Hemocytin

Overview
NameHemocytin
Smed IDSMED30002668
Length (bp)6365
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hemocytin (SMED30002668) t-SNE clustered cells

Violin plots show distribution of expression levels for Hemocytin (SMED30002668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hemocytin (SMED30002668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hemocytin (SMED30002668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_004757SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_004757SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_002272SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_013410SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_013410SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_019354SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 SmedASXL_019354SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002668h1SMcG0015593 Contig21652uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002668h1SMcG0015593 Contig21652newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30002668h1SMcG0015593 dd_Smed_v4_305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002668h1SMcG0015593 dd_Smed_v4_305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002668h1SMcG0015593 dd_Smed_v4_305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002668h1SMcG0015593 dd_Smed_v4_305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002668h1SMcG0015593 dd_Smed_v4_13106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 dd_Smed_v6_13106_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 dd_Smed_v6_305_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 dd_Smed_v6_18786_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30002668h1SMcG0015593 dd_Smed_v6_3183_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hemocytin vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 437.573 bits (1124), Expect = 6.047e-123
Identity = 343/1192 (28.78%), Postives = 516/1192 (43.29%), Query Frame = 2
Query:  449 VNKSSDDCEITI-KFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGD-DKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAI----------QMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGL--KIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCP---VICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDN-NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-PYL--GTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIGTKS-CISDC--MEGCY--CKNNTYLKDD---ECVS---EKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            + +S +    T+ + L K       L+   V V       P+S++   I     Y  V+    L + +N   S+ +        + CGLCG ++G     +  + +  + P+E   +  K+     +     P+P            ++++  L   + C  +V +    + E C  + C  ++      +   +A  S        +  DWR    C +  CPN M + +C + C + C        C   C  GC+C +        +  C    +C C Y  +A     Y  G      C NC C S G W C     C   C + G  HF TFD +   V G C Y+   P     D    +++ E + C  ++  TC K + +       QT + IK+  EV +N     +P        +++F+ ++  +  +   G   ++      ++ + L+ K   +  GLCGNFN    DD     G      +     ++    C    +R S+   C  S+E  K A   C +     G F  C A V    + + C  D CNC       + +C C+A S+Y   C+ KG+Q   WR    C      CPK+M Y    S+C  TCR       D  C      +DGC CP    +++ TG CV+  +C C + G      E   D    CTC +G  +C     +    C    V+ DC          GCQ++C  +++ C    C PGC C  G V D    CI   +CPC     S+     I  G   C  +CTC S  W C    C   C  +G+ HY++FDG+ + F+GDC Y L++++C  K  T   F++V ENV CG+ GT+C+K+I+ +     + L  G   +IG + +   PY     GI+   D    +V++       WD++ S+ + L+PE+K  VCGLCGNFDD   ND   R+  +  DV  F +SWKL  SCP     K+PC  N FR+SWA K+CSIL   TF  CH  V    YY+ CV D+CACD G DC C CTA++ Y   C+   + + WR    CP+ C    P+ +    Y+PC   C  TC   +  C+ D   +EGCY  C     + D+   +CV+     PL       GK Y  G  V   KNC  C C   G EC
Sbjct:  122 LRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFG-NLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQL--FSGCVALVDV--GSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAA-----YAPGATYSTDCTNCTC-SGGRWSCQ-EVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKP----CDSSAFTVLAELRRCGLTDSETCLKSVTLSLDGA--QTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPN--IRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNC-----ERSEDCLCAALSSYVHACAAKGVQLGGWRD-GVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSE--GDITCSVGFIPVDGCICPKGTFLDD-TGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQ-APAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---CN-TCTCDSRMWRCTDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLL-------WDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVEC 1268          

HSP 2 Score: 122.094 bits (305), Expect = 1.293e-26
Identity = 104/397 (26.20%), Postives = 162/397 (40.81%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHIIHLIRGAA------PIIGRNPTWSP-YLGTGIFSKHDYVSSIVIITKELKIQW---DRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSCPYPE-------------ISKNPCDINKFRESWAIKR--------CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM-------EGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLGTTVIKNCHKCTCQ 3799
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++++N  CG++ G SC +SI   Y    + L R          II  N   SP +   GI      V     I  EL +Q        SV+V  + ++ NN  G CG   ++  ++ R   G + A  +  +  W +    + +C  P               +  P  +                   C ++ S+ FEPCH  +   L+Y+ CV D C      D   VC+++  Y   C  ++I I WR      CP  CP D+ Y+PC    P  C G  S     +       EGC+C     L         P     C    G+   +G TV  +C +CTC+
Sbjct: 4912 CHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATI-PELGVQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRC---HMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCE 5302          

HSP 3 Score: 121.324 bits (303), Expect = 1.855e-26
Identity = 94/360 (26.11%), Postives = 148/360 (41.11%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDN--VDNDLRNRAGIIDADVNAFADSWKLKTSC--PYPEISKNPCDINKFRESWAIKRC-SILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRY-NIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEK 3823
            +C  WG  HY +FDG  F F G C+YV  E +C      F I +   +  +  T     +       +I L +G+  ++  +P   P+  +G+  +     + V     L + W+   S+ + L  +Y N  CGLCG+F+    V   L +   +   +             C  P PE  +N C       S     C  +L  + F  C   V    Y + C QD C C+  D   CVC  +++Y  +C     +   WR  + CP  CP + +Y  C   C +TC     +++C   C+ GC+C   T L D       P+  C    +G  Y  G T   +C  CTC    + C++
Sbjct:   80 VCSTWGSFHYKTFDGDVFRFPGLCNYVFSE-HCGAAYEDFNIQLRRSQESAAPT--LSRVLMKVDGVVIQLTKGSV-LVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRN-C-------STGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQE 427          

HSP 4 Score: 93.2041 bits (230), Expect = 6.911e-18
Identity = 95/408 (23.28%), Postives = 157/408 (38.48%), Query Frame = 2
Query: 1346 HDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLT----QTCH---------------GEVLRQSYLG---LCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATC------RLRQRPNCDNDCIDGCQCPDDMVIEEKTGN-CVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGLWNCT 2464
            H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++V+N FC   + ++C + I + + +    L +  +      E+I N+K+V+ P     G+ +S   V       E G +  +F      +E+  S K+A    G CG    D +D+   P G      SE++  + ++      CH                  +  + +G   +  T+     + + +C       F+ C  ++P   F   C  D C+       + ++  CS+   YA +C+   I   WR  T   CP  CP + VY+ CG S  + C       L   P       +GC CP+ M +   +   CV     +C    G            C  CTC    W  T
Sbjct: 4914 HYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVS-PGFRKNGIVVSRIGVKMYATIPELG-VQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCH------MTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEA-GPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCEAATWTLT 5309          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC5AC (mucin 5AC, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7515])

HSP 1 Score: 437.573 bits (1124), Expect = 6.047e-123
Identity = 343/1192 (28.78%), Postives = 516/1192 (43.29%), Query Frame = 2
Query:  449 VNKSSDDCEITI-KFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGD-DKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAI----------QMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGL--KIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCP---VICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDN-NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-PYL--GTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIGTKS-CISDC--MEGCY--CKNNTYLKDD---ECVS---EKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            + +S +    T+ + L K       L+   V V       P+S++   I     Y  V+    L + +N   S+ +        + CGLCG ++G     +  + +  + P+E   +  K+     +     P+P            ++++  L   + C  +V +    + E C  + C  ++      +   +A  S        +  DWR    C +  CPN M + +C + C + C        C   C  GC+C +        +  C    +C C Y  +A     Y  G      C NC C S G W C     C   C + G  HF TFD +   V G C Y+   P     D    +++ E + C  ++  TC K + +       QT + IK+  EV +N     +P        +++F+ ++  +  +   G   ++      ++ + L+ K   +  GLCGNFN    DD     G      +     ++    C    +R S+   C  S+E  K A   C +     G F  C A V    + + C  D CNC       + +C C+A S+Y   C+ KG+Q   WR    C      CPK+M Y    S+C  TCR       D  C      +DGC CP    +++ TG CV+  +C C + G      E   D    CTC +G  +C     +    C    V+ DC          GCQ++C  +++ C    C PGC C  G V D    CI   +CPC     S+     I  G   C  +CTC S  W C    C   C  +G+ HY++FDG+ + F+GDC Y L++++C  K  T   F++V ENV CG+ GT+C+K+I+ +     + L  G   +IG + +   PY     GI+   D    +V++       WD++ S+ + L+PE+K  VCGLCGNFDD   ND   R+  +  DV  F +SWKL  SCP     K+PC  N FR+SWA K+CSIL   TF  CH  V    YY+ CV D+CACD G DC C CTA++ Y   C+   + + WR    CP+ C    P+ +    Y+PC   C  TC   +  C+ D   +EGCY  C     + D+   +CV+     PL       GK Y  G  V   KNC  C C   G EC
Sbjct:  122 LRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFG-NLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQL--FSGCVALVDV--GSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAA-----YAPGATYSTDCTNCTC-SGGRWSCQ-EVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKP----CDSSAFTVLAELRRCGLTDSETCLKSVTLSLDGA--QTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPN--IRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNC-----ERSEDCLCAALSSYVHACAAKGVQLGGWRD-GVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSE--GDITCSVGFIPVDGCICPKGTFLDD-TGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQ-APAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---CN-TCTCDSRMWRCTDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLL-------WDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVEC 1268          

HSP 2 Score: 122.094 bits (305), Expect = 1.293e-26
Identity = 104/397 (26.20%), Postives = 162/397 (40.81%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHIIHLIRGAA------PIIGRNPTWSