPGKSLVFAALELCLCILVRQLPRL 1711          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Yeast
Match: LAA1 (AP-1 accessory protein; colocalizes with clathrin to the late-Golgi apparatus; involved in TGN-endosome transport; physically interacts with AP-1; similar to the mammalian p200; may interact with ribosomes; YJL207C is a non-essential gene [Source:SGD;Acc:S000003743])

HSP 1 Score: 84.7297 bits (208), Expect = 8.933e-17
Identity = 91/347 (26.22%), Postives = 168/347 (48.41%), Query Frame = 3
Query: 2034 LSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDS-----------PQFLSSIEGLAVLRAWAEIYIVAVSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQ-YKTHWPVILCAASLWLADHSQNI--TIDDK-----VFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCI--IAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISE-NRTPKT 3008
            ++D+I  +F  +TV  + ++L GL  L  ++  ++ + +P+ P   ILEQ +AQ+ +AL PAF+ G+ P V + A  V +  +AS +      L R+ QLL++ L   ++ +S           P+    IE LAVL AWAE+   +++ SS   L +      + L   W  +L  Y ++      S      +  + SL +   T     +I+ Y+  W   + A    L    Q I  +++D+     +F++   C++A   +V    D ++K  +       L+  + CI  I E+ ++  E++ ++ R++ T D  +  L  +D +S +II  S+ N TP+T
Sbjct: 1357 IADLIKISFRGSTVRNEGMKLTGLHILNFVLKNYSTMRDPQVPGSSILEQQEAQITSALMPAFSKGSSPTVMSFAITVAAEVLASNIMPP-DKLGRISQLLIDLLGNFKDPNSGIRIGEAIIVTPKAKRKIE-LAVLDAWAEVVQRSIT-SSNDALFSFTRKYWSILVPLWIISLREYMMIKYNDNDSTVQVKNDSKENSLIEPRST-----KIELYEPVWLNFVEALGCTLDSDVQVILASLNDEELEYFLFILFSQCLEA---IVKNIDDHSVKMQVLPALHNVLKSNL-CIKSIFEDDIIT-EVVEIMDRLISTGDSKEEFL-LVDIISDLIIGYSKCNATPET 1689          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 516/1086 (47.51%), Postives = 674/1086 (62.06%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGK---------------SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFLS----SIEGLAVLRAWAEIYIVAVSNSSMRD-----------------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------ADHSQNIT----------------------IDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHL-----------QALDFLSQIIISISENRTPKTESSES-------TRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G +N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV++GSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL VL    +      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+ L+ G+L N NPILRCAAGE LGRMAQV+G+ +FIA MAQ SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD +S  VQ W+LH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGALITT+GPELQGNS  I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E   E+ E    + R   +N+                 S P   +I +      GLEG LF +LD E D KLCSD+ DT   +L S   E+L+ WL+L K+V+ A                 SE KDE  D +TM  G                  +D+  KP    RW T+VFAA+C  +++ +C  + DK  HF++ +AR+      + D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++     S Q  S    ++E LAVL+AWAE+Y+VA+      D                             L+ LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T D  +   Y++ W  +L A +LWL      A   Q+                        + DK+ L+LG+ ++ +C    ++  E +  CL A  T+   P ++  IAE+ L+ +EL+NV+HR+LLTRD   + L            A D L Q   +  +      + S++       T ++ +  KS V+A +E++V  L R++P L    K +SP+
Sbjct:  718 EGNFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLMGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYLRVLVGEAI------PGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALALVMGALDNPNPILRCAAGEALGRMAQVVGEVTFIARMAQTSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGSSHEVQTWALHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGALITTVGPELQGNSATISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLCSSHLLLRRAAVACLRQLAQRE-AAEVCEYAMSLARRAGDNKD----------------STPIKLNITET-----GLEGVLFGMLDRETDRKLCSDIHDTFGHMLSSLAVEKLSHWLKLCKDVLAATTDVGGAVPVKVEKDEDSEKKDEM-DDDTMFTG----------------LGEDEKSKPSVAPRWVTRVFAADCLCRIILLCENA-DKA-HFDLATARAGKGKNAKGDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFAAVPEPEFPGHVILEQYQANVGAALRPAFSPDTPSDITAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDKVQAGKGSSSQLYSESATTMEKLAVLKAWAEVYVVAMKVKKEADSKPAKVVRRGRGEEEDEEDLGADVLPPDSLITLVQPELPTLSRLWLAMLRDYALLTLPAEFSSQLPPEGGA----FYTPETIDTARH-HYRSSWAPVLHAVALWLNSTGFTAAEDQDEASPASFKPPNLPQVSTTKTFEELVKDKLHLMLGVSIEFLCFPRPEEPIEHVISCLHALCTLLETPCVKKHIAEDQLLAVELLNVLHRLLLTRDPPAVQLLVTAVVQETVRAAQDHLQQQRANTGKEEEESEKDSQANLGDGGETGEL-VPGKSLVYATMELLVFILVRHLPQLNSRVK-ESPS 1748          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 516/1086 (47.51%), Postives = 674/1086 (62.06%), Query Frame = 3
Query:  174 KGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGK---------------SETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLR--NEDSPQFLS----SIEGLAVLRAWAEIYIVAVSNSSMRD-----------------------------LMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWL------ADHSQNIT----------------------IDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHL-----------QALDFLSQIIISISENRTPKTESSES-------TRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPN 3143
            +G +N LLRELVAEFTLT+N +NTTTSLLRS+CH DDSV++GSWLQETDHK IEDQLQPNSASGSGALEHDP+++YL VL    +      P PLPLGV+VID+SV LFG++FP +  KHRLQ+L+HF+EC++QAK +RQQA Q+NIFTAVL A++ LAE KS+ G E  ++K A+ L+ G+L N NPILRCAAGE LGRMAQV+G+ +FIA MAQ SFD+LK+ RDV +RTG+SLALGCLHRYVG +GSGQHL TSV ILLALAQD +S  VQ W+LH+LALI DS GPM+  Y+E T++L+L+LLL  PPS  +VHQCLG+ LGALITT+GPELQGNS  I ++R SC V C+I+Q H DSLVQA A+SCLQQLHMFAP+HVNLS+L+P L   L S HLLLRRA VACLRQLAQ+E   E+ E    + R   +N+                 S P   +I +      GLEG LF +LD E D KLCSD+ DT   +L S   E+L+ WL+L K+V+ A                 SE KDE  D +TM  G                  +D+  KP    RW T+VFAA+C  +++ +C  + DK  HF++ +AR+      + D L+LHLSD+I  AF+AAT   ++LR+ GL AL+DII  FA V EPEFP  VILEQYQA VGAALRPAF+  T  ++TA AC+VCS+WI SGV  DL+DLRRVH LLV+SLDK++     S Q  S    ++E LAVL+AWAE+Y+VA+      D                             L+ LV+P L TLS  W   L  YA+L LP E S  L    GA    F + +T D  +   Y++ W  +L A +LWL      A   Q+                        + DK+ L+LG+ ++ +C    ++  E +  CL A  T+   P ++  IAE+ L+ +EL+NV+HR+LLTRD   + L            A D L Q   +  +      + S++       T ++ +  KS V+A +E++V  L R++P L    K +SP+
