Coiled-coil domain-containing protein 89

Overview
NameCoiled-coil domain-containing protein 89
Smed IDSMED30002673
Length (bp)1133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain-containing protein 89 (SMED30002673) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 89 (SMED30002673) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain-containing protein 89 (SMED30002673) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain-containing protein 89 (SMED30002673) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002673

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002673SMESG000017325.1 dd_Smed_v4_12263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002673SMESG000017325.1 dd_Smed_v4_12263_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002673SMESG000017325.1 Contig13118newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002673SMESG000017325.1 Contig13118uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002673SMESG000017325.1 dd_Smed_v4_12263_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30002673SMESG000017325.1 dd_Smed_v4_12263_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002673SMESG000017325.1 dd_Smed_v4_41_2_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Human
Match: CCDC89 (coiled-coil domain containing 89 [Source:HGNC Symbol;Acc:HGNC:26762])

HSP 1 Score: 65.855 bits (159), Expect = 2.699e-11
Identity = 86/343 (25.07%), Postives = 174/343 (50.73%), Query Frame = 1
Query:  127 EVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTH-------DEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQ------LEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKL-KSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLT-KKSKTYESLYRELK-----------------EKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            E++ +RE L  L  L++E+++ +++L++RIEEQS LI +LK+R+DE L RCQ+L+  N ELE ++    EK K+  + SR +   F  L   H       DE K E   ++  NEKL+ E + L       ++ LK++        ++ ++T R   L  EL+   E+ +++  Q Q      LE+   +        + +Q  + ++  + +    +E++ K++ + S     ++ ++L+ +   V +  EE++ L+ ++ K  ++   E+                  E++++E+  ++ N ++++L+  +   +  + ELR   EA+K +S  LL  E+E
Sbjct:   41 ELDGLREALANLRGLSEEERSEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQEAEKLKAQGEYSRKLEERFMTLAANHELMLRFKDEYKSENIKLREENEKLRLENSSL------FSQALKDEEA------KVLQLTVRCEALTGELETLKERCAQDACQAQAREKELLELQSQQACTHT--KETEQLRSQLQTLKQQHQQAVEQIAKAEETHS-----SLSQELQARLQTVTREKEELLQLSIERGKVLQNKQAEICQLEEKLEIANEDRKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDELRLQSEAFKKHSLDLLSKERE 364          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Zebrafish
Match: zgc:172182 (zgc:172182 [Source:NCBI gene;Acc:100136847])

HSP 1 Score: 90.1225 bits (222), Expect = 1.122e-19
Identity = 101/338 (29.88%), Postives = 193/338 (57.10%), Query Frame = 1
Query:  115 TGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELE-----TQLTIATEKSKSD--EKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSE--------IVSMTENLKNQSTMEAVNEELTKMTQRNSELELELK-IFNEKRSKEI-LQNQLEIDKNREI---VDFLKS-DIKQKETDIKDYRMKSDS--VIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            T QD ++ + + LEKL +L+ E++T   +L++RI+EQS LI +LK+RADE LLRCQ L+K N ELE      Q+ +  E+ KS+  E++   +  N  +L+   +E K +   +++ NE+L+ E   L SE        I+ +T+ LK+ +    + E   +  ++ +  +++LK + N  R KE  L+N+L  D  +++   V+     D+K ++T +K+   ++D+   +EKL  +     +E+ ++  Q   +  I++    EI +L +K +  E+  R  +++++KE+  +N   ++++L+  L+  E    EL++++EA K +S +LL+ EKE
Sbjct:   18 TKQD-MDDVHQALEKLRSLSQEERTEAEVLRSRIDEQSTLICILKRRADEMLLRCQALEKINAELENLRANVQVELENERKKSELLEQRFMDLASNHRELINFKNEYKSQNAKLEKENERLQKENEALFSEEVQEKEETILKLTQELKDLAEQHKILE--NEYQEKTTGFQIKLKELMNLHRIKEASLKNELS-DTQKQLKTAVEMCAELDLKLRQTQVKESMRETDTQERLEKLIKEK----DELIDLSVQ---RGKIIRDKQVEIQELERKRQEAENGRRHAEDRFEKEAAAVNSELRVKELREALERAEFSCNELKKEFEALKKHSCELLEKEKE 344          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Zebrafish
Match: zgc:172182 (zgc:172182 [Source:NCBI gene;Acc:100136847])

HSP 1 Score: 88.9669 bits (219), Expect = 2.330e-19
Identity = 98/326 (30.06%), Postives = 186/326 (57.06%), Query Frame = 1
Query:  151 LEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELE-----TQLTIATEKSKSD--EKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSE--------IVSMTENLKNQSTMEAVNEELTKMTQRNSELELELK-IFNEKRSKEI-LQNQLEIDKNREI---VDFLKS-DIKQKETDIKDYRMKSDS--VIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            LEKL +L+ E++T   +L++RI+EQS LI +LK+RADE LLRCQ L+K N ELE      Q+ +  E+ KS+  E++   +  N  +L+   +E K +   +++ NE+L+ E   L SE        I+ +T+ LK+ +    + E   +  ++ +  +++LK + N  R KE  L+N+L  D  +++   V+     D+K ++T +K+   ++D+   +EKL  +     +E+ ++  Q   +  I++    EI +L +K +  E+  R  +++++KE+  +N   ++++L+  L+  E    EL++++EA K +S +LL+ EKE
Sbjct:    9 LEKLRSLSQEERTEAEVLRSRIDEQSTLICILKRRADEMLLRCQALEKINAELENLRANVQVELENERKKSELLEQRFMDLASNHRELINFKNEYKSQNAKLEKENERLQKENEALFSEEVQEKEETILKLTQELKDLAEQHKILE--NEYQEKTTGFQIKLKELMNLHRIKEASLKNELS-DTQKQLKTAVEMCAELDLKLRQTQVKESMRETDTQERLEKLIKEK----DELIDLSVQ---RGKIIRDKQVEIQELERKRQEAENGRRHAEDRFEKEAAAVNSELRVKELREALERAEFSCNELKKEFEALKKHSCELLEKEKE 324          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Xenopus
Match: ENSXETT00000027930.1 (coiled-coil domain containing 89 [Source:NCBI gene;Acc:100485641])

HSP 1 Score: 69.3218 bits (168), Expect = 1.719e-12
Identity = 78/332 (23.49%), Postives = 170/332 (51.20%), Query Frame = 1
Query:  115 TGQDEVNKMRENLE---KLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLK----SEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELEL------KIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQL----EVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
             G++  N+  + L    +L+ L  ++K    +L++R++EQS LI MLK+RADE  L+ Q L++ N+EL  Q   A  + +++ ++   +   F  L   H ++    +  K+ N++L+ +C++L+     +++   + ++         E      + +S  +L+L      ++  EKR+       LE+      +    S+  + E + K  R++     EK+++D  +   E+K  K++L      +   +++   E  +L+ + +  E   ++ +E+YQ++   ++ ++++ +L++ L+  E  F +LR+D+EAYK +S  LL  E+E
Sbjct:    2 PGEEGANRGGDGLPALKQLHKLPWDEKMENEMLRSRLDEQSQLICMLKQRADETQLKWQQLERVNEELGKQSREAARRLQAERERGERLEERFAILAANHQQIIRFKDEYKQQNQELREQCDRLRESEHPQLLHRDQCIRELRAQLGATEARLIEQEASSGRKLDLLRAEVQRLQEEKRT-----GGLELASLSHSIKV--SEESRHEAEEKLARLEEIKKAEKVEADKRL--EELKKEKQELLNLCMERGRTLQERQREAAELSVRLREAEKSLKKAEERYQRDRAAVDADARVSELQSKLEDGENHFEQLRRDFEAYKKHSGDLLAKERE 324          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Mouse
Match: Ccdc89 (coiled-coil domain containing 89 [Source:MGI Symbol;Acc:MGI:1917304])

HSP 1 Score: 67.0106 bits (162), Expect = 8.645e-12
Identity = 90/339 (26.55%), Postives = 179/339 (52.80%), Query Frame = 1
Query:  118 GQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENV-KRINEKLKTECNQLKSEIVSM-TENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEID-----KNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLT-KKSKTYESLYRELK-----------------EKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            G  E++ +RE L  L  L++E+K  +++L++RI+EQS LI +LK+R+DE L RCQ+L+  N ELE +     EK K+  +  + +  +F  L   H++M + F++  K  N KLK E  +L+ E  S+ ++ LK+Q   EA   ELT +   N  L  EL++  ++ + E  Q Q   +     +N++  D  K + ++  + ++  + +     E++  +   +     N+ ++L+ +   V +  EE++ L+ ++ K  ++   E++                 E++++E+  ++ N ++++L+  +   +  + ELR   EA+K +S  LL  E+E
