PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30002671
Length (bp)2540
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PBPe domain-containing protein (SMED30002671) t-SNE clustered cells

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30002671) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PBPe domain-containing protein (SMED30002671) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30002671) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002671

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal cellSMED30002671SMESG000065907.1 dd_Smed_v4_8532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002671SMESG000065907.1 dd_Smed_v4_8532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002671SMESG000065907.1 dd_Smed_v4_8532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002671SMESG000065907.1 dd_Smed_v4_8532_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 102.064 bits (253), Expect = 1.556e-21
Identity = 102/446 (22.87%), Postives = 185/446 (41.48%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L      K  +    +G+  T+            N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +    NG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ-----KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 102.064 bits (253), Expect = 1.663e-21
Identity = 102/446 (22.87%), Postives = 185/446 (41.48%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L      K  +    +G+  T+            N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +    NG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  334 TGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ-----KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 767          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 102.064 bits (253), Expect = 1.815e-21
Identity = 102/446 (22.87%), Postives = 185/446 (41.48%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L      K  +    +G+  T+            N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +    NG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ-----KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4580])

HSP 1 Score: 102.064 bits (253), Expect = 1.947e-21
Identity = 102/446 (22.87%), Postives = 185/446 (41.48%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L      K  +    +G+  T+            N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +    NG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  334 TGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ-----KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 767          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 102.064 bits (253), Expect = 2.005e-21
Identity = 101/447 (22.60%), Postives = 185/447 (41.39%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAK-TASVQIVN---GIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQ---------------TKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG  TF      R  + LD   L  + T  + I N   G+  TD N        + N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L   Y++    +P G        G+ NGM+    + +AD+ + P+T   V +  +D++    T  I ILY K N T+    +F F+      +W+ +L++C      L ++   +P +                 FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + S  S+ + +   + ++    +    +  I  V   D     YAL+  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  373 TGHITFNKTNGLRKDFDLDIISLKEEGTEKIGIWNSNSGLNMTDSN-----KDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKL--VPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTD-----YALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 107.071 bits (266), Expect = 1.699e-23
Identity = 95/381 (24.93%), Postives = 165/381 (43.31%), Query Frame = 3
Query: 1191 MRAKPFRVAAMQEKPYAFY-ANGTQTGHSVEIIIKILSSLNVTYNITFYE--LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYK---INSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQT---------------KFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAPVC 2261
            +  K  +++   E P+    +NG+  G+ ++++ KI + L  TY I             NGK +GM+G  Q G AD+ +  +T +      +D+T       I IL+K   I  +D +K    F+      VWI+   S  +  +++ ++  ISP +                +F+   S  FT+ S++Q  +   P   S R+L   WW F + ++ +Y AN  A+LT  RM+  I    DL  Q    YGT+   +   F   S   + + + Q + +    +   +    I  V + D     YA +  +S+L+      C ++  G   +Q  Y   LP  S Y  +I+ A L   + + L  L  K++   K+ VC
Sbjct:  398 LEGKHLKISVYLEAPFVMITSNGSYEGYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFK----FMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSS-PGLFVQSSKEGIARVKSSD-----YAYLMESSMLEYAVERDCELMQIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWK-DKSVVC 767          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 105.531 bits (262), Expect = 3.371e-23
Identity = 72/263 (27.38%), Postives = 122/263 (46.39%), Query Frame = 3
Query: 1206 FRVAAMQEKPYAFYANGTQT---GHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSAS 1931
            FRV  + + P+        T   G+ +++I  I   +N TY  T YE+  G+      NG  NG++G   +G ADI + P++     ++ VD+T V   D +G    +   D+  ++F+F+   ++ VW+ I+ +     I L + +  SP               + +F+    + F M S+        P  ISGR++A  WW+F   ++ +Y AN  A LT SR++  I  L DL +Q    Y  I  SA + + +  A 
Sbjct:  160 FRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTY--TIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFT-VPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAE 419          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 105.916 bits (263), Expect = 3.876e-23
Identity = 72/263 (27.38%), Postives = 122/263 (46.39%), Query Frame = 3
Query: 1206 FRVAAMQEKPYAFYANGTQT---GHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSAS 1931
            FRV  + + P+        T   G+ +++I  I   +N TY  T YE+  G+      NG  NG++G   +G ADI + P++     ++ VD+T V   D +G    +   D+  ++F+F+   ++ VW+ I+ +     I L + +  SP               + +F+    + F M S+        P  ISGR++A  WW+F   ++ +Y AN  A LT SR++  I  L DL +Q    Y  I  SA + + +  A 
Sbjct:  355 FRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTY--TIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFT-VPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAE 614          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 105.916 bits (263), Expect = 3.896e-23
Identity = 72/263 (27.38%), Postives = 122/263 (46.39%), Query Frame = 3
Query: 1206 FRVAAMQEKPYAFYANGTQT---GHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSAS 1931
            FRV  + + P+        T   G+ +++I  I   +N TY  T YE+  G+      NG  NG++G   +G ADI + P++     ++ VD+T V   D +G    +   D+  ++F+F+   ++ VW+ I+ +     I L + +  SP               + +F+    + F M S+        P  ISGR++A  WW+F   ++ +Y AN  A LT SR++  I  L DL +Q    Y  I  SA + + +  A 
Sbjct:  374 FRVVTLIQPPFVQRTGDPDTPYEGYCIDLINMIQVEVNFTY--TIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFT-VPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWLCIVAAYLFTSILLWIFDRFSPYSFTNNKERYQNDIEKRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAE 633          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 100.908 bits (250), Expect = 1.492e-21
Identity = 89/344 (25.87%), Postives = 154/344 (44.77%), Query Frame = 3
Query: 1284 IIKILSSLNVTYNITFYELPSGTLV-----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFT----GGLSI----------LFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVS----LKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIINAQLNAL-DPSFLNSLITKYF 2237
            ++K+L+     +N   YE+  GT       +G  +GM+G   +G+A  V+  +T N   +  VD++    T  I I+ K      + ++F F+      +W+ I+ +     + + LV+  SP + +      GG +I           FT+ + +Q  T  LP  ISGRI +  WW F + ++ +Y AN  A LT  +MQ  I  + DL +Q+   YG     +   F + S+    Q + + + +Q   +   ++   I+ V +        L+  A  Y N+  KP     C  +  G   N + Y  A PF SD+ + IN  + AL +   L  L  K++
Sbjct:  499 LLKLLADKIEEFN---YEIKLGTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEF-SVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENT-RKP-----CDTMKVGANLNSIGYGIATPFGSDWKDHINLAILALQERGELKKLENKWW 832          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 101.293 bits (251), Expect = 1.536e-21
Identity = 102/431 (23.67%), Postives = 177/431 (41.07%), Query Frame = 3
Query: 1056 RTSWILDAYQLN-AKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFY--------ANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL-----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLI---------------SPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIINAQLNAL-DPSFLNSLITKYFSTTKA 2252
            RT ++LD  +L  A    +   N  +    N    F+   Q +   ++ K   V  +   PY            N    G++V++I +I  SL   Y I    +P G+      + G+ NGM+      +AD+ I  +T     +  VD+T       + ILY+        N+F F+      VWI +  + A  G+S+ L  L                   +++FT    + F +GS++Q     LP  +S R++A  WW F + ++ +Y AN  A LT  RM   I    DL +Q    YG +   +   F + S  S+ Q +   + +   ++   +    ++ V     S   YA +  ++ ++  T   C +   G   +  +Y  A P NS Y   IN+ +  L +   L+ L TK++   + 
Sbjct:  367 RTDFMLDIVELTPAGIRKIGTWNSTLPDGINFTRTFSQKQQEIEANLKNKTLVVTTILSNPYCMRKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQL--VPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYR-KPIKQPPNLFSFLSPLSLDVWIYM--ATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGS---YAFLMESTSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRG 789          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 90.1225 bits (222), Expect = 4.677e-18
Identity = 79/334 (23.65%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 1362 GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTK---------------FTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYE 2309
            G+ NGM+      +AD+ +G +T     +S +D+T       I IL+K+ +++  + +F F+      +WI +L++  +  + + +V  +SP + K               F+   S  FT+G+ +Q      P  +S RI++  W  F++ ++ +Y AN  A LT  RM   I    DL  Q   SYGT+ + +   F + S   + + + +++  +  +   TT+   I  VN  +     YA +  +++L       C +   G   +   Y  A P  S + + I+ A L   +   +  L  K++  T        T      N LG E
Sbjct:  467 GEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTR-LFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGN-----YAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLE 794          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 85.8853 bits (211), Expect = 1.015e-16
Identity = 81/335 (24.18%), Postives = 147/335 (43.88%), Query Frame = 3
Query: 1362 GKLNGMMGIAQNGQ-ADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTK---------------FTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYE 2309
            G+ NGM  +AQ  + AD+ +G +T     +S +D+T       I IL+K+ +++  + +F F+      +WI +L++  +  + + +V  +SP + K               F+   S  FT+G+ +Q      P  +S RI++  W  F++ ++ +Y AN  A LT  RM   I    DL  Q   SYGT+ + +   F + S   + + + +++  +  +   TT+   I  VN  +     YA +  +++L       C +   G   +   Y  A P  S + + I+ A L   +   +  L  K++  T        T      N LG E
Sbjct:  467 GEWNGM--VAQLMKYADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTR-LFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGN-----YAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLE 793          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: clumsy (gene:FBgn0026255 transcript:FBtr0110895)

HSP 1 Score: 85.1149 bits (209), Expect = 1.552e-16
Identity = 95/352 (26.99%), Postives = 151/352 (42.90%), Query Frame = 3
Query: 1203 PFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMM----GIAQ---NGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLIS--------PNQTKFTGGL----SIL----FTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIINA 2183
            PF      ++      N    G+S+++I +I   LN  +   F   P G    G LN +     GI +   +G AD+ I  +T     +  VD+T    T  I IL+    T    ++F F+  F   VWI +    A   ISL L  L          P+  K    +    SI+     ++GS++      LP   S R++   WW F + +L +Y AN  A LTNSR   SI    DL  Q+   YG +   +   F + S  S+ Q +  A+ +   ++   T +  ++ V  K  +L  YA +  ++ L+      C ++  G   +  +Y  A+PFNS Y   I+A
Sbjct:  426 PFLTLREPQEGEILTGNSRYEGYSIDLINEIAKMLN--FKFEFRMSPDGKY--GALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTLGISILFSKPPTP-PTDLFSFLSPFSLDVWIYM--GSAYLFISLLLFALARMAPDDWENPHPCKEPEEVENIWSIMNTTWLSIGSLMGQGCDILPKAASTRLVTGMWWFFALMMLNSYTANLAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMESASPSVFTKTNDEGVERV-QKGKNL--YAFLMESTTLEYNVERKCDLVQIGGWLDYKSYGIAMPFNSPYRKQISA 767          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Nmdar1 (gene:FBgn0010399 transcript:FBtr0078763)