Sbjct:  749 EGNFNALLRELVAEFTLTDNSANTTTSLLRSLCHYDDSVLMGSWLQETDHKSIEDQLQPNSASGSGALEHDPSSIYLRVLVGEAI------PGPLPLGVSVIDASVALFGVVFPHVSFKHRLQMLDHFAECVKQAKGVRQQAVQLNIFTAVLSALKGLAENKSTLGPE-EVRKSALALVMGALDNPNPILRCAAGEALGRMAQVVGEVTFIARMAQTSFDKLKSARDVVSRTGHSLALGCLHRYVGGIGSGQHLKTSVSILLALAQDGSSHEVQTWALHSLALIVDSSGPMYRGYVEPTLSLVLTLLLTVPPSHTEVHQCLGRCLGALITTVGPELQGNSATISTIRSSCLVGCAIMQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPCLCVHLCSSHLLLRRAAVACLRQLAQRE-AAEVCEYAMSLARRAGDNKD----------------STPIKLNITET-----GLEGVLFGMLDRETDRKLCSDIHDTFGHMLSSLAVEKLSHWLKLCKDVLAATTDVGGAVPVKVEKDEDSEKKDEM-DDDTMFTG----------------LGEDEKSKPSVAPRWVTRVFAADCLCRIILLCENA-DK-AHFDLATARAGKGKNAKGDLLVLHLSDLIRMAFMAATDHSNQLRMAGLQALEDIIKKFAAVPEPEFPGHVILEQYQANVGAALRPAFSPDTPSDITAKACQVCSTWIGSGVVSDLNDLRRVHNLLVSSLDKVQAGKGSSSQLYSESATTMEKLAVLKAWAEVYVVAMKVKKEADSKPAKVVRRGRGEEEDEEDLGADVLPPDSLITLVQPELPTLSRLWLAMLRDYALLTLPAEFSSQLPPEGGA----FYTPETIDTARH-HYRSSWAPVLHAVALWLNSTGFTAAEDQDEASPASFKPPNLPQVSTTKTFEELVKDKLHLMLGVSIEFLCFPRPEEPIEHVISCLHALCTLLETPCVKKHIAEDQLLAVELLNVLHRLLLTRDPPAVQLLVTAVVQETVRAAQDHLQQQRANTGKEEEESEKDSQANLGDGGETGEL-VPGKSLVYATMELLVFILVRHLPQLNSRVK-ESPS 1779          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 2536.14 bits (6572), Expect = 0.000e+0
Identity = 1347/1371 (98.25%), Postives = 1352/1371 (98.61%), Query Frame = 3
Query:  135 VMLDSNRQKEIKRKGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFLSSIEGLAVLRAWAEIYIVAVSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVXXXXXXXXXXXXXXEVFSKSPNRIALERTKCSNDTSPWEERYQESIADCVIQFYENLNLCLKDSLLSTMNKERINIIXXXXXXXXKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRAXXXXXXXXXXXXXXXXXDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVXXXXXXXXXXXXXXGNPLGSINSKITENLKIPKIALKIDFSNFKQ 4247
            +MLDSNRQKEIKRKGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDP+ALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYLELTMNLILSLLLNTPPSLIDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHLLLRRAVVACLRQL+QKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARDDDFEDDDIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDS  F        VLRA        VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSES+RDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVLPSLLHLSNRLLQLEVFSKSPNRIALERTKCSNDTSPWEER+QESIADCVIQFYENLNLCLKDSLLSTMNKERINIISSSLLLLLKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRASILMMLIPLLISILLPIDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVAAKQAKIASQKSSAGNP GSINSKITENLKIPKIALKIDFSNFKQ
Sbjct:  696 IMLDSNRQKEIKRKGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPSALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYLELTMNLILSLLLNTPPSLIDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHLLLRRAVVACLRQLSQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARDDDFEDDDIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSLNFC------LVLRA--------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESSRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVLPSLLHLSNRLLQLEVFSKSPNRIALERTKCSNDTSPWEERFQESIADCVIQFYENLNLCLKDSLLSTMNKERINIISSSLLLLLKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRASILMMLIPLLISILLPIDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVAAKQAKIASQKSSAGNPFGSINSKITENLKIPKIALKIDFSNFKQ 2052          
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 2504.55 bits (6490), Expect = 0.000e+0
Identity = 1333/1356 (98.30%), Postives = 1337/1356 (98.60%), Query Frame = 3
Query:  180 TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYXXXXXXXXXXXXXXXXXXXXDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHXXXXXXXXXXXXXXXQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARXXXXXXXXIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFLSSIEGLAVLRAWAEIYIVAVSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESTRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVXXXXXXXXXXXXXXEVFSKSPNRIALERTKCSNDTSPWEERYQESIADCVIQFYENLNLCLKDSLLSTMNKERINIIXXXXXXXXKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRAXXXXXXXXXXXXXXXXXDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVXXXXXXXXXXXXXXGNPLGSINSKITENLKIPKIALKIDFSNFKQ 4247
            TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDP+ALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYLELTMNLILSLLLNTPPSLIDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHLLLRRAVVACLRQL+QKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARDDDFEDDDIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDS  F        VLRA        VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSES+RDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVLPSLLHLSNRLLQLEVFSKSPNRIALERTKCSNDTSPWEER+QESIADCVIQFYENLNLCLKDSLLSTMNKERINIISSSLLLLLKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRASILMMLIPLLISILLPIDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVAAKQAKIASQKSSAGNP GSINSKITENLKIPKIALKIDFSNFKQ
Sbjct:  697 TYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDSVILGSWLQETDHKEIEDQLQPNSASGSGALEHDPSALYLSVLSVCKVKGIVTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSLRQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNPILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLALGCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSGGPMFGNYLELTMNLILSLLLNTPPSLIDVHQCLGKVLGALITTLGPELQGNSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLSTLIPHLYEGLSSPHLLLRRAVVACLRQLSQKEDPKELGEVISHIIRDQSNNRKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDYKLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTMNAGGIARDDDFEDDDIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQMCSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDKLRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTGPEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSLNFC------LVLRA--------VSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYAILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASLWLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFLRPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISISENRTPKTESSESSRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDSPNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVLPSLLHLSNRLLQLEVFSKSPNRIALERTKCSNDTSPWEERFQESIADCVIQFYENLNLCLKDSLLSTMNKERINIISSSLLLLLKDDNAKHSAIPIYVVASIIKKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDDNVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVEVVHTDQRASILMMLIPLLISILLPIDSYTLSSINRNSLHNHSFQRINSIAPRYPTEFKNLLSAPHMSVLKIRLEVAAKQAKIASQKSSAGNPFGSINSKITENLKIPKIALKIDFSNFKQ 2038          
The following BLAST results are available for this feature:
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HEATR5B0.000e+047.61HEAT repeat containing 5B [Source:HGNC Symbol;Acc:... [more]
HEATR5A0.000e+041.38HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A0.000e+041.38HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A2.249e-12843.35HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A4.075e-3847.60HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