Sbjct:   34 GFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRLQEMEKLKAQSEHIQKLENHFMILASNHEQM-IRFKDAHKSENVKLKEENARLRQENNSLFSQALKDQ---EAKVLELTTL---NKALVEELEVLKQRCAHEASQAQAREEELLGLQNQQACDHAK-ETEELRSQLQSIKQQHQQATEQMGKEQEANL----NLNQELQARLQTVLREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRRVDGIQKAYDELRLQSEAFKKHSLDLLSKERE 360          
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Match: sp|A8WG43|CCD89_DANRE (Coiled-coil domain-containing protein 89 OS=Danio rerio OX=7955 GN=ccdc89 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.140e-20
Identity = 101/338 (29.88%), Postives = 194/338 (57.40%), Query Frame = 1
Query:  115 TGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELE-----TQLTIATEKSKSD--EKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSE--------IVSMTENLKNQSTMEAVNEELTKMTQRNSELELELK-IFNEKRSKEI-LQNQLEIDKNREI---VDFLKS-DIKQKETDIKDYRMKSDS--VIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            T QD ++ + + LEKL +L+ E++T   +L++RI+EQS LI +LK+RADE LLRCQ L+K N ELE      Q+ +  E+ KS+  E++   +  N  +L+   +E K +   +++ NE+L+ E   L SE        I+ +T+ LK+ +    + E   +  ++ +  +++LK + N  R KE  L+N+L  D  +++   V+     D+K ++T +K+   ++D+   +EKL  +     +E+ ++  Q   +  I++    EI +L +K +  E+  R  +++++KE+  +N   ++++L+  L+  E    EL++++EA+K +S +LL+ EKE
Sbjct:   18 TKQD-MDDVHQALEKLRSLSQEERTEAEVLRSRIDEQSTLICILKRRADEMLLRCQALEKINAELENLRANVQVELENERKKSELLEQRFMDLASNHRELINFKNEYKSQNAKLEKENERLRKENEALFSEEVQEKEETILKLTQELKDLAEQHKILE--NEYQEKTTGFQIKLKELMNLHRIKEASLKNELS-DTQKQLKTAVEMCAELDLKLRQTQVKESMRETDTQERLEKLIKEK----DELIDLSVQ---RGKIIRDKQVEIQELERKRQEAENGRRHAEDRFEKEAAAVNSELRVKELREALERAEFSCNELKKEFEAFKKHSCELLEKEKE 344          
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Match: sp|Q7ZW57|CCD89_XENLA (Coiled-coil domain-containing protein 89 OS=Xenopus laevis OX=8355 GN=ccdc89 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 4.020e-13
Identity = 88/335 (26.27%), Postives = 165/335 (49.25%), Query Frame = 1
Query:  118 GQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQN---QLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLT-KKSKTYESLYRE-----------------LKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            G++ V +  ++L++L+ L  ++KT   +L++R++EQS LI MLK+RADE  ++ Q L++ N ELE Q   A ++ +S+ ++   +   F  L   H +M    +  K+ NE+L+  C+ ++       E L     ++ + ++L     R  E E+     N  R  + L     QLE +K    ++    D+  +    ++ R ++    EKL     I   E     K+LE     +KK  +E+++L  ++ +T +   RE                  +E YQ++   ++ + ++  L+  L+  E +F +LR+D+EAYK +S  LL  E+E
Sbjct:    6 GENRVGEGIQSLKQLHALPWDEKTENEMLRSRLDEQSQLICMLKQRADETQIKWQHLERVNGELERQSGEAAQRFQSERERGERLEERFAILASNHQQMIRFKDEYKQQNEELRQLCDTMRE--SKYPELLHRDRCIQELRDQLGDTETRLKEQEM-----NYGRKLDTLSAKVEQLEGEKRTGSLEL--GDLTHRLKVSEETRHEAQ---EKLARLEEIKKAEKAEADKRLEE----IKKEKQELLNLCMERGRTLQDRQREAAELSVRLQEAQKSLEKAEESYQRDKAAVDADIRVSDLQRKLEDGENQFEQLRRDFEAYKKHSGDLLTKERE 324          
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Match: sp|B2RZ86|CCD89_RAT (Coiled-coil domain-containing protein 89 OS=Rattus norvegicus OX=10116 GN=Ccdc89 PE=2 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 2.177e-12
Identity = 87/346 (25.14%), Postives = 173/346 (50.00%), Query Frame = 1
Query:  118 GQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQV--------LDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTEN--LKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKE----ILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLT-KKSKTYESLYRELK-----------------EKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            G  E++ +RE L  L  L++E+K  +++L++RI+EQS LI +LK+R+DE L RCQ+         +K  +E+E ++ +  E+ +  E +   +  N   +++  DE K E   +K  NEKL+ E N L S+ +   EN  L+  +  +A+ EEL  + QR +          + R++E     LQNQ   +  +E         +Q  + ++  + +     E++  D   +     NM ++L+ +   V +  EE++ L+ ++ K  ++   E++                 E++++E+  ++ N ++++L+  +   +  + +LR   EA+K +S  LL  E+E
Sbjct:   34 GFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRMQEME-KMKVQNEQVQKLESRFMTLAANHELMIRFKDEHKSENIKLKEENEKLRQENNSLFSQALKDQENKVLQLTAHNKALVEELEVLKQRCAH------EAGQARAREEELLALQNQQACEHAKE--------TEQLRSQLQSIKQQHRQATEQMGKDQEANI----NMNQELQARLHTVMREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDDLRLQSEAFKKHSLDLLSKERE 360          
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Match: sp|Q29RS0|CCD89_BOVIN (Coiled-coil domain-containing protein 89 OS=Bos taurus OX=9913 GN=CCDC89 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.041e-11
Identity = 86/342 (25.15%), Postives = 167/342 (48.83%), Query Frame = 1
Query:  118 GQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTH-------DEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDF--LKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQ-LEVQFSIVKKNNEEII------------------DLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            G  E++ +RE L  L  L++EDK+  ++L +RI+EQS LI +LK+R+DE L RCQ L+  N ELE +  +  E+ K+  ++++ +   F  L   H       DE K +   ++  NEKL+ E +QL S              ++A   ++ ++T ++  L  EL+    K + ++ Q Q    + +E+++    ++    +ET+    +++S    ++     +  A +  + + Q L  +   V +  EE++                   L +K K  +   R   E++++E+  +N N ++++L+  +   +  + ELR   EA+K +S  LL  E+E
Sbjct:   34 GFKELDGLREALANLRGLSEEDKSERAMLCSRIQEQSQLICILKRRSDEALERCQTLELLNTELEEKRLLEAEELKAKNQQAQKLEERFMTLASNHELMIRFKDEHKRQNAKLREENEKLRLENDQLFS------------PALKAQEAKVVQLTAQSEALAKELETLQRKYAHDVCQAQA---REQELLELQNRQACAHTEETEQLRMQLQSLQQQQQEALQQTAKAEQAHSQQNQELRARLQTVTREKEELLLLSMERGRVLQNKQAEIRQLEEKLKMADVARRHALERFEQEAVAVNSNLRVRELQRRVDGIQAAYDELRLQSEAFKKHSLDLLSKERE 360          
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Match: sp|Q9DA73|CCD89_MOUSE (Coiled-coil domain-containing protein 89 OS=Mus musculus OX=10090 GN=Ccdc89 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 6.047e-11
Identity = 90/339 (26.55%), Postives = 179/339 (52.80%), Query Frame = 1
Query:  118 GQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENV-KRINEKLKTECNQLKSEIVSM-TENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEID-----KNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLT-KKSKTYESLYRELK-----------------EKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            G  E++ +RE L  L  L++E+K  +++L++RI+EQS LI +LK+R+DE L RCQ+L+  N ELE +     EK K+  +  + +  +F  L   H++M + F++  K  N KLK E  +L+ E  S+ ++ LK+Q   EA   ELT +   N  L  EL++  ++ + E  Q Q   +     +N++  D  K + ++  + ++  + +     E++  +   +     N+ ++L+ +   V +  EE++ L+ ++ K  ++   E++                 E++++E+  ++ N ++++L+  +   +  + ELR   EA+K +S  LL  E+E
Sbjct:   34 GFKEMDGLREALANLRGLSEEEKGEKAMLRSRIQEQSQLICILKRRSDEALERCQILELLNSELEEKRLQEMEKLKAQSEHIQKLENHFMILASNHEQM-IRFKDAHKSENVKLKEENARLRQENNSLFSQALKDQ---EAKVLELTTL---NKALVEELEVLKQRCAHEASQAQAREEELLGLQNQQACDHAK-ETEELRSQLQSIKQQHQQATEQMGKEQEANL----NLNQELQARLQTVLREKEELLQLSMERGKVLQNKQAEIRQLEEKLETAAMAKKHALERFEQEAVAVDSNLRVRELQRRVDGIQKAYDELRLQSEAFKKHSLDLLSKERE 360          
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Match: A0A2T7PAB8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_09623 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.130e-20
Identity = 97/338 (28.70%), Postives = 184/338 (54.44%), Query Frame = 1
Query:  115 TGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFEN-VKRINEKLKTECNQLKSEIVSMTENL--KNQSTMEAVNEELTKMTQRNSELELELKIFNE--KRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIID------------------LTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            + QD + +++++L KL  L ++DKT  ++L++RI+EQS LIM+LK RADE LLR Q LDK NKEL      + +  K++ +K  I+   F  L   H+EM ++ +N  KR+N++L+ E  +LK+E   M   +     + ++ +  +   M ++N  LE++L+   +  +  +E L+ QL+     ++ +   + IK  +  ++D   +      KL+      A     ++++L+ +   + K  +E+++                  LTKK +  E L + ++ K+  E+  +N N Q+QKLK +L   E K+ ++++++ A+K +S +LL+ EKE
Sbjct:   18 SSQD-IQEIQDSLAKLRALKEDDKTEAAMLRSRIDEQSRLIMILKHRADEELLRAQALDKVNKELTELKEHSDDVLKNEMRKYNILDSRFGNLASNHEEM-IKIKNEYKRVNQELREENARLKNENSRMFSKVVQDKDAKIQELENKFAIMKEQNGSLEIKLRQLQQEYRDREETLKQQLQ-----KVTEKAGAQIKDLQHHLQDSEERLKGANHKLQVQQESRA----YLEQELQSKVGTLTKERDELLELSMQRGKLIQKEQAENKRLTKKVEEAEKLVKSMQIKFDCEAAAVNANLQVQKLKEELTETEAKYADMQKEFAAFKKHSGELLRQEKE 344          
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Match: K1QSD1 (Coiled-coil domain-containing protein 89 (Fragment) OS=Crassostrea gigas OX=29159 GN=CGI_10008129 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.233e-19
Identity = 102/336 (30.36%), Postives = 180/336 (53.57%), Query Frame = 1
Query:  127 EVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTEN--LKNQSTMEAVNEELTKMTQRNSELEL-ELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQ-LEVQF---SIVKKNNEEIIDLT------------------KKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            +V  M+ NL+KL NL+++DK   ++L++RI+EQ  LIM+LK+RAD+   +   L++ NKEL      A E   ++ +K+ ++   F +L   H EM    +  KR N+ L+ E ++L+ E   +     ++    +  + ++L  M ++NS  EL + +   + R+KE  + Q E+D+ +E          Q  TD+K    K     E+LK  N    N++++ +   LE Q    S+VK+ + E++DL                   KK +  E   R +++K+++E+  +N N Q++KL+ +L   E + +E+ +D+EA+K YSN LLQ EKE
Sbjct:    1 DVEDMKSNLDKLKNLSEDDKKENAMLRSRIDEQCQLIMILKQRADDVQGKTSTLERINKELIEFRGNAQEMLNAEIRKNTLLEKRFDELASNHQEMIKIKDEYKRSNQDLRLENSRLRDENARLFSGAIVEKDQLIADLEKKLASMKEQNSSQELRQRQSIQDLRAKE-QELQREVDRLQE----------QYRTDLKALTSKLQDTEERLKGANYKLQNQMEDKRSADLESQTKLQSLVKEKD-ELLDLAMQRGKIIQKEQTENKRLQKKVEEMEKSVRSMEDKFEREAATVNSNLQVRKLRDELSSAETRCQEVMRDFEAFKKYSNTLLQKEKE 324          
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Match: A0A2C9JZ21 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073657 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.641e-19
Identity = 98/326 (30.06%), Postives = 184/326 (56.44%), Query Frame = 1
Query:  139 MRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKEL-----ETQLTIATEKSKSDEKKSRI--VYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENL-----KNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLK------SDNSISANEIKNMKKQLEVQFS-IVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            M++NL KL  LT++DK   + L++RI+EQ  LIM+LK+RADE  +RCQ L+K NKEL     +T+  + +E  K D   +R   +  N  +++Q  DE K   + ++  N +LK E  +L S+ ++  +N      K  STM   +E++  + Q+  + ++E +   E   +E+ ++Q     + + V  L+S +K  E   KD   +  S+++K +      SD  + AN+ K     L +Q   +++K  EE  DL  K +  +   +++++++ +E+E +N N ++++L  +L+  + K+ ++ ++YEA+K +S++LL  EKE
Sbjct:   26 MQKNLMKLKQLTEDDKMENTKLRSRIDEQCQLIMILKQRADEGTIRCQTLEKINKELLDFREQTEAMLKSEIKKYDVLDTRFNQLASNHEEMIQIKDEYKRVNQELREDNARLKDENGRLFSKTIAEKDNKIQELEKKCSTM---SEQIVTLEQKLRQNQVEWRAKEEAMRQELSEHQT---ISSQQVKNLQSLLKTTEDKFKDTEQRLQSIMDKKRNMQDEVSDKLMKANKEKEELLALVMQRGKLIQKEQEENKDLKNKIEEMKKAVKKMEDRFNREAEAVNTNLKVKRLAEELEGADSKYTQMMKEYEAFKKHSSELLLREKE 345          
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Match: W5MN84 (Zgc:172182 OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.057e-16
Identity = 96/331 (29.00%), Postives = 176/331 (53.17%), Query Frame = 1
Query:  127 EVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELET-----QLTIATEKSKSDEKKSRI--VYGNFTKLVQTHDEMKMEFENVKRINEKLKTE-----CNQLKSE---IVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISA-----NEIKNMKKQLEVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            E++ +   LEKL  L+ +DKT  +LL++RI+EQS LI +LK+RADE LLRCQ L++ N ELET        +  E+ +S + + R   +  N  +L+   DE K +   +K  NE+L+ E     C +L+ +   I+ +T+ LK+ +    + E   K      + +L+  I   +  +  LQ +L+ D  +++ D +  ++   E D++  R      +E+ +    + A     +E+ ++  Q   +  I++   +EI +L +K +  E      +E+++KE+  +  N ++Q L+  L   E  + +L++D+EAYK +S+ LL  EKE
Sbjct:   21 EMDDVHTALEKLRGLSQDDKTESALLRSRIDEQSSLICILKQRADEMLLRCQALERINSELETLREDVHKELENERKRSSQLEQRFLDLAANHQELINFKDEYKRQNAELKEENERLQQENENLFCKELQEKEEVILQLTQELKDLAEQHKILEAEYKEKTNGFQTKLKELIITHQTKEASLQGELQ-DTQKQLKDAV--EMCTVELDLQLRRAMEKDALEESQLQQKLEALVKEKDELLDLSMQ---RGRIIQDKQKEIQELEEKREEAEKARATAEERFEKEAAAVEANLKVQDLQRCLDESEQSYNDLKKDFEAYKKHSSDLLAKEKE 345          
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Match: A0A210PU83 (Coiled-coil domain-containing protein 89 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19693 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.150e-16
Identity = 98/343 (28.57%), Postives = 173/343 (50.44%), Query Frame = 1
Query:  127 EVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIV-------DFLKSDIK----QKETDIKDYRMKSDSVIEKLKSDN---SISANEIKNMKKQLEVQFSIVKKNNEEIIDLT------------------KKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            +++ M+ NL KL  L+ +DKT +++L++RI+EQS LIM+LK+R+DE   + + +D+ N+EL +    +      + +K  I+   F  L   H EM    +  KR N  L+ E ++L+       EN +  S   A  EE        SELE +L    E+       N LE  +NR I        + L+ DI+    Q + D+K  + K     E+LKS N      A+  K++  + +++   + K  +E++DL                   ++    E   R ++EK+++E+  +N N Q+++L+ DL+   V+ +E + ++EAYK ++N LLQ E++
Sbjct:   30 DMSDMQNNLSKLKGLSADDKTEKAMLRSRIDEQSQLIMILKQRSDEVASKTKSVDRINEELISFRDSSKGMLDGEIRKYNILNARFDDLASNHQEMIKIKDEYKRANRDLREENSRLRD------ENARIFSGAIAEKEEQI------SELEKKLGGLKEQ------CNTLE-HRNRHITQEFRMKEEALQGDIRTLQEQYKKDVKSLQAKLQEAEERLKSANYKLQNQADSKKSIDAETQLKIQQLTKEKDELLDLAMQRGKIVHKEQTENKKLQQRIGEMEKAVRNMEEKFEREAAAVNSNLQVRRLREDLEDSSVRNKERQSEFEAYKKHTNALLQRERD 353          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Cavefish
Match: zgc:172182 (coiled-coil domain containing 89 [Source:NCBI gene;Acc:103044093])

HSP 1 Score: 73.9442 bits (180), Expect = 2.849e-14
Identity = 97/343 (28.28%), Postives = 182/343 (53.06%), Query Frame = 1
Query:  106 IFHTGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELE-----TQLTIATEKSKSDEKKSRI--VYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRS------KEILQNQLEIDKNREIVDFLKSDIKQ--------KETDIKDYRMKSDSVIEKLKSDNSISANEI---KNMKKQLEVQFS-IVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            I  T QD ++ + + LEKL  L+ E+++ + +L++RI+EQS LI +LK+RADE LLRCQ L++ N ELE      Q  +  E  +S++ + R   +  N  +L+   DE K +   + + N++L+ E  +L S+ +   E      T+  + +EL ++ +++  LE   K + +K +      KE++   L   K   + D L +  KQ         E D+K  R+  +  + K +S+N      +   KN   +L +Q   I++   EEI +L K  +  E+  ++ + ++++E+  ++   ++++L+  L   E K+  L + +EA+K +S+ LL+ EKE
Sbjct:   15 IIDTKQD-MDDVHQALEKLRGLSQEERSEDEMLRSRIDEQSGLICILKQRADEMLLRCQALERINAELEKLQADVQTELENEHQRSEQLEQRFMDLAANHRELINFKDEYKRQNAELLKENQRLREENEKLFSKELEEKE-----ETILKLTQELRELAEQHRHLE---KEYQDKTTGFQMKIKELM--NLHQIKEASLQDELHNTQKQLKNAVEMCAEMDLK-LRLSHERGMTK-ESENQEKLEALMREKNDLLKLSMQRGKIIQDKQEEIQELEKMKQEAENARQDAESRFEREAAAVDGELRVKELQHALDQAEEKYSSLEKVFEAFKKHSSDLLRNEKE 344          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Sea Lamprey
Match: zgc:172182 (zgc:172182 [Source:NCBI gene;Acc:100136847])

HSP 1 Score: 59.3066 bits (142), Expect = 3.105e-10
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  178 EDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEM 414
            ED    +LL++RIEEQSHLI +LK+RAD+ L RCQVL+  + ELE       E+  +D K+  ++   F +L   H +M
Sbjct:    2 EDGEQCALLRSRIEEQSHLISILKRRADDTLARCQVLECRSGELE------RERDGAD-KRCSLLEQRFMELASNHQQM 73          
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Nematostella
Match: EDO43644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY64])

HSP 1 Score: 71.633 bits (174), Expect = 4.410e-14
Identity = 80/311 (25.72%), Postives = 155/311 (49.84%), Query Frame = 1
Query:  139 MRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEI-VSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSD---IKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEV-QFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEK 1056
            M+ NLEKL  L+ +D +  S+L++RI++Q+ LI +LK+RADE   +    +KENKE++       E   ++ KK  ++   F  L   H EM    ++ K  N+KL++E  +L  E  V   E +K +      ++E+ ++ + + +L+    +  ++  +E + +        E  DF+  +     Q E+      M+ D     LK  +  +         QL V +   +K+  +E + L+   +  E   RE+++K+  E   ++ N+Q+Q++K  +   E  +   ++ Y+AYK +++ LL+ EK
Sbjct:    1 MKNNLEKLRALSKDDISENSMLRSRIDQQAELICILKQRADECTKKSIGFEKENKEIKAVREELLESIHTERKKHALLKQRFDVLNANHQEMISIKDSYKTQNKKLRSENEKLVHENEVLFAEKVKER------DQEIERLREESKQLQANCSLAGQRLEQERVHH--------EACDFIGKESETAGQLESVKHQLSMQRDQATAALKERDEFA---------QLAVDRGKALKEKQQENVQLSASLEEAEKTLREMEDKFASELHAMSSNAQVQRMKKQVDEMERMYHAQQKGYQAYKKHTSALLEKEK 288          
BLAST of Coiled-coil domain-containing protein 89 vs. Planmine SMEST
Match: SMESG000017325.1 (SMESG000017325.1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 316/319 (99.06%), Postives = 318/319 (99.69%), Query Frame = 1
Query:  103 DIFHTGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVKKNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 1059
            DIFHTGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTK+TQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLE QFSIVKKNNEEIIDLTKKSKTYESLY+ELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE
Sbjct:    9 DIFHTGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQSHLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYGNFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTMEAVNEELTKITQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLKSDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEAQFSIVKKNNEEIIDLTKKSKTYESLYKELKEKYQKESENLNINSQIQKLKTDLQMEEVKFRELRQDYEAYKIYSNKLLQTEKE 327          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC892.699e-1125.07coiled-coil domain containing 89 [Source:HGNC Symb... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1721821.122e-1929.88zgc:172182 [Source:NCBI gene;Acc:100136847][more]
zgc:1721822.330e-1930.06zgc:172182 [Source:NCBI gene;Acc:100136847][more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000027930.11.719e-1223.49coiled-coil domain containing 89 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc898.645e-1226.55coiled-coil domain containing 89 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8WG43|CCD89_DANRE9.140e-2029.88Coiled-coil domain-containing protein 89 OS=Danio ... [more]
sp|Q7ZW57|CCD89_XENLA4.020e-1326.27Coiled-coil domain-containing protein 89 OS=Xenopu... [more]