HSP 1 Score: 81.6481 bits (200), Expect = 1.726e-15
Identity = 85/389 (21.85%), Postives = 161/389 (41.39%), Query Frame = 3
Query: 1185 NEMRAKPFRVAAMQEKPYAFYANGTQT-------GHSVEIIIKILSSLNVTYNITFYELPSGTL-------------VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP-----------NQTK-FTGGLSILFTMGSMV-QGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTY---SYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKY 2234
            +E R +P       E+P   + N   T       G+ ++++I++   +N TY++     P G               +  +  G++G   N +AD+++ P+T N     Y++++       I IL K  S      +  F+  F   +WIL++VS  +  + L L++  SP           N+ K      ++ F  G ++  G+    P   S R+L + W  F + ++ +Y AN  A L   R +  +  ++D   +NT    +  T+  S+VD + +         ++   R   AN   T   A  D+   K +     A I+ +S L+   S  C ++ +G    +  Y   L   S +T+ +  A L   +  F+  L  ++
Sbjct:  439 DEFRCEP------DERPCPLFNNSDATANEFCCRGYCIDLLIELSKRINFTYDLALS--PDGQFGHYILRNNTGAMTLRKEWTGLIGELVNERADMIVAPLTINPERAEYIEFSKPFKYQGITILEKKPSRS--STLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFKLSHSDSNEEKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLSGINDARLRNTMENLTCATVKGSSVDMYFRRQV-----ELSNMYRTMEANNYATAEQAIQDVKKGKLM-----AFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHESGFMEKLDKQW 807          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-251b21.1 (si:ch211-251b21.1 [Source:ZFIN;Acc:ZDB-GENE-060809-5])

HSP 1 Score: 101.679 bits (252), Expect = 3.372e-22
Identity = 67/265 (25.28%), Postives = 121/265 (45.66%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELP--SGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTK--------FTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIR 1964
            +P +V  ++E+PYA        G  ++++  I + L   Y++   +      T  +G  NGM+G    G+ADI + P+T     ++ VD +       +  + + +           +  F   +W+ +LV+  +  I + LV+ ISP + +        FT   S  +T+G++        P  +SGR++   WWIF++ +L  Y AN    L +   Q SI    DL  QN   YGTI +S+   F + S + +   + + I+
Sbjct:   23 QPLKVTTIKEEPYAMSKGSELEGFCIDMLSAISNKLGFKYDVHLVKDGRYGKTDDSGNWNGMIGEVVRGEADIAVAPLTLTAQREAVVDMSKPFMQTGLSFIMRKDLGSDDSQFLSLLKLFSTEMWMGVLVAYLLTSICIFLVSRISPCEWEQPEKDNNSFTLSHSFWYTVGALTLQGAGPHPKALSGRVITSIWWIFSLVLLACYFANLSLWLHSDNQQLSIKTFEDLANQNVIEYGTIKDSSSFNFFKNSNNPTYHRIYEHIK 287          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grid1b (glutamate receptor, ionotropic, delta 1b [Source:ZFIN;Acc:ZDB-GENE-121214-84])

HSP 1 Score: 103.219 bits (256), Expect = 5.428e-22
Identity = 100/407 (24.57%), Postives = 179/407 (43.98%), Query Frame = 3
Query: 1140 YNSLPLFNSSTQN--LLNEMRAKPFRVAAMQEKPYAFYAN------GTQTGHSVEIIIKILSSLNVTYNITFYELPSGT----LVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLIS------PNQTKFTGGLS------ILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAV-DYFLQTSASSSIQNVNQAIRAQYANIMPT-------TFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLA---CYVLVSGTNQVNYSY--ALPFNSDYTNIINAQLNAL-DPSFLNSLITKYFSTT 2246
            ++S+   N S +   + N M+    +V  + E P+   A           G S++++  +   L   Y+I  Y++        L NG  NGM+G   N +AD+ +  IT     ++ VD++      ++GIL++     +  N+F     FD  VW  I  +  + G+ + L+  +       P        +S      I    G+ VQ    ++   ++ RI+   WW+F + V  +Y AN  A LT SRM  +I    DL +Q  ++YGT+ +SAV DYF     +   Q+      + YA +  T        F+ S      +     PYA ++  ++++ Y +L    C + VSG +  +  Y  A+   S Y ++I+ ++  L +   L+ L  K++  T
Sbjct:  416 WDSVHGLNGSLKESRIENGMQGVTVKVVTLLEDPFVMVAENILGQPKRYKGFSIDVLEALAKILGFKYDI--YQVADSKYGSQLSNGSWNGMIGELINKRADLAVSAITITPERENVVDFSKRYMDYSVGILHRKPEEKI--NIFSLFAPFDLAVWACIAAAIPVVGVLIFLLTRMQMLRSQNPPGAHHASSMSNSLHSAIWIVYGAFVQQGGDSVVGSVALRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNTIRTFQDLARQMDFAYGTVRDSAVYDYFKAKGTNPLEQD------STYAELWRTISKNNGQDFSVSSPSEGIRKAKKGPYAFLWDMAVVE-YAALTDDDCTITVSGNSMSSKGYGIAMQHGSPYRDLISQKILELQEKGDLDVLKQKWWPRT 811          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 101.293 bits (251), Expect = 2.001e-21
Identity = 99/446 (22.20%), Postives = 187/446 (41.93%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F      RT + LD   L      K  +    +G+  T+          T N+ + +  +   V+ + E+PY          Y N    G+ V+++ ++ + L   Y +   E     +    +G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + +  S+   + + + ++  ++M  +    I+ V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRINFNRTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTENQ-----KGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDKPLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 101.293 bits (251), Expect = 2.001e-21
Identity = 99/446 (22.20%), Postives = 187/446 (41.93%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F      RT + LD   L      K  +    +G+  T+          T N+ + +  +   V+ + E+PY          Y N    G+ V+++ ++ + L   Y +   E     +    +G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + +  S+   + + + ++  ++M  +    I+ V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRINFNRTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTENQ-----KGKTANVTDSLSNRSLVVSTILEEPYVMFKKSDKPLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: LO018303.1 (glutamate receptor ionotropic, kainate 3 [Source:NCBI gene;Acc:100334689])

HSP 1 Score: 100.523 bits (249), Expect = 4.232e-21
Identity = 105/442 (23.76%), Postives = 182/442 (41.18%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGISLTL------VNLISPN----QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFS 2240
            TG+  F      RT + LD   L      K        G+  T+   +P  N    N+ + +  +   +  + E+PY        A   N    G  ++++ ++ S L  +Y I    +P G        G+ NGM+      +AD+ + P+T   + +  +D++       I ILY K NST+     F F+      +W+ IL     VSC ++ I+          +  +P     +  FT   S  F +GS++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM   +    DL +Q    YG + + A   F + S  S+ + +   + ++ +     +    I  V   D     YAL+  ++ ++  T   C +   G   +   Y    P  S Y + I  A L  L+   L+ L  K++S
Sbjct:  368 TGRLCFNRTTGLRTDFDLDIVSLKEDGLQKVGKWSASGGLNITE---VPRQNG--MNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFSYEIHL--VPDGKYGFQDDKGQWNGMIRELMEHRADLAVAPLTITFMREKAIDFSKPFLNTGISILYRKPNSTN--SGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSRQSTSFVKSIEDGIQRVLKSD-----YALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKITIAILGILEDGRLHMLKEKWWS 795          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 107.457 bits (267), Expect = 6.353e-24
Identity = 78/326 (23.93%), Postives = 144/326 (44.17%), Query Frame = 3
Query: 1140 YNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGS-IVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILK 2078
            +  + +F    +        K   V  + E+P++        G  ++++ ++  SL   +N T  E+  G       +G  NGM+G     +AD+ + P+T     +  + +T       I IL + +       +F F+  F    WI ILV+  +  + L LV  +SP         Q  F    S+ F +G+         P  +S RI+AV WWIF+I ++ AY+A++ A L +  MQ + I    DL  Q T  +GTI +S+   F + S + + + + + +  +   ++  +F   +  V   +     YA + G S+++
Sbjct:   11 FKEMDVFKLQEKERSKRQALKHLTVTTIMEQPFSMKTESGMEGFCIDLLSELAQSLG--FNYTIKEVKDGRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESN-----YAFL-GESVMQ 328          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 107.457 bits (267), Expect = 6.395e-24
Identity = 78/326 (23.93%), Postives = 144/326 (44.17%), Query Frame = 3
Query: 1140 YNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGS-IVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILK 2078
            +  + +F    +        K   V  + E+P++        G  ++++ ++  SL   +N T  E+  G       +G  NGM+G     +AD+ + P+T     +  + +T       I IL + +       +F F+  F    WI ILV+  +  + L LV  +SP         Q  F    S+ F +G+         P  +S RI+AV WWIF+I ++ AY+A++ A L +  MQ + I    DL  Q T  +GTI +S+   F + S + + + + + +  +   ++  +F   +  V   +     YA + G S+++
Sbjct:    7 FKEMDVFKLQEKERSKRQALKHLTVTTIMEQPFSMKTESGMEGFCIDLLSELAQSLG--FNYTIKEVKDGRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESN-----YAFL-GESVMQ 324          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 105.916 bits (263), Expect = 2.831e-23
Identity = 77/306 (25.16%), Postives = 139/306 (45.42%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGS-IVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILK 2078
            K   V  + E+P++        G  ++++ ++  SL   +N T  E+  G       +G  NGM+G     +AD+ + P+T     +  + +T       I IL + +       +F F+  F    WI ILV+  +  + L LV  +SP         Q  F    S+ F +G+         P  +S RI+AV WWIF+I ++ AY+A++ A L +  MQ + I    DL  Q T  +GTI +S+   F + S + + + + + +  +   ++  +F   +  V   +     YA + G S+++
Sbjct:   41 KHLTVTTIMEQPFSMKTESGMEGFCIDLLSELAQSLG--FNYTIKEVKDGRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESN-----YAFL-GESVMQ 338          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 100.523 bits (249), Expect = 3.498e-21
Identity = 106/444 (23.87%), Postives = 180/444 (40.54%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSW---ILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYE--LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIY-GISLTLVNLISPN----------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F N+   RT++   IL+      +   V   N  +  +  SL L  S T      +  K   V  + E PY        +   N    G   E+++++ + L   Y I   E  L      NG   GM+G   N +AD+ +   T     +  +D++    T  I ILY++         F F+  F   VW+ +L     VSC ++    L+     +P+          + ++T G S+ F +G  +Q  +  +P  +S R ++  WW F + ++ +Y AN  A LT  RM+  I    DL  Q    YGTI   +   F Q S   + Q +   + ++  ++   +    I  V N       YA +  +++ + +  L C +   G   +   Y   +P  S Y + I  A L   + + L  L  K++   K P
Sbjct:   74 TGRVEF-NSKGQRTNYTLRILEKAGDGHREIGVWYSNRTLAMNATSLDLSTSET------LENKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQ-MGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSR-----YAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPYRDEITLAILQLQENNRLEILKRKWWEGGKCP 504          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 100.138 bits (248), Expect = 6.779e-21
Identity = 106/444 (23.87%), Postives = 180/444 (40.54%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSW---ILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYE--LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIY-GISLTLVNLISPN----------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F N+   RT++   IL+      +   V   N  +  +  SL L  S T      +  K   V  + E PY        +   N    G   E+++++ + L   Y I   E  L      NG   GM+G   N +AD+ +   T     +  +D++    T  I ILY++         F F+  F   VW+ +L     VSC ++    L+     +P+          + ++T G S+ F +G  +Q  +  +P  +S R ++  WW F + ++ +Y AN  A LT  RM+  I    DL  Q    YGTI   +   F Q S   + Q +   + ++  ++   +    I  V N       YA +  +++ + +  L C +   G   +   Y   +P  S Y + I  A L   + + L  L  K++   K P
Sbjct:  353 TGRVEF-NSKGQRTNYTLRILEKAGDGHREIGVWYSNRTLAMNATSLDLSTSET------LENKTLVVTTILENPYMMRKSNYRSLSGNDQYEGFCAEMLMELAALLRFNYKIKLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQ-MGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSR-----YAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPYRDEITLAILQLQENNRLEILKRKWWEGGKCP 783          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 103.219 bits (256), Expect = 4.673e-22
Identity = 102/442 (23.08%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L  +    +I     ++  N          N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLE-KIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 103.219 bits (256), Expect = 4.673e-22
Identity = 102/442 (23.08%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L  +    +I     ++  N          N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLE-KIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 103.219 bits (256), Expect = 5.185e-22
Identity = 102/442 (23.08%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L  +    +I     ++  N          N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLE-KIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 102.834 bits (255), Expect = 7.116e-22
Identity = 102/442 (23.08%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L  +    +I     ++  N          N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLE-KIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 102.834 bits (255), Expect = 7.116e-22
Identity = 102/442 (23.08%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L  +    +I     ++  N          N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLE-KIGTWDPSSGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P20262|GLRK_LITBE (Probable glutamate receptor OS=Lithobates berlandieri OX=30360 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.615e-24
Identity = 76/289 (26.30%), Postives = 141/289 (48.79%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQ-TGHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGA-ILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNN 2024
            K   V  + EKP+A         G++++++ ++  SL   +N T + +  G        G  +GM+G     +AD+ I P+T   V ++ + +T       IGIL K ++      MF F+  F   +WI I++S  I  + L LV  +SP         Q +FT   S+ + +G++        P  +S RI+AV WW+F+I +L AY+ ++ + I +N+    +I  + DL +Q+   +GT+ NS+   F + S + + Q + + +  +   ++  TF+  +  V  
Sbjct:   39 KTLTVTTILEKPFAMKTESDALEGYAIDLLSELTQSLG--FNYTLHIVKDGKYGSKDQEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTGIGILLKKDTAAESSYMFGFLNPFSKELWIGIIISYVITSLCLFLVGRLSPCEWTEPASEQNQFTLLNSLWYGVGALTLQGAEPQPKALSARIIAVIWWVFSITLLAAYIGSFASYINSNTNQTPNIQSVEDLLKQDKLDFGTLSNSSTLNFFKNSKNPTFQMIYEYMDKRKDRVLVKTFSEGVQRVRE 325          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P19439|GLRK_CHICK (Probable glutamate receptor OS=Gallus gallus OX=9031 GN=KBP PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.061e-23
Identity = 80/298 (26.85%), Postives = 140/298 (46.98%), Query Frame = 3
Query: 1212 VAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFY-ELPSGTLV-NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSM-VQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSI 2072
            V  + E PY    +    G+ ++++  + S L+ +Y +    +   G +  +G   GM+G     +ADI + P+T     +  V +T       IGIL +  +     + F F+  F    W  +L +  +  + L LV  +SP         +  FT   S+ F  G++ +QGVT   P   S R++A  WW+F IA+L AY+AN+ A+L++   Q SI    DL +Q    +GT+  S+  YF + S +   + V + +  +  +++  T+  ++  V   +     YA I G SI
Sbjct:   51 VTTILEDPYVMVRSAELEGYCIDLLKALASMLHFSYKVKVVGDGKYGAISPSGNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGIGILLRKETISQEMSFFHFLAPFSKETWTGLLFAYVLTCVCLFLVARLSPCEWNEPKNEENHFTFLNSLWFGAGALTLQGVTPR-PKAFSVRVIAAIWWLFTIALLAAYIANFTALLSSGSEQLSIQTFEDLVKQRKLEFGTLDGSSTFYFFKNSKNPIHRMVYEYMDKRRDHVLVKTYQEAVQRVMESN-----YAFI-GESI 341          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q90218|GLRK_ANAPL (Probable glutamate receptor OS=Anas platyrhynchos OX=8839 GN=KBP PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.744e-23
Identity = 79/298 (26.51%), Postives = 138/298 (46.31%), Query Frame = 3
Query: 1212 VAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV--NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSM-VQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSI 2072
            V  + E PY         G+ ++++  + S L+ +Y +          V  NG   GM+G     +ADI + P+T     +  V +T       IGIL + ++     + F F+  F    W  +L +  +    L LV  +SP         +  FT   S+ F  G++ +QGVT   P  +S R++A  WW+F IA+L AY+AN+ A+L++   Q  I    DL +Q    +GT+  S+  Y+ + S +   Q + + +  +  +++  T+  ++  V + +     YA I G SI
Sbjct:   51 VTTILEDPYVMVRRAELEGYCIDLLKALASMLHFSYKVKVVGDGKYGAVSSNGNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGIGILLRKDTMSQEMSFFHFLAPFSKETWTGLLFAYILTCFCLFLVARLSPCEWNEPKNEENHFTFLNSLWFGAGALALQGVTPR-PKALSVRVIAAIWWLFTIALLAAYIANFTALLSSGSEQLPIQTFEDLVKQRKLEFGTLDGSSTFYYFKNSKNPIHQMIYEYMDKRRDHVLVKTYQEAVQRVMDSN-----YAFI-GESI 341          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91756|GLRK_XENLA (Glutamate receptor U1 OS=Xenopus laevis OX=8355 GN=kbp PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.579e-21
Identity = 76/306 (24.84%), Postives = 138/306 (45.10%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGS-IVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILK 2078
            K   V  + E+P++  +     G  ++++ ++  SL   +N T  E+  G       +G  NGM+G     + D+ + P+T     +  + +T       I IL +         +F F+  F    WI ILV+  +  + L LV  +SP         Q  FT   S+ F  G+         P  +S RI+AV WWIF+I ++ AY+A++ A L +  +Q + I    DL  Q T  +GTI +S+   F + S + + + + + +  +   ++  +F   +  V   +     YA + G S+++
Sbjct:   41 KHLTVTTIMEQPFSMKSESGMEGFCIDLLSELSQSLG--FNYTIKEVKDGRYGAKDQDGNWNGMVGEVLRKEVDLAVAPLTITANRERELAFTKPFMQTGISILLRKEDASENSFLFGFLTPFSKETWIGILVAYMVTSLCLFLVGRLSPCEWTELSTEQNNFTFLNSLWFGAGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSVQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVRESN-----YAFL-GESVMQ 338          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P42260|GRIK2_RAT (Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 3.683e-21
Identity = 103/446 (23.09%), Postives = 186/446 (41.70%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAF--------YANGTQTGHSVEIIIKILSSLNVTYNITFYE---LPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ TF      RT + LD   L      K  +    +G+  T+            N+ + +  +   V  + E+PY          Y N    G+ ++++ ++ + L  TY I   E     +   VNG+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + S  S+   +   + ++  +++  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  372 TGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQ-----KGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 805          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A068WHH0 (Glutamate receptor ionotropic kainate OS=Echinococcus granulosus OX=6210 GN=EgrG_001066000 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 7.500e-42
Identity = 147/627 (23.44%), Postives = 276/627 (44.02%), Query Frame = 3
Query:  381 GPSQYFQPSFFGFDSSNSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFS-------SLSYGNYTQRPNVTIFDYAHNSDYSS----TVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAY---QLNAKTA--SVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYA---NGTQTGHSVEIIIK--ILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNAL 2198
            GP  ++ P+FF  +          S I    + F  +  ++ +  N + ++  +  + +  + +      P+       +L    G   + +  +        S IL  GA  I +++ +  +L++L    + N+      WLVF +        L  GN     N    +++ N  ++     +  P  +  +D++F D +++ ++ +    +  +P  + L T           +  W   +Y     ++++A     + NG +   + +L     S + LLN MR+KPFR+  ++  P        NG  T    EI++   +L+ LNV+YNIT ++L  G  V+G+  G+ G+ +    D+++GP +           T+ + + T   +Y   S      +F+FV AFD   W+LI ++ A++  +LTL++ ISPN   +T   S+LF  G + QGV T  P + S +IL V WW F + +++A+ ANY A  + + +Q     +  L  Q  Y Y  I  S ++  +  S   SI  +   I  +Y +++P   +A +D V         +AL+  +  ++ Y    C    S      Y + +P    Y  IIN +L  +
Sbjct:   95 GPDYFYGPAFFPPEWKTGMNNVNRSRIVGFDLTFDVQNEVIKSAFNHLTSDIGVVKLAYFFDYAE-GGIHPFFHIETFQFLEQKVGQFLLYQLRDFASVEDALSKILVDGANVIVLNVGQQAALKLLEKAQEKNILQQPFYWLVFNAGVTLSGVELCVGN----ANFFAVEFSTNGRFTEFPELSAIPKPITPKDLIFRDTAVVGLQRLARLLSKTVPNDITLITSTRDGMENTVIQQKWKFYSYVDTNFDSRSAYEVTVLTNGSIVASFQALKQ-PPSGELLLNRMRSKPFRLGTIKVPPVITEETDKNGAVTVSGPEIVLAKALLNRLNVSYNITLFDLGVGEEVDGRWTGIFGLLEEWDIDLLVGPFSETWDRSKSFLSTSPIRSITYNYMYLRPSLKASLQIFQFVVAFDGYTWLLIFITAALFAGALTLLHKISPNTLSYTIHPSMLFVFGYLFQGVRTRPPSQASSQILIVVWWFFCLVLVIAFCANYAAYRSFTALQTLPTTVFALLHQEYYKYAYINGSNMNMEMSVSLDPSIYALYTEINTKYKDVIPPNRSAGVDKVIKGG-----FALLDESPFIEYYARKYCLETSSALWYGAYVFYMPKLLPYYKIINDELTLM 710          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A5K3EXB0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.264e-42
Identity = 160/652 (24.54%), Postives = 291/652 (44.63%), Query Frame = 3
Query:  342 ENRNDFSTIQLAFGPSQYFQPSFFGFDSSNSTFKFKNSYIADSF-MNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQG--DGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSY-GNYTQRPNVTIF--DYAHNSDYSSTVN----PTILEEQDILFSDFSMMAVK----LMDSECNNPIP------PSLNLRTGQFTFTNAIYTRTSWILDA---YQLNAKTASVQIVNGIVTTDYNSLPLFNSST-QNLLNEMRAKPFRVAAMQEKPYAFYANGTQ------TGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSL---KPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNAL 2198
            E  ND   I +  GP   + PSFF   +  +TF        + F ++ + + ++M      + +   + +V  +L+ S+ +   P+ S  P+ +L +  G    Q YY +       + S IL  GA  + + L +  +L++L+   + N+      WLVF + L+  GN     +   +  + + N  +         P  +   D++F D +++A+K    L+  +    +P         NL + + T T   Y+  +   DA   Y++  K       NG  T D N  PL  + T ++LL  M++KPFR+      P     +          G  + +  K+L  LNV++ IT ++L  G  V  +  G+ G  +    D+++GPI+     Q+    T+   + +   +Y   S      +F+FV AFD   W+LI ++  ++  SL L++ ISPN   ++   S++F  G +VQGV T  P++ S +IL   WW F + +++ + ANY A  + + ++        L  Q  Y+Y  I  S  +  ++ +   SI  + Q+I  ++AN +P     +++ V N   +L    P+   Y     K Y       L  GT    Y++ +P    Y +I+ A+L  +
Sbjct:   81 ETIND-PRIFVQIGPKSLYGPSFFR-TTEKTTFDNVTRLCFEGFDLSAAVQDDVMWAAFKHLTSAMDLTNVALLLDDSDTE-THPFASTEPLQFLGS--GVGQFQVYYKREFPSSEEILSRILVDGATVLVLKLDQSNALKLLTMAQEKNILLTPFHWLVFNAGLTLSGNAYDVADANFYAVELSTNGKFQDYPEFNSIPKPVTTNDLIFRDMTVVALKKLSQLLAIQLTEDVPLITCTLSDPNLSSQELTPTWNFYSYVTTEFDASSTYRIERKP------NG--TVDGNFQPLKPTPTRESLLKLMQSKPFRIGTFVIPPLIELVDDQTNRTTRVQGPQIAVATKLLERLNVSFEITVFDLEVGEKVGDRWTGLFGHLEEWDIDLLVGPISLTWDRQADFQSTSPFQSISYKFIYMRPSLSGALQIFQFVVAFDGYTWLLIFITAVVFACSLALLHKISPNTLSYSIHPSMIFVFGYLVQGVRTRPPNRASSQILIAVWWFFCLVLVIGFCANYAAYRSFTALENLPSTDYSLLHQTYYTYAYINGSNTEEIMRATLDPSIYALYQSINMKFANKIPPNRTVALEQVLNGHFALIDESPFTDYYA----KKYCLETSVTLWHGT----YAFYMPKLLPYYDIVEAELKGM 711          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: W6UGF4 (Glutamate receptor U1 OS=Echinococcus granulosus OX=6210 GN=EGR_05049 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 9.962e-42
Identity = 121/456 (26.54%), Postives = 219/456 (48.03%), Query Frame = 3
Query:  690 SGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSY---GNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAY---QLNAKTA--SVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYA---NGTQTGHSVEIIIK--ILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLV 2018
            S IL  GA  I +++ +  +L++L    + N+      WLVF + + +   G +T+ P ++               P  +  +D++F D +++ ++ +    +  +P  + L T           +  W   +Y     ++++A     + NG +   + +L     S + LLN MR+KPFR+  ++  P        NG  T    EI++   +L+ LNV+YNIT ++L  G  V+G+  G+ G+ +    D+++GP +           T+ + + T   +Y   S      +F+FV AFD   W+LI ++ A++  +LTL++ ISPN   +T   S+LF  G + QGV T  P + S +IL V WW F + +++A+ ANY A  + + +Q     +  L  Q  Y Y  I  S ++  +  S   SI  +   I  +Y +++P   +A +D V
Sbjct:   41 SKILVDGANVIVLNVGQQAALKLLEKAQEKNILQQPFYWLVFNAVIEFSTNGRFTEFPELSAI-------------PKPITPKDLIFRDTAVVGLQRLARLLSKTVPNDITLITSTRDGMENTVIQQKWKFYSYVDTNFDSRSAYEVTVLTNGSIVASFQALKQ-PPSGELLLNRMRSKPFRLGTIKVPPVITEETDKNGAVTVSGPEIVLAKALLNRLNVSYNITLFDLGVGEEVDGRWTGIFGLLEEWDIDLLVGPFSETWDRSKSFLSTSPIRSITYNYMYLRPSLKASLQIFQFVVAFDGYTWLLIFITAALFAGALTLLHKISPNTLSYTIHPSMLFVFGYLFQGVRTRPPSQASSQILIVVWWFFCLVLVIAFCANYAAYRSFTALQTLPTTVFALLHQEYYKYAYINGSNMNMEMSVSLDPSIYALYTEINTKYKDVIPPNRSAGVDKV 482          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A068YLC6 (Glutamate receptor ionotropic kainate OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001066000 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.264e-41
Identity = 143/628 (22.77%), Postives = 277/628 (44.11%), Query Frame = 3
Query:  366 IQLAFGPSQYFQPSFFGFDSSNSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSYGN---YTQRPNVTIFDYAHNSDYSS----TVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAY---QLNAKTASVQIV--NGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYAN---GTQTGHSVEIIIK--ILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNAL 2198
            I +  GP  ++ P FF  +          S I    + F  +  ++ +  N + ++  +  + +  + +      P+       +L    G   + +  +        S IL  GA  I +++ +  +L++L    + N+      WLVF + ++      Y    N    +++ N  ++     +  P  +  +D++F D +++ ++ +    +  +P  + L T           +  W   +Y     ++++A    V  NG +   + +L     S + LLN MR+KPFR+  ++  P         G  T    EI++   +L+ LNV+YNIT ++L +G  V+G+  G+ G+ +    D+++GP +           T+ + + T   +Y   S      +F+FV AFD   W+LI ++ A++  +LTL++ ISPN   +T   S+LF  G + QGV T  P + S +IL V WW F + +++A+ ANY A  + + ++     +  L  Q  Y Y  I  S ++  ++     +I  +   I  ++ +++P   +A ID V         +AL+  +  ++ Y    C    S      Y + +P    Y  IIN +L  +
Sbjct:   90 IFVEIGPDYFYGPLFFPPEWKTGMNNVNRSRIVGFDLTFDVQNEVIKSAFNHLTSDIGVVKLAYFFDYAE-GGIHPFIHIEIFQFLEQKVGQFLLYQLRDFASVEDALSKILVDGANVIVLNVGQRAALKLLEKAQEKNILQQPFYWLVFNAGVTLSGVELYVGNANFFAVEFSTNGRFTEFPELSAIPKPITPKDLIFRDTAVVGLQRLARLLSKTVPNDITLITSTRDGMENPVIQLKWKFYSYVDTNFDSRSAYEVTVLNNGSIMASFQALKQ-PPSRELLLNRMRSKPFRLGTIKVPPVITEETDKTGAVTVSGPEIVLAKALLNRLNVSYNITIFDLGAGKEVDGRWTGVFGLLEEWDIDLLVGPFSETWDRSKSFLSTSPIRSITYNYMYLRPSLKASLQIFQFVVAFDGYTWLLIFITAALFAGALTLLHKISPNTLSYTIHPSMLFVFGYLFQGVRTRPPSQASSQILIVVWWFFCLVLVIAFCANYAAYRSFTALETLPTTIFTLLHQEYYKYAYINGSNMESMMRVPLDPTIHALYTEINTKFKDMIPPNRSAGIDKVIKGG-----FALLDESPFIEYYARKYCLETSSALWYGAYVFYMPKLLPYYKIINDELTLM 710          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A5K3EV18 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.404e-38
Identity = 141/563 (25.04%), Postives = 252/563 (44.76%), Query Frame = 3
Query:  606 NPMPYLSTFKGSLNIQKYYNQG--DGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSY-GNYTQRPNVTIF--DYAHNSDYSSTVN----PTILEEQDILFSDFSMMAVK----LMDSECNNPIP------PSLNLRTGQFTFTNAIYTRTSWILDA---YQLNAKTASVQIVNGIVTTDYNSLPLFNSST-QNLLNEMRAKPFRVAAMQEKPYAFYANGTQ------TGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSL---KPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNAL 2198
             P+ +L +  G    Q YY +       + S IL  GA  + + L +  +L++L+   + N+      WLVF + L+  GN     +   +  + + N  +         P  +   D++F D +++A+K    L+  +    +P         NL + + T T   Y+  +   DA   Y++  K       NG  T D N  PL  + T ++LL  M++KPFR+      P     +          G  + +  K+L  LNV++ IT ++L  G  V  +  G+ G  +    D+++GPI+     Q+    T+   + +   +Y   S      +F+FV AFD   W+LI ++  ++  SL L++ ISPN   ++   S++F  G +VQGV T  P++ S +IL   WW F + +++ + ANY A  + + ++        L  Q  Y+Y  I  S  +  ++ +   SI  + Q+I  ++AN +P     +++ V N   +L    P+   Y     K Y       L  GT    Y++ +P    Y +I+ A+L  +
Sbjct:   27 EPLQFLGS--GVGQFQVYYKREFPSSEEILSRILVDGATVLVLKLDQSNALKLLTMAQEKNILLTPFHWLVFNAGLTLSGNAYDVADANFYAVELSTNGKFQDYPEFNSIPKPVTTNDLIFRDMTVVALKKLSQLLAIQLTEDVPLITCTLSDPNLSSQELTPTWNFYSYVTTEFDASSTYRIERKP------NG--TVDGNFQPLKPTPTRESLLKLMQSKPFRIGTFVIPPLIELVDDQTNRTTRVQGPQIAVATKLLERLNVSFEITVFDLEVGEKVGDRWTGLFGHLEEWDIDLLVGPISLTWDRQADFQSTSPFQSISYKFIYMRPSLSGALQIFQFVVAFDGYTWLLIFITAVVFACSLALLHKISPNTLSYSIHPSMIFVFGYLVQGVRTRPPNRASSQILIAVWWFFCLVLVIGFCANYAAYRSFTALENLPSTDYSLLHQTYYTYAYINGSNTEEIMRATLDPSIYALYQSINMKFANKIPPNRTVALEQVLNGHFALIDESPFTDYYA----KKYCLETSVTLWHGT----YAFYMPKLLPYYDIVEAELKGM 571          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 115.546 bits (288), Expect = 6.329e-26
Identity = 108/446 (24.22%), Postives = 191/446 (42.83%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFY--------ANGTQTGHSVEIIIKILSSLNVTYNITFYELPS-GTLVN--GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F      RT + LD   L      K  + + VNG+  T+++      S   N+ N +  K  RVA + E+PY  +         N    G+ V+++ ++ S L   Y I   E    G L    G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + +  S+   + + + ++  ++M  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  374 TGRVLFNKTNGLRTEFDLDVISLKEDGLEKIGTWEPVNGLNMTEHH-----KSKMTNVTNSLSNKSLRVATILEEPYVMFKKSDKPLCGNDRFEGYCVDLLRELASILGFRYEIQLVEDGKYGALEESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDMVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGSTMAFFKKTKISTYDKMWEFMNSRRQSVMVKSVEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 807          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 102.064 bits (253), Expect = 8.639e-22
Identity = 102/439 (23.23%), Postives = 186/439 (42.37%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGI-VTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKI-NSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGISLTL------VNLISPN----QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFS 2240
            TG+ +F      RT + LD   +N K   ++ V     +   N   +   S  N+ + +  +   +  + E+PY        A   N    G  ++++ ++ S L   Y I    +P G        G+ NG++      +AD+ + P+T   V +  +D++       I ILY+  NST+     F F+      +W+ IL     VSC ++ I+          +  +P+    +  FT   S  F +GS++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM   +    DL +Q    YG + + A   F + S  S+ + +   + ++ +  +  +    I  V   D     YAL+  ++ ++  T   C +   G   +   Y    P  S Y + +  A L+ L+   L+ L  K++S
Sbjct:  325 TGRLSFNRTTGLRTDFDLDI--VNLKEDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRL--VPDGKYGFQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTN--SGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSD-----YALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWS 752          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 102.064 bits (253), Expect = 9.135e-22
Identity = 102/439 (23.23%), Postives = 186/439 (42.37%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGI-VTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKI-NSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGISLTL------VNLISPN----QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFS 2240
            TG+ +F      RT + LD   +N K   ++ V     +   N   +   S  N+ + +  +   +  + E+PY        A   N    G  ++++ ++ S L   Y I    +P G        G+ NG++      +AD+ + P+T   V +  +D++       I ILY+  NST+     F F+      +W+ IL     VSC ++ I+          +  +P+    +  FT   S  F +GS++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM   +    DL +Q    YG + + A   F + S  S+ + +   + ++ +  +  +    I  V   D     YAL+  ++ ++  T   C +   G   +   Y    P  S Y + +  A L+ L+   L+ L  K++S
Sbjct:  371 TGRLSFNRTTGLRTDFDLDI--VNLKEDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRL--VPDGKYGFQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTN--SGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSD-----YALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWS 798          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 101.679 bits (252), Expect = 1.155e-21
Identity = 102/439 (23.23%), Postives = 186/439 (42.37%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGI-VTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPY--------AFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLV----NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKI-NSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGISLTL------VNLISPN----QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFS 2240
            TG+ +F      RT + LD   +N K   ++ V     +   N   +   S  N+ + +  +   +  + E+PY        A   N    G  ++++ ++ S L   Y I    +P G        G+ NG++      +AD+ + P+T   V +  +D++       I ILY+  NST+     F F+      +W+ IL     VSC ++ I+          +  +P+    +  FT   S  F +GS++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM   +    DL +Q    YG + + A   F + S  S+ + +   + ++ +  +  +    I  V   D     YAL+  ++ ++  T   C +   G   +   Y    P  S Y + +  A L+ L+   L+ L  K++S
Sbjct:  373 TGRLSFNRTTGLRTDFDLDI--VNLKEDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRL--VPDGKYGFQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTN--SGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSD-----YALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWS 800          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-251b21.1 (probable glutamate receptor [Source:NCBI gene;Acc:103035003])

HSP 1 Score: 97.4413 bits (241), Expect = 8.894e-21
Identity = 75/298 (25.17%), Postives = 128/298 (42.95%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVN--GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTS--------------ASSSIQNVNQAI-RAQYANIMPTTFNASIDLV 2018
            +P +V  ++++PYA        G  ++++  + S L   Y +   +       N  G  NGM+G     +AD+ + P+T     ++ VD T       +  + + +          F+  F   +W+ ILV+  +    + L   ISP        ++ +FT   S  +T+G++        P  +SGR++   WW+F++ VL  Y AN  A L +   Q SI    DL  QN   YGTI  S+   F + S                S  Q++++ + RAQ  N      + S+DLV
Sbjct:   31 QPLKVTTIKQEPYAMSKGTELEGFCIDLLSALASKLGFKYELHVVKDGRYGAKNEQGTWNGMIGEVFRREADLAVAPLTLTASREAAVDMTKPFMQTGLSFIMRKDIASDDSQYLSFLNLFSTEMWLGILVAYLLTSFCIYLAARISPSEWEKPQADENQFTLSHSFWYTVGAITLQGAGPHPKALSGRLITAIWWLFSLMVLACYFANLSAWLHSDSNQLSIKSFEDLANQNIIQYGTIKGSSSLNFFKNSNNPIYRRVYENMERQQSYAQSMDEGVRRAQEGNYAFIGESVSLDLV 328          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 9.086e-17
Identity = 73/306 (23.86%), Postives = 134/306 (43.79%), Query Frame = 3
Query: 1395 NGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            N +AD+ + P+T N + +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P+         +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + S  S+ + +   + ++   ++       I  V   D     YA++  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:    7 NHKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTN--PGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNN-EEGIQRVLTTD-----YAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 304          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 75.8702 bits (185), Expect = 1.611e-14
Identity = 81/336 (24.11%), Postives = 130/336 (38.69%), Query Frame = 3
Query: 1371 NGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQ-----------------------------------------TKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTF-NASIDLVNNKDVSLKPYALIYGNSILKPYTS--LACYVLVSGTN--QVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYF 2237
            NGM+G    G+ADI I P+T +LV +  +D++    +  I I+ K         +  F+    Y +W+ I+ +     + L LV+  SP +                                          +F    S+ F++G+ +Q      P  +SGRI+   WW F + ++ +Y AN  A LT  RM   I    DL +Q   +YGT+ + +   F Q S       V + +     +  P  F   + D V+    S   YA +   S    YT     C  +  G N     Y  A P  S   + +N A L   +   L+ L  K++
Sbjct:   99 NGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIK-KPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKI----GVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLL-ESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWW 428          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.315e-11
Identity = 46/160 (28.75%), Postives = 76/160 (47.50%), Query Frame = 3
Query: 1530 NMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQ----------TKFTGGL-----SILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIR 1964
             +F+F+   + ++WI +L +CA   + L +++L+ P++          ++  G       S  F   +MV+  +  LP  ++G+I+   WW F + V   Y AN  A LT +  Q SI  L DL +Q    YGT     +  FL +SA      V + IR
Sbjct:   28 RIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLT-AEGQTSIRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIR 186          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 2.331e-10
Identity = 28/95 (29.47%), Postives = 50/95 (52.63%), Query Frame = 3
Query: 1665 SILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNV 1949
            S+ F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + S  S+ + +
Sbjct:   28 SLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKM 122          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 5.334e-10
Identity = 53/222 (23.87%), Postives = 101/222 (45.50%), Query Frame = 3
Query: 1221 MQEKPYAFYANGTQ------TGHSVEIIIKILSSLNVTYNITF-----YELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP-NQTKFTGGL--SILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVE 1844
            +QE+P+   A           G SV+++  +  SL  +Y I       Y LP     +G  +GM+G   N +AD+ I  +T     +S VD+T      ++G+  +  +      +F  +   +   W  + ++  + G+ + L+N ++P  + + +  L  S+    GS +Q         +S R++   WW+F   V+ +Y A+  A+LT +RM   I +
Sbjct:    1 LQEEPFVMLAENVLGKPKKFQGFSVDVMDALSKSLGFSYEIFMPADLSYGLPQA---DGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADS--AGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRREPRHSPSLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINRMDPPIRQ 217          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 93.2041 bits (230), Expect = 1.868e-19
Identity = 95/365 (26.03%), Postives = 158/365 (43.29%), Query Frame = 3
Query: 1284 IIKILSSLN--VTYNITFYELPSGTL-----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP-----------------NQTKFTGGLSILFTMGS-----MVQGVTTALPDKISGRILAVFWWIFNIAVLLA-YVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYV----LVSGTN-----QVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVC 2261
            +I +L  L+  + +N T Y  P G +     V G  +G++      +AD+ +GPIT        +D+T    T  IG++  + + +  K  F F+  F   +WI I  +    G+   L +++SP                 +  K    LS L ++ S     + QG     P   SGR     WW F I +L A Y AN  A LT +RMQ  I  + DL  Q   +YG + NS    F Q+S+    Q + + ++ + + + P T+ A    +  K      YA I+   IL+ Y +   Y     L+ G +       +Y +ALP  S YTN+++ ++  L  S +   + + +   + P  
Sbjct:  410 VIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVV--MGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWW-FVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRS-LQPDTYTAIERTLKGK------YAFIHDAPILE-YLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCA 763          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 92.0485 bits (227), Expect = 4.562e-19
Identity = 86/357 (24.09%), Postives = 162/357 (45.38%), Query Frame = 3
Query: 1257 TQTGHSVEIIIKILSSLNVTYNITFYELPS-GTL--VNG----KLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP-----------NQTKFTGGLSILFTMGSMV-QGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQN---TYSYGTIVNSAVD-YFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGT--NQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTK 2249
            T +G  ++++I++   +N TY+++  E  S G+L  VNG    + NGM+G    G+AD+++  +T N     +++++       + IL K N      ++  F+  F   +W+L+L+S  I  + L L++  SP            +T      ++ F+ G ++  G+    P   S R+L + W  F + ++ +Y AN  A L   R +  +  + D   +N    + Y T+ NS+VD YF +    SS+    +    + A          I+ V N ++     A I+ + +L    S  C +  +G    +  Y   +P  S ++N I+ A LN  +   +  L T +   +K
Sbjct:  438 TDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQS--NSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTA-------KEGIEKVKNGELK----AFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEELETTWIDASK 781          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 88.9669 bits (219), Expect = 1.027e-18
Identity = 89/385 (23.12%), Postives = 161/385 (41.82%), Query Frame = 3
Query: 1191 MRAKPFRVAAMQEKPYA--FYANGTQTGHSVEIIIKILSSLNVTYNITFYELPS-GTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTK-------------FTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSR-MQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSIL------KPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNAL--DPSFLNSLITKYFSTTKAPVCTST 2270
            ++ +PF    M  KP A     N    G S +++  +   LN  Y I   +  S G+ V G+  G++G     +ADI +GPIT     +  +D++       I ++ +   T    N+F F+  FD  +W+  L    +  + +  ++  SP   K             F+   S+ F + S++Q      P   SGR+LA  +W+F + ++  Y AN  A  T  R ++  I  L DL  Q+T  YG     ++  F   S       + Q +++Q   +  T +              +P+A +     L      KP  ++    L+      +Y+ A+  NS++TN+I+  +  L  +     S +  +  +++ P   ST
Sbjct:    6 LQDEPF----MMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQ-QPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETFVNGTQYGV-------LKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAK---SYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSECPTGPST 375          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 89.3521 bits (220), Expect = 3.483e-18
Identity = 94/389 (24.16%), Postives = 163/389 (41.90%), Query Frame = 3
Query: 1200 KPFRVAAMQEKPYAFYANGTQ---------TGHSVEIIIKILSSLNVTYNITFYELPSGTL-----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNL-----------------ISPNQTKFTGGLSILFTMGSMV-----QGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILK--PYTSLACYVLV-SGT--NQVNYSYALPFNSDYTNII-NAQLNALDPSFLNSLITKYFS 2240
            +  +V  + E P+ F    T           G+ +E++ K+   L   + +  Y +P         V  + NG++    NG+AD+ +  +T +   Q  +D+T       + +L K + T+  KN F  +  F Y +W+ I  +  I G  L L +                  I P   K    LS++  + S V     Q      P   SGRI    +W   + V+  Y AN  A LT  R    I  + DL +Q   SYGT++NS    F ++++  S   + Q +R  Y +         I+ V N++     YA I+ +++L+   +  ++C  L+ SG+   ++ Y + L  +S YT  + NA L      ++  L  K+  
Sbjct:  444 RTLKVVTIAEAPFIFAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEV--YLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTE-EKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMR--YHHTFVNNSAEGIEKVMNEN-----YAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLK 822          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J4])

HSP 1 Score: 69.3218 bits (168), Expect = 1.470e-13
Identity = 53/186 (28.49%), Postives = 82/186 (44.09%), Query Frame = 3
Query: 1401 QADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP-------------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQ 1919
            +AD+ + PIT     +S +D++     D +  L      +   ++F FV  FD  VW+LI+V      I + +V+L SP                +F    S+ F   SM+Q      P   SGRILA  +W F + ++  Y AN  A  T    +  I  L DL +Q   SYG +   ++  F +
Sbjct:    1 KADMALAPITITAERESKIDFSKPF-MDFMQSLIMKEMKEEEISLFAFVQPFDGTVWLLIIVVVLFVTIMMFVVDLWSPFGHRAEARITDEGAGDEFNLFNSLWFATASMLQQGPDNTPKSPSGRILASAFWFFILIIISTYTANLAAFFTKKTSKNFIETLDDLTKQKKISYGCLKGGSMASFFE 185          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 109.383 bits (272), Expect = 5.274e-24
Identity = 102/442 (23.08%), Postives = 182/442 (41.18%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYELPS-GTLVN--GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQ---------------TKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+  F  +   RT + LD   L  +    +I      +  N      S T N+ + +  K  RV+ + E+PY          Y N    G+ ++++ ++   L   Y +   E    G L    G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL++C      L ++   SP +                 FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + A   F + +  S+   + + + ++  ++M       I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  375 TGRVLFNKSNGLRTDFDLDVISLKEEGLE-KIGTWDPPSGLNMTETHKSKTSNITDSLANKSLRVSTILEEPYVMFKKSDKPLYGNDRFEGYCIDLLRELSGILGFRYELRLVEDGKYGALDESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLNPLSPDIWMYILLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSVMVKNVEEGIQRVLTSD-----YAFLMESTTIEFVTQRNCNLTQIGGLIDSRAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 808          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: si:ch211-251b21.1 (glutamate receptor U1 [Source:NCBI gene;Acc:101161808])

HSP 1 Score: 100.138 bits (248), Expect = 9.785e-22
Identity = 63/253 (24.90%), Postives = 117/253 (46.25%), Query Frame = 3
Query: 1197 AKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPS-GTL-VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISP--------NQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTS 1925
            AK   +  ++E PY         G+ +++I ++   L   Y +   +    G +  +G  NGM+G     +AD+ + P+T   V + +VD         +  + +  ++D  ++ F  +  F   +W+ +LVS  + G+ + LV  ISP        ++  FT   S  + +GS+        P  +SGR+++  WWIF + +L  Y AN+ +++ +   Q SI    DL  Q+   YGT+   +   F + S
Sbjct:   23 AKQLSITTIKEDPYTMSKGSGLEGYCIDLISELSKKLGFDYKVHVVKDNRYGAMDASGNWNGMIGELVRKEADLAVAPLTVTAVRERHVDMAAPFIHTGLSFITR-KASDSEESSFSLLAPFSTDMWVGLLVSFLLTGLCIYLVGRISPAEWAEPRTDEHSFTLLHSFWYIIGSLTLQGAGPHPKALSGRVISALWWIFCVLLLACYFANFSSVMQSKSRQVSISTFEDLANQDVIDYGTVEFGSTMLFFKNS 274          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grid1a (glutamate receptor ionotropic, delta-1 [Source:NCBI gene;Acc:101162392])

HSP 1 Score: 101.293 bits (251), Expect = 1.906e-21
Identity = 88/362 (24.31%), Postives = 158/362 (43.65%), Query Frame = 3
Query: 1191 MRAKPFRVAAMQEKPYAFYAN------GTQTGHSVEIIIKILSSLNVTYNITFYELPSGT----LVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGL------------SILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNN--KDVSLKPYALIYGNSILKPYTSLA---CYVLVSGT--NQVNYSYALPFNSDYTNIINAQL 2189
            M+    ++  + E+P+   A           G S++++  +   L   Y+I  Y++  G     L NG  NGM+G     +AD+ I  IT     +S VD++      ++GIL + +   +  N+F  +  FD  VW  I  +  + GI + L+  I   +     G             +I    G+ VQ  T +L   ++ RI+   WW+F + V  +Y AN  A LT SRM  ++  L DL +Q    YGT+ +SAV  + +   ++ ++  N              F  S+   +   +    + YA ++  ++++ Y +L    C + V G+  N   Y  AL   S Y ++ + ++
Sbjct:  435 MQGVTLKIVTLLEEPFVMAAENILGQPKRYKGFSIDVLDALAKILGFKYDI--YQVGDGKYGSMLPNGSWNGMIGELIGKRADLAISAITITPERESVVDFSKRYLDYSVGILMRKSEEKI--NIFSLLAPFDLAVWACIAAAIPVVGIMIFLLRRIQAVRCHNNAGGQPAPSASTSLQNAIWIVYGAFVQQGTDSLLGSVALRIVMGSWWLFTLIVCSSYTANLAAYLTVSRMDNAVRSLQDLSKQGDVVYGTVRDSAVYEYFRAKGTNPLEQDNTFAELWKVINKNNGFEYSVSSPSEGLRKAKRESYAFLWDMAVVE-YAALTDDDCTLTVGGSSLNTRGYGMALQHGSPYRDLFSQKI 791          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 99.3673 bits (246), Expect = 7.182e-21
Identity = 101/446 (22.65%), Postives = 187/446 (41.93%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVN---GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ +F  +   RT + LD   L      K       +G+  TD          T N+ + +  +   V+ + E+PY          Y N    G+ ++++ ++ S L  TY +   E     + +   G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P          +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + +  S+   + + + ++  ++M  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  359 TGRISFNKSNGLRTDFDLDVISLKEEGLEKIGIWDPSSGLNMTDNQ-----KGKTINVSDSLSNRSLIVSTILEEPYVMFRKSDTPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSD-----YAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 792          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 98.9821 bits (245), Expect = 7.987e-21
Identity = 101/446 (22.65%), Postives = 187/446 (41.93%), Query Frame = 3
Query: 1020 TGQFTFTNAIYTRTSWILDAYQLNA----KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYA--------FYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVN---GKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILY-KINSTDLYKNMFEFVFAFDYIVWILIL-----VSCAIYGIS-LTLVNLISPN---------QTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSG--TNQVNYSYALPFNSDYTNIIN-AQLNALDPSFLNSLITKYFSTTKAP 2255
            TG+ +F  +   RT + LD   L      K       +G+  TD          T N+ + +  +   V+ + E+PY          Y N    G+ ++++ ++ S L  TY +   E     + +   G+ NGM+    + +AD+ + P+    V +  +D++    T  I ILY K N T+    +F F+      +W+ IL     VSC ++ I+  +     +P          +  FT   S  F +G+++Q  +  +P  +S RI+   WW F + ++ +Y AN  A LT  RM+  I    DL +Q    YG + + +   F + +  S+   + + + ++  ++M  +    I  V   D     YA +  ++ ++  T   C +   G   +   Y    P  S Y + I  A L   +   L+ +  K++     P
Sbjct:  371 TGRISFNKSNGLRTDFDLDVISLKEEGLEKIGIWDPSSGLNMTDNQ-----KGKTINVSDSLSNRSLIVSTILEEPYVMFRKSDTPLYGNDRFEGYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTN--PGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSD-----YAFLTESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 804          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000065907.1 (SMESG000065907.1)

HSP 1 Score: 1455.66 bits (3767), Expect = 0.000e+0
Identity = 773/777 (99.49%), Postives = 777/777 (100.00%), Query Frame = 3
Query:  120 MKLFERTFKFLILYFVNISLVKCRTLRXXXXXXXXXXXXXXXIANLFQKIWSKCPTNYTISVVPYNLTAPFLSPENRNDFSTIQLAFGPSQYFQPSFFGFDSSNSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSYGNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYEFVTNKVNSLNVDKTAGMXXXXXXXXXXXXXXXXXXXXXRKCKKNENE 2450
            MKLFERTFKFLILYFVNISLVKCRTLRTTVTTNSVNFTNFQTIANLFQKIWSKCPTNYTISVVPYNLTAPFLSPENRNDFSTIQLAFGPSQYFQPSFFGFDSS+STFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSYGNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGI+LTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYEFVT++VNSLNVDKTAGMFIIMIFGVILAIIIGIIELIVRKCKKNENE
Sbjct:    1 MKLFERTFKFLILYFVNISLVKCRTLRTTVTTNSVNFTNFQTIANLFQKIWSKCPTNYTISVVPYNLTAPFLSPENRNDFSTIQLAFGPSQYFQPSFFGFDSSSSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSYGNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGIALTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYEFVTSQVNSLNVDKTAGMFIIMIFGVILAIIIGIIELIVRKCKKNENE 777          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000065489.1 (SMESG000065489.1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 343/623 (55.06%), Postives = 453/623 (72.71%), Query Frame = 3
Query:  600 SFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSY------GNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMD-SECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQLNA---KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYEFVTNKVNSLNVDKTAGMXXXXXXXXXXXXXXXXXXXXXRKCKK 2438
            ++NPMP LS+FKG ++I+KYY+ GDGVS+CSGIL+SG VTIAMDL+R G+L+VL++CND NL +W++RWL+FFS+LS+      GN   R NVTI+D+  NS+ S+ V   I +EQD + +D S   VKLMD SECN      LNL TG F+F N   TR +WI+D Y+ +    K     I NG ++ +  ++P FN + QN+L EM+ KPFRVA M EKP+ +Y   T  GHS++II  IL  LNVTYNIT+Y L +G L +GKL GM+GIAQNGQADIVIGPIT NL Y SYVD+T+ V    I I YK N+++ Y  +FEF+ AF++++W+LI+ SC IY I+LTLVNLISP++  F    SIL  MGS+VQGVTTALPD ISG+IL VFWWIFNIA+LLAYVANYGA LTN RMQ SI ++ DL  Q  Y+YGT++ SA+D FLQ+S S+ I N N+ IR+QY NIMP + + + +LVN       PYALIY +++L    + +C+ + +GT+  NYSYALPF SDYT IINAQ+N+L+ SF+  L  KYF T   P C +++W++ VL +LG EF+ N +NSLN++KTAG+FI+MIFG+ LA+I  +IELIVRKC+K
Sbjct:    4 AYNPMPLLSSFKGGVSIKKYYSNGDGVSICSGILSSGTVTIAMDLNRAGTLDVLNSCNDQNLLHWKMRWLIFFSTLSFAKTNIFGNLPLRQNVTIYDFPKNSETSTNVPQGITDEQDFVLTDISYTVVKLMDYSECNIDPGNILNLGTGNFSFNNGAVTRNNWIVDIYRPSGSLLKVGQAIIRNGAISLNQPNVPFFNLTAQNILKEMQTKPFRVAVMAEKPFGYYVGNTTVGHSIDIISLILGKLNVTYNITYYNLSNGLLSDGKLTGMLGIAQNGQADIVIGPITQNLKYISYVDFTDPVGQYFIAIGYKTNASNAYSQIFEFINAFNWVIWVLIIGSCIIYAIALTLVNLISPSKAHFNILYSILLMMGSLVQGVTTALPDTISGKILIVFWWIFNIAILLAYVANYGAYLTNLRMQSSIQQVGDLIAQTKYAYGTVIGSAIDTFLQSSTSTDILNTNKVIRSQYLNIMPNSLSEAFNLVNK-----TPYALIYHSTVLHSLGNSSCFSVSTGTDSFNYSYALPFKSDYTAIINAQINSLNSSFMMDLQNKYFPTYIQPACDTSSWIDLVLEVLGQEFLINPINSLNINKTAGIFIVMIFGMFLALISALIELIVRKCRK 621          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000065489.1 (SMESG000065489.1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/619 (55.09%), Postives = 449/619 (72.54%), Query Frame = 3
Query:  612 MPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVTIAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSY------GNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMD-SECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQLNA---KTASVQIVNGIVTTDYNSLPLFNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNSLITKYFSTTKAPVCTSTTWLNPVLNILGYEFVTNKVNSLNVDKTAGMXXXXXXXXXXXXXXXXXXXXXRKCKK 2438
            MP LS+FKG ++I+KYY+ GDGVS+CSGIL+SG VTIAMDL+R G+L+VL++CND NL +W++RWL+FFS+LS+      GN   R NVTI+D+  NS+ S+ V   I +EQD + +D S   VKLMD SECN      LNL TG F+F N   TR +WI+D Y+ +    K     I NG ++ +  ++P FN + QN+L EM+ KPFRVA M EKP+ +Y   T  GHS++II  IL  LNVTYNIT+Y L +G L +GKL GM+GIAQNGQADIVIGPIT NL Y SYVD+T+ V    I I YK N+++ Y  +FEF+ AF++++W+LI+ SC IY I+LTLVNLISP++  F    SIL  MGS+VQGVTTALPD ISG+IL VFWWIFNIA+LLAYVANYGA LTN RMQ SI ++ DL  Q  Y+YGT++ SA+D FLQ+S S+ I N N+ IR+QY NIMP + + + +LVN       PYALIY +++L    + +C+ + +GT+  NYSYALPF SDYT IINAQ+N+L+ SF+  L  KYF T   P C +++W++ VL +LG EF+ N +NSLN++KTAG+FI+MIFG+ LA+I  +IELIVRKC+K
Sbjct:    1 MPLLSSFKGGVSIKKYYSNGDGVSICSGILSSGTVTIAMDLNRAGTLDVLNSCNDQNLLHWKMRWLIFFSTLSFAKTNIFGNLPLRQNVTIYDFPKNSETSTNVPQGITDEQDFVLTDISYTVVKLMDYSECNIDPGNILNLGTGNFSFNNGAVTRNNWIVDIYRPSGSLLKVGQAIIRNGAISLNQPNVPFFNLTAQNILKEMQTKPFRVAVMAEKPFGYYVGNTTVGHSIDIISLILGKLNVTYNITYYNLSNGLLSDGKLTGMLGIAQNGQADIVIGPITQNLKYISYVDFTDPVGQYFIAIGYKTNASNAYSQIFEFINAFNWVIWVLIIGSCIIYAIALTLVNLISPSKAHFNILYSILLMMGSLVQGVTTALPDTISGKILIVFWWIFNIAILLAYVANYGAYLTNLRMQSSIQQVGDLIAQTKYAYGTVIGSAIDTFLQSSTSTDILNTNKVIRSQYLNIMPNSLSEAFNLVNK-----TPYALIYHSTVLHSLGNSSCFSVSTGTDSFNYSYALPFKSDYTAIINAQINSLNSSFMMDLQNKYFPTYIQPACDTSSWIDLVLEVLGQEFLINPINSLNINKTAGIFIVMIFGMFLALISALIELIVRKCRK 614          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000065494.1 (SMESG000065494.1)

HSP 1 Score: 145.206 bits (365), Expect = 6.685e-40
Identity = 80/162 (49.38%), Postives = 115/162 (70.99%), Query Frame = 3
Query:  120 MKLFERTFKFLILYFVNISLVKCRTLRXXXXXXXXXXXXXXXIANLFQKIWSKCPTNYTISVVPYNLTAPFLSPENRNDF-STIQLAFGPSQYFQPSFFGFDSSNSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNGSNVDPASPWKS 602
            M +    F  L+++ + +   KC+T+  TVT+ +VN +NF+ I N F  + SKCP++Y+++++P+NLTAPF SP N+N++   + L FGP+QYF P+FFGF+ + + FKF N+YI DS+MN S RL LMLT VN  VAND  K+V+F+LN SNVDP  PWK 
Sbjct:    1 MNIRTDIFISLLIFQICLQDTKCKTVNITVTSANVNISNFRAIINSFL-LTSKCPSSYSVNILPFNLTAPFASPINQNNYLKEVHLVFGPAQYFTPAFFGFNPTTTIFKFPNAYIQDSYMNLSLRLQLMLTAVNLAVANDADKNVLFILNASNVDPMQPWKG 161          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000047329.1 (SMESG000047329.1)

HSP 1 Score: 125.946 bits (315), Expect = 1.819e-29
Identity = 89/351 (25.36%), Postives = 169/351 (48.15%), Query Frame = 3
Query: 1158 FNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELPSGTL-----VNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDY-TNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTLVNLISPNQ-TKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQL 2189
            +N S  NLL    A  FR+  ++  P++F +NG+ TG +VE++  +L   N+    T+  LP   +      N   +G++G  QNG  D V  PI   +   +Y D+ TN +S + +G  YK +       +  ++  F++ +W  +L S A   I L + + + P++  ++   +S+ F+  S+  G     P ++ GR+L  FWW++ + V++ +V+NY A+L  +     +   SD+  QN Y Y T+ +  +  FL+ +A    Q + + +  +  N    T   +I ++         Y ++Y +  L   ++  C  +   +   +Y   LP  S+ T +I  +L
Sbjct:  345 YNLSASNLL----ATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNII--PTYVPLPIKNIGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGA-YKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVFFSFSSLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVIIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLYSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN------YIILYDDRTLYYQSTKNCLTMFGKSVYFDYGVVLPKFSEKTLVIRTKL 682          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.556e-2122.87glutamate ionotropic receptor kainate type subunit... [more]
GRIK21.663e-2122.87glutamate ionotropic receptor kainate type subunit... [more]
GRIK21.815e-2122.87glutamate ionotropic receptor kainate type subunit... [more]
GRIK21.947e-2122.87glutamate ionotropic receptor kainate type subunit... [more]
GRIK12.005e-2122.60glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-31.699e-2324.93GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-73.371e-2327.38GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-73.876e-2327.38GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-73.896e-2327.38GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-11.492e-2125.87Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D1.536e-2123.67gene:FBgn0038837 transcript:FBtr0083987[more]
Ekar4.677e-1823.65gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar1.015e-1624.18gene:FBgn0039916 transcript:FBtr0344874[more]
clumsy1.552e-1626.99gene:FBgn0026255 transcript:FBtr0110895[more]
Nmdar11.726e-1521.85gene:FBgn0010399 transcript:FBtr0078763[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-251b21.13.372e-2225.28si:ch211-251b21.1 [Source:ZFIN;Acc:ZDB-GENE-060809... [more]
grid1b5.428e-2224.57glutamate receptor, ionotropic, delta 1b [Source:Z... [more]
GRIK22.001e-2122.20glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK22.001e-2122.20glutamate receptor, ionotropic, kainate 2 [Source:... [more]
LO018303.14.232e-2123.76glutamate receptor ionotropic, kainate 3 [Source:N... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank16.353e-2423.93double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank16.395e-2423.93double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank12.831e-2325.16double zinc ribbon and ankyrin repeat domains 1 [S... [more]
ogfr3.498e-2123.87opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr6.779e-2123.87opioid growth factor receptor [Source:Xenbase;Acc:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik24.673e-2223.08glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik24.673e-2223.08glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik25.185e-2223.08glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik27.116e-2223.08glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
Grik27.116e-2223.08glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20262|GLRK_LITBE3.615e-2426.30Probable glutamate receptor OS=Lithobates berlandi... [more]
sp|P19439|GLRK_CHICK1.061e-2326.85Probable glutamate receptor OS=Gallus gallus OX=90... [more]
sp|Q90218|GLRK_ANAPL1.744e-2326.51Probable glutamate receptor OS=Anas platyrhynchos ... [more]
sp|Q91756|GLRK_XENLA3.579e-2124.84Glutamate receptor U1 OS=Xenopus laevis OX=8355 GN... [more]
sp|P42260|GRIK2_RAT3.683e-2123.09Glutamate receptor ionotropic, kainate 2 OS=Rattus... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WHH07.500e-4223.44Glutamate receptor ionotropic kainate OS=Echinococ... [more]
A0A5K3EXB08.264e-4224.54Uncharacterized protein OS=Mesocestoides corti OX=... [more]
W6UGF49.962e-4226.54Glutamate receptor U1 OS=Echinococcus granulosus O... [more]
A0A068YLC65.264e-4122.77Glutamate receptor ionotropic kainate OS=Echinococ... [more]
A0A5K3EV183.404e-3825.04Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000004586.26.329e-2624.22glutamate receptor ionotropic, kainate 2-like [Sou... [more]
GRIK38.639e-2223.23glutamate ionotropic receptor kainate type subunit... [more]
GRIK39.135e-2223.23glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.155e-2123.23glutamate ionotropic receptor kainate type subunit... [more]
si:ch211-251b21.18.894e-2125.17probable glutamate receptor [Source:NCBI gene;Acc:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005084.19.086e-1723.86pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b1.611e-1424.11glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000007790.12.315e-1128.75pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000002503.12.331e-1029.47pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000000621.15.334e-1023.87pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466331.868e-1926.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355454.562e-1924.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412911.027e-1823.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302033.483e-1824.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412901.470e-1328.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK25.274e-2423.08glutamate receptor ionotropic, kainate 2 [Source:N... [more]
si:ch211-251b21.19.785e-2224.90glutamate receptor U1 [Source:NCBI gene;Acc:101161... [more]
grid1a1.906e-2124.31glutamate receptor ionotropic, delta-1 [Source:NCB... [more]
GRIK27.182e-2122.65glutamate ionotropic receptor kainate type subunit... [more]
GRIK27.987e-2122.65glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065907.10.000e+099.49SMESG000065907.1[more]
SMESG000065489.10.000e+055.06SMESG000065489.1[more]
SMESG000065489.10.000e+055.09SMESG000065489.1[more]
SMESG000065494.16.685e-4049.38SMESG000065494.1[more]
SMESG000047329.11.819e-2925.36SMESG000047329.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002671 ID=SMED30002671|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2540bp
TAACTACAAAATAATTTTAGAAATTGTCATTCAGCACACTGTTCCATTTA
GCACAATCGATCTGATTGATTAAAATCAATGAACTGTGCCATAAAATTAA
ATGAACGTTGATTTAGAATATGAAGCTCTTTGAAAGAACATTCAAATTTT
TAATCTTATATTTTGTTAATATTTCACTGGTCAAATGCAGAACTTTGAGA
ACGACCGTTACGACAAATTCTGTCAATTTCACCAATTTTCAAACAATAGC
GAATTTATTTCAAAAAATTTGGTCAAAATGCCCAACAAATTATACAATAA
GTGTGGTTCCTTACAATTTGACAGCACCCTTTCTGTCTCCGGAAAATCGA
AATGATTTCTCAACAATCCAACTGGCCTTCGGTCCATCGCAATATTTCCA
ACCATCCTTTTTTGGATTTGATTCTTCAAACAGTACTTTTAAATTTAAAA
ACAGCTACATCGCGGATTCTTTTATGAATTTCTCAACTCGTTTAAATTTG
ATGTTGACTATTGTCAACAGAGTCGTTGCGAATGATCCCATAAAATCTGT
CGTTTTTGTATTGAATGGATCAAATGTGGATCCTGCCTCGCCATGGAAAA
GTTTCAACCCAATGCCTTATTTATCAACATTTAAAGGATCACTAAATATT
CAAAAATATTACAATCAAGGTGATGGGGTAAGTGTATGCTCTGGAATCCT
GGCTAGTGGAGCTGTTACTATAGCAATGGATCTAAGTAGAATTGGTTCCC
TTGAGGTGCTATCGGCTTGCAATGACCTTAATTTACAAAATTGGCGAATA
AGATGGCTGGTATTCTTTTCGTCACTTTCATATGGGAATTATACTCAAAG
GCCCAATGTAACTATTTTTGATTATGCTCATAACAGTGACTACAGCTCAA
CAGTTAACCCAACGATTTTGGAAGAGCAAGATATTTTATTTTCAGACTTT
TCTATGATGGCGGTAAAACTGATGGATTCTGAATGCAATAATCCAATACC
CCCTAGCCTAAATTTGAGAACCGGTCAATTTACTTTTACTAATGCGATAT
ATACAAGGACAAGCTGGATTCTTGATGCCTATCAACTGAATGCAAAGACC
GCTTCTGTACAAATAGTGAATGGAATTGTAACTACTGATTATAATTCTCT
TCCTCTCTTCAACAGCTCCACACAGAATCTGTTGAATGAAATGCGAGCCA
AACCATTTAGAGTCGCTGCAATGCAAGAAAAACCTTATGCCTTTTATGCC
AATGGAACCCAAACTGGACACAGTGTAGAAATAATCATAAAGATTTTGTC
TAGCTTGAATGTCACATATAATATAACTTTCTATGAACTTCCAAGCGGAA
CTTTGGTAAATGGAAAATTAAATGGAATGATGGGCATAGCGCAAAATGGG
CAAGCGGACATAGTCATTGGGCCGATCACCACAAACTTGGTCTATCAATC
TTATGTGGATTATACCAATGTTGTTTCTACAGACACAATCGGAATTCTCT
ATAAAATTAATAGCACTGATTTATATAAAAACATGTTTGAATTCGTATTT
GCATTCGATTATATTGTTTGGATACTCATATTGGTCAGTTGTGCCATTTA
TGGAATTTCACTAACTTTAGTCAATTTGATAAGCCCAAATCAAACCAAAT
TTACAGGTGGATTATCAATTCTATTTACAATGGGGTCCATGGTCCAAGGT
GTTACTACCGCTTTGCCGGATAAAATTTCGGGACGAATACTCGCTGTATT
TTGGTGGATATTCAACATAGCTGTCCTTCTGGCATATGTTGCTAATTATG
GTGCAATCCTTACAAATAGCCGAATGCAAGGGTCCATCGTAGAACTGTCC
GATCTTTTTCAACAAAATACTTATTCGTATGGAACGATAGTCAACTCGGC
CGTGGATTATTTTCTTCAAACTAGTGCTTCGTCCAGTATCCAAAATGTCA
ACCAAGCCATCAGAGCACAATATGCAAACATAATGCCTACTACATTCAAT
GCATCTATAGACCTTGTCAACAATAAAGACGTTTCATTGAAACCTTATGC
TTTAATATATGGAAATTCAATTTTGAAACCATATACAAGTTTGGCCTGCT
ATGTCCTTGTATCTGGAACCAATCAGGTCAATTATTCATATGCACTTCCG
TTCAACAGTGATTATACTAATATCATTAATGCACAGTTAAATGCTCTTGA
TCCTTCGTTTCTCAATAGCCTTATAACAAAATATTTCTCGACTACAAAGG
CCCCTGTTTGCACCTCCACAACTTGGTTAAACCCAGTTTTAAACATACTT
GGATATGAGTTTGTTACCAACAAAGTTAATTCGCTAAATGTCGACAAAAC
CGCAGGAATGTTTATCATAATGATATTTGGGGTTATTCTTGCTATAATTA
TTGGGATCATTGAGCTAATTGTGAGAAAATGCAAAAAGAATGAAAATGAA
TAACGAAGAATGGTTTTAATAGAAAAAAATCCAAAACATCTCACTTTATT
TTACTTTATTGTCATGCAAACTATTTCAGGTTCTAAATAC
back to top

protein sequence of SMED30002671-orf-1

>SMED30002671-orf-1 ID=SMED30002671-orf-1|Name=SMED30002671-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=778bp
MKLFERTFKFLILYFVNISLVKCRTLRTTVTTNSVNFTNFQTIANLFQKI
WSKCPTNYTISVVPYNLTAPFLSPENRNDFSTIQLAFGPSQYFQPSFFGF
DSSNSTFKFKNSYIADSFMNFSTRLNLMLTIVNRVVANDPIKSVVFVLNG
SNVDPASPWKSFNPMPYLSTFKGSLNIQKYYNQGDGVSVCSGILASGAVT
IAMDLSRIGSLEVLSACNDLNLQNWRIRWLVFFSSLSYGNYTQRPNVTIF
DYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLR
TGQFTFTNAIYTRTSWILDAYQLNAKTASVQIVNGIVTTDYNSLPLFNSS
TQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTY
NITFYELPSGTLVNGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDYTN
VVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGISLTL
VNLISPNQTKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNI
AVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQ
TSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNS
ILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNS
LITKYFSTTKAPVCTSTTWLNPVLNILGYEFVTNKVNSLNVDKTAGMFII
MIFGVILAIIIGIIELIVRKCKKNENE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 466..765
e-value: 1.4E-55
score: 190.5
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 456..672
e-value: 1.4E-55
score: 190.5
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 382..711
e-value: 1.4E-55
score: 190.5
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 326..768
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 326..768
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.644
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 361..707
NoneNo IPR availableTMHMMTMhelixcoord: 511..532
NoneNo IPR availableTMHMMTMhelixcoord: 542..564
NoneNo IPR availableTMHMMTMhelixcoord: 482..504
NoneNo IPR availableTMHMMTMhelixcoord: 643..665
NoneNo IPR availableTMHMMTMhelixcoord: 746..768
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 363..463
e-value: 4.3E-9
score: 36.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 483..755
e-value: 1.5E-19
score: 70.3