soap-12.761e-15434.12Sorting Of Apical Proteins [Source:UniProtKB/TrEM... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG27470.000e+043.29gene:FBgn0037541 transcript:FBtr0335229[more]
CG27470.000e+043.29gene:FBgn0037541 transcript:FBtr0300916[more]
CG27470.000e+043.29gene:FBgn0037541 transcript:FBtr0300917[more]
CG27470.000e+042.86gene:FBgn0037541 transcript:FBtr0335230[more]
CG27470.000e+042.86gene:FBgn0037541 transcript:FBtr0081818[more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b0.000e+048.85HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5b0.000e+055.89HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
BX465838.30.000e+038.29HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
heatr5a0.000e+037.03HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
heatr5a3.128e-17037.35HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b0.000e+046.81HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b0.000e+047.10HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b0.000e+047.10HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b0.000e+047.10HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b0.000e+045.21HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Heatr5b0.000e+047.80HEAT repeat containing 5B [Source:MGI Symbol;Acc:M... [more]
Heatr5a0.000e+040.34HEAT repeat containing 5A [Source:MGI Symbol;Acc:M... [more]
Heatr5a3.024e-5053.98HEAT repeat containing 5A [Source:MGI Symbol;Acc:M... [more]
Heatr5b5.669e-1428.42HEAT repeat containing 5B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A5F2|HTR5B_XENTR0.000e+046.81HEAT repeat-containing protein 5B OS=Xenopus tropi... [more]
sp|Q8C547|HTR5B_MOUSE0.000e+047.80HEAT repeat-containing protein 5B OS=Mus musculus ... [more]
sp|Q9P2D3|HTR5B_HUMAN0.000e+047.61HEAT repeat-containing protein 5B OS=Homo sapiens ... [more]
sp|Q86XA9|HTR5A_HUMAN0.000e+041.38HEAT repeat-containing protein 5A OS=Homo sapiens ... [more]
sp|Q5PRF0|HTR5A_MOUSE0.000e+040.34HEAT repeat-containing protein 5A OS=Mus musculus ... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TVV80.000e+052.19Uncharacterized protein OS=Capitella teleta OX=283... [more]
V4A0F30.000e+050.23Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3H0J50.000e+050.00HEAT repeat-containing protein 5B-like isoform X4 ... [more]
A0A1S3H0R30.000e+050.00HEAT repeat-containing protein 5B-like isoform X3 ... [more]
A0A0L8GGE60.000e+050.09Uncharacterized protein (Fragment) OS=Octopus bima... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b0.000e+047.46HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5a1.886e-17137.12HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
heatr5b0.000e+045.33HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LAA18.933e-1726.22AP-1 accessory protein; colocalizes with clathrin ... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b0.000e+047.51HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b0.000e+047.51HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HEAT repeat-containing protein 5B-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028228.10.000e+098.25SMESG000028228.1[more]
SMESG000028228.10.000e+098.30SMESG000028228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002690 ID=SMED30002690|Name=HEAT repeat-containing protein 5B-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4371bp
CGGCACCTCGGTTGAGAAACACTGCATTATGGTATTAATTCACTGGGAGT
TTTGTTGCGCTGAATAAATTTGTGTAAAAGAGGATGATGAGTATAGAGTA
GTAAAAATTTCATGGAGATATTTAATACGTTTTAGTAATGCTTGATTCAA
ACCGACAAAAGGAAATTAAACGCAAAGGCACTTACAATACATTACTGAGA
GAATTAGTCGCAGAATTTACTTTGACCGAGAATCCTTCAAATACTACGAC
GTCATTGTTGAGAAGCATGTGTCATGTTGATGACAGTGTCATTCTCGGTT
CATGGCTCCAGGAAACTGACCACAAAGAAATTGAAGATCAACTCCAACCA
AATAGTGCCAGTGGTTCAGGGGCGTTAGAACATGATCCTACGGCTCTTTA
CCTCAGCGTTTTATCCGTATGTAAAGTCAAAGGAATAGTAACGTATCCTT
CTCCTTTACCACTAGGAGTTGCTGTTATTGATTCTTCAGTTCAATTGTTT
GGCATACTTTTTCCAAAAATTCAATCTAAACATCGGCTTCAAATACTAGA
ACATTTTTCAGAATGTATTCGTCAAGCAAAATCACTCCGACAACAAGCAA
CTCAAATGAACATTTTTACAGCAGTCCTTTGTGCAATGCGGCGATTAGCT
GAAACTAAATCATCTTTTGGCAGTGAACACAATTTAAAGAAGGAAGCCGT
GACTCTAATTTTTGGTTCTCTGATAAATCAAAATCCAATTCTTCGATGTG
CCGCTGGAGAATGTCTTGGAAGAATGGCACAAGTTATTGGCGATAGCAGT
TTTATTGCCGAAATGGCACAATACAGTTTTGATCGGTTAAAAGCCGTTCG
TGATGTGACAAATCGAACTGGGTATTCTCTAGCTCTTGGTTGTCTTCATA
GATATGTTGGAAGTCTTGGTTCTGGACAGCATTTGAGTACAAGTGTTGGT
ATTTTATTGGCTTTGGCACAAGATACTAATTCACCTGTTGTACAAGTTTG
GTCGTTACACGCTTTGGCTCTTATTGCTGATTCCGGAGGACCAATGTTCG
GAAATTACTTAGAATTGACAATGAATTTGATTTTATCACTTTTATTAAAT
ACTCCTCCATCTTTAATTGATGTTCATCAATGTTTAGGTAAAGTTTTGGG
AGCTTTAATTACAACACTTGGTCCAGAACTACAAGGTAATTCTACGATGA
TCGTTAGTTTGCGAATGTCATGCACCGTTAGCTGTTCAATTTTACAAGGA
CATCCAGATTCTCTTGTTCAAGCGGAAGCGGTATCGTGTTTGCAACAATT
ACACATGTTCGCACCGAAACATGTCAATCTATCTACTTTGATTCCTCATC
TTTATGAAGGACTTTCTAGTCCACATTTATTGCTGAGAAGAGCTGTAGTT
GCGTGTTTGAGACAATTGGCTCAGAAAGAGGATCCTAAAGAATTGGGAGA
AGTGATCTCACACATTATACGTGATCAATCAAACAATAGAAAAGATGCTA
AGCAATCACAACGAAATCAATCTGTTGGAAAATCAGTCAGATCTGATCCA
ACTGCATCGGACATTCTTCAAGCTGCTTTATTGTCAAAAGGTTTAGAAGG
TGCATTATTTCAGTTGTTGGATTTTGAACAAGATTACAAGTTGTGTTCTG
ACCTGGAAGATACTCTTTTATGTCTATTGCAATCTCAAGGAGAAGAGCAA
TTAACAAAATGGTTGCAGTTATTAAAAGAAGTTATTCAAGCTGGTAAATC
TGAAACTAAGGATGAAAAAGGTGACAAAAATACAATGAACGCTGGTGGAA
TAGCTCGAGATGATGACTTTGAAGATGACGACATCAAATTTAGTGCAAAT
AAAGACGATTCTGTGAAGCCTTTTAATGGTTGTAGGTGGCCGACTAAAGT
GTTCGCTGCGGAATGTTTTAGGAAACTTCTCCAAATGTGTTCAACTTCAC
ATGATAAAGATCGTCATTTCAATATAATATCAGCCCGATCATTTATGACT
TCAACTGGTCGCAGTGATTGTTTGATTTTGCATTTATCGGACGTCATCAG
TTTCGCTTTCATTGCTGCCACTGTCGAAATAGATAAGTTGCGTTTATTTG
GCCTCGGTGCATTGCAAGATATAATTAATCTCTTTGCAAAAGTTTCAGAA
CCCGAGTTTCCAGATCAAGTCATACTCGAACAATATCAAGCCCAAGTTGG
TGCAGCCTTACGTCCTGCGTTTGCAATTGGAACTGGTCCAGAAGTTACAG
CAGCAGCTTGTGAAGTTTGCAGTAGTTGGATTGCTTCTGGAGTCGCCAGA
GATTTAAGTGACTTGAGAAGAGTTCATCAACTATTGGTTAATTCTCTAGA
CAAGTTACGTAATGAAGACTCTCCTCAATTTCTGTCTAGTATTGAGGGGT
TGGCAGTGTTGCGTGCATGGGCAGAAATATATATCGTAGCTGTTAGCAAT
AGCAGTATGCGAGATCTAATGAATTTAGTTGAACCCGTCCTAAATACGCT
ATCAAATCATTGGTGGCAGACATTGCATGCATATGCAATTTTAGCTCTCC
CTACTGAATTATCTGAAGCTTTGCAACATAGGAATGGAGCACAACAATCA
CTGTTTCAATCCTTAGATACTACAGATGACAATCAACAAATTCAATATAA
AACACATTGGCCCGTTATTCTTTGTGCTGCGTCTTTATGGCTCGCTGATC
ATTCCCAAAATATTACAATTGATGATAAAGTCTTTTTGATTTTAGGACTC
TGCATGGATGCAATGTGCGGTTTGGTATCTAAACAGACTGATGAAACTAT
TAAATATTGCTTGAAAGCTTGCAATACAATGTTTTTACGGCCGACCATTC
GTTGCATTATTGCTGAAAATCCATTGGTTCCCATCGAATTAATAAATGTT