sp|B2RZ86|CCD89_RAT2.177e-1225.14Coiled-coil domain-containing protein 89 OS=Rattus... [more]
sp|Q29RS0|CCD89_BOVIN5.041e-1125.15Coiled-coil domain-containing protein 89 OS=Bos ta... [more]
sp|Q9DA73|CCD89_MOUSE6.047e-1126.55Coiled-coil domain-containing protein 89 OS=Mus mu... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PAB81.130e-2028.70Uncharacterized protein OS=Pomacea canaliculata OX... [more]
K1QSD14.233e-1930.36Coiled-coil domain-containing protein 89 (Fragment... [more]
A0A2C9JZ216.641e-1930.06Uncharacterized protein OS=Biomphalaria glabrata O... [more]
W5MN841.057e-1629.00Zgc:172182 OS=Lepisosteus oculatus OX=7918 PE=4 SV... [more]
A0A210PU831.150e-1628.57Coiled-coil domain-containing protein 89 OS=Mizuho... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1721822.849e-1428.28coiled-coil domain containing 89 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1721823.105e-1043.04zgc:172182 [Source:NCBI gene;Acc:100136847][more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436444.410e-1425.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain-containing protein 89 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000017325.10.000e+099.06SMESG000017325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002673 ID=SMED30002673|Name=Coiled-coil domain-containing protein 89|organism=Schmidtea mediterranea sexual|type=transcript|length=1133bp
TAATACGTCGCGAAGACAAAGTAACAGTGTGAATTTGTTAATACAATAAT
ATAAATTAATAAAAATATTAACCGTAATATGAATGAAGAGGAGAATTTCA
ATGATATTTTTCACACTGGGCAAGATGAGGTAAATAAAATGCGTGAAAAC
TTAGAAAAATTGTATAATCTAACAGACGAAGATAAAACTAATGAAAGCTT
ATTACAAGCTAGGATTGAGGAGCAGTCTCATTTAATAATGATGTTAAAAA
AGAGAGCAGACGAATACTTATTACGATGTCAAGTTTTGGATAAAGAAAAC
AAAGAATTGGAAACTCAATTAACCATAGCGACAGAAAAAAGTAAATCAGA
TGAAAAAAAAAGCAGAATTGTATATGGTAATTTCACTAAGCTCGTACAAA
CTCATGATGAAATGAAAATGGAATTTGAAAACGTGAAAAGAATCAATGAG
AAACTCAAAACCGAGTGCAATCAATTGAAATCTGAAATTGTGTCAATGAC
AGAAAATTTGAAAAATCAATCAACAATGGAAGCAGTGAATGAAGAATTAA
CCAAAATGACTCAAAGGAATAGCGAATTGGAATTAGAGCTCAAAATTTTC
AATGAGAAACGTTCCAAAGAAATTTTACAAAATCAATTGGAAATCGATAA
GAACAGGGAAATTGTTGATTTTCTCAAGTCAGATATCAAGCAAAAAGAGA
CAGATATCAAAGATTATCGCATGAAATCGGATAGTGTTATTGAAAAACTA
AAAAGCGACAACTCTATTTCAGCGAATGAAATCAAAAATATGAAAAAACA
ATTGGAAGTGCAATTTTCAATTGTCAAAAAAAACAATGAAGAAATAATTG
ATTTAACAAAGAAAAGCAAAACTTACGAAAGTCTTTACAGGGAATTAAAA
GAAAAATATCAAAAAGAATCAGAAAATTTAAATATCAATTCTCAAATACA
AAAGCTGAAAACAGATTTGCAAATGGAAGAAGTCAAGTTTAGAGAACTGC
GACAGGATTATGAAGCGTACAAGATCTACTCTAACAAACTTTTACAGACA
GAAAAAGAACTTAGTTCTCGACTAAGAAAACTTTATTCATAACTTTTACA
TATTATTCCAGTAAATATAACATTAGTATTCGT
back to top

protein sequence of SMED30002673-orf-1

>SMED30002673-orf-1 ID=SMED30002673-orf-1|Name=SMED30002673-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MNEEENFNDIFHTGQDEVNKMRENLEKLYNLTDEDKTNESLLQARIEEQS
HLIMMLKKRADEYLLRCQVLDKENKELETQLTIATEKSKSDEKKSRIVYG
NFTKLVQTHDEMKMEFENVKRINEKLKTECNQLKSEIVSMTENLKNQSTM
EAVNEELTKMTQRNSELELELKIFNEKRSKEILQNQLEIDKNREIVDFLK
SDIKQKETDIKDYRMKSDSVIEKLKSDNSISANEIKNMKKQLEVQFSIVK
KNNEEIIDLTKKSKTYESLYRELKEKYQKESENLNINSQIQKLKTDLQME
EVKFRELRQDYEAYKIYSNKLLQTEKELSSRLRKLYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 60..94
NoneNo IPR availableCOILSCoilCoilcoord: 196..216
NoneNo IPR availableCOILSCoilCoilcoord: 109..143
NoneNo IPR availableCOILSCoilCoilcoord: 150..177
NoneNo IPR availableCOILSCoilCoilcoord: 221..252
NoneNo IPR availableCOILSCoilCoilcoord: 290..310
NoneNo IPR availableCOILSCoilCoilcoord: 256..283
NoneNo IPR availablePANTHERPTHR34768FAMILY NOT NAMEDcoord: 16..336
NoneNo IPR availablePANTHERPTHR34768:SF2COILED-COIL DOMAIN CONTAINING 89coord: 16..336