ATTCATAGAATTCTTCTAACCAGAGATTGTGGTGATATCCATTTACAAGC
TCTGGATTTTCTCTCACAGATTATAATCTCTATTTCCGAAAATCGAACTC
CTAAAACGGAATCCTCTGAGTCGACCAGAGATGTGAAAATTTTGCTAAAA
TCTCCTGTATTTGCATGTTTGGAAATCGTTGTTTGTGGTCTCACTCGATA
TGTACCTCATTTGTTAGATGATTTCAAAATTGATTCCCCCAACAGCAAAA
GAACAACTGTGCTGCCTTTGGTGGTATCGAATAATCATCAAAAATCACTA
AATGTTATTTGTCAATTAATTAATGCCATGTCTAATTTATTGAAATTAAT
TGAAATAGAATTAATTGATGCCGTTTTGCCGTCACTTTTGCATTTGTCTA
ATCGCTTGCTCCAGCTTGAAGTATTTTCTAAAAGTCCAAATCGTATTGCA
TTGGAGCGCACTAAATGCTCAAACGATACATCGCCATGGGAAGAAAGATA
TCAGGAAAGTATTGCTGACTGTGTTATTCAATTCTATGAAAATTTGAATC
TGTGTCTAAAAGATTCTTTACTCTCAACTATGAATAAAGAAAGAATCAAC
ATAATTTCTTCGAGTTTACTCCTGCTTTTAAAAGACGATAACGCTAAACA
TTCCGCAATTCCTATTTATGTCGTCGCGTCAATTATTAAAAAAATGTCGG
TGAACGTTTTGAAATTTAATCAGTATTTACTACAAATAATTGTGGAGTGT
TGCCAAGCGTTATGGCATCAATTGACAGATACAAACAAGATCCCCCTTGT
TCAATCGATCACAAATTTAGTTTCTCTTTCAGATGACAATGTTGTCAGAT
ATTTCGCTAGAAATCTCTCGGAACTTATAATTATCTGGCTTTTCAAACTG
CCAGAAAATTTGGAGCAGAATGAATTGAGTCAAGATACGGTGAAATTATT
TTGCATGGCTACTGATTTCTTTGAGATTCTCGTTGAAGTTGTCCATACCG
ACCAGAGGGCCTCAATATTGATGATGCTTATTCCTTTACTTATAAGTATT
TTACTTCCAATTGATAGTTACACTTTATCGTCAATAAATCGTAATTCTTT
ACATAATCATTCATTCCAAAGAATAAACAGTATTGCACCAAGATATCCAA
CTGAATTTAAAAATTTGCTTTCGGCTCCTCATATGTCAGTGCTGAAAATT
CGACTGGAAGTCGCTGCTAAACAGGCCAAAATCGCCAGTCAAAAGTCGTC
AGCTGGCAACCCATTGGGGTCTATTAACTCAAAAATAACTGAAAATTTAA
AAATTCCTAAAATTGCACTTAAAATCGATTTCAGCAATTTTAAACAATGA
TAATAATAATAATTTGTATGGTAAGCTGAAATGTGAACGCATAAGGATTT
ATTATCACATTCACGGATTTTATTATTCAAACTTGAATTTTGTGATCATT
TCATTCGTGATAATTTGTTGT
back to top

protein sequence of SMED30002690-orf-1

>SMED30002690-orf-1 ID=SMED30002690-orf-1|Name=SMED30002690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1371bp
MLDSNRQKEIKRKGTYNTLLRELVAEFTLTENPSNTTTSLLRSMCHVDDS
VILGSWLQETDHKEIEDQLQPNSASGSGALEHDPTALYLSVLSVCKVKGI
VTYPSPLPLGVAVIDSSVQLFGILFPKIQSKHRLQILEHFSECIRQAKSL
RQQATQMNIFTAVLCAMRRLAETKSSFGSEHNLKKEAVTLIFGSLINQNP
ILRCAAGECLGRMAQVIGDSSFIAEMAQYSFDRLKAVRDVTNRTGYSLAL
GCLHRYVGSLGSGQHLSTSVGILLALAQDTNSPVVQVWSLHALALIADSG
GPMFGNYLELTMNLILSLLLNTPPSLIDVHQCLGKVLGALITTLGPELQG
NSTMIVSLRMSCTVSCSILQGHPDSLVQAEAVSCLQQLHMFAPKHVNLST
LIPHLYEGLSSPHLLLRRAVVACLRQLAQKEDPKELGEVISHIIRDQSNN
RKDAKQSQRNQSVGKSVRSDPTASDILQAALLSKGLEGALFQLLDFEQDY
KLCSDLEDTLLCLLQSQGEEQLTKWLQLLKEVIQAGKSETKDEKGDKNTM
NAGGIARDDDFEDDDIKFSANKDDSVKPFNGCRWPTKVFAAECFRKLLQM
CSTSHDKDRHFNIISARSFMTSTGRSDCLILHLSDVISFAFIAATVEIDK
LRLFGLGALQDIINLFAKVSEPEFPDQVILEQYQAQVGAALRPAFAIGTG
PEVTAAACEVCSSWIASGVARDLSDLRRVHQLLVNSLDKLRNEDSPQFLS
SIEGLAVLRAWAEIYIVAVSNSSMRDLMNLVEPVLNTLSNHWWQTLHAYA
ILALPTELSEALQHRNGAQQSLFQSLDTTDDNQQIQYKTHWPVILCAASL
WLADHSQNITIDDKVFLILGLCMDAMCGLVSKQTDETIKYCLKACNTMFL
RPTIRCIIAENPLVPIELINVIHRILLTRDCGDIHLQALDFLSQIIISIS
ENRTPKTESSESTRDVKILLKSPVFACLEIVVCGLTRYVPHLLDDFKIDS
PNSKRTTVLPLVVSNNHQKSLNVICQLINAMSNLLKLIEIELIDAVLPSL
LHLSNRLLQLEVFSKSPNRIALERTKCSNDTSPWEERYQESIADCVIQFY
ENLNLCLKDSLLSTMNKERINIISSSLLLLLKDDNAKHSAIPIYVVASII
KKMSVNVLKFNQYLLQIIVECCQALWHQLTDTNKIPLVQSITNLVSLSDD
NVVRYFARNLSELIIIWLFKLPENLEQNELSQDTVKLFCMATDFFEILVE
VVHTDQRASILMMLIPLLISILLPIDSYTLSSINRNSLHNHSFQRINSIA
PRYPTEFKNLLSAPHMSVLKIRLEVAAKQAKIASQKSSAGNPLGSINSKI
TENLKIPKIALKIDFSNFKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0016020membrane
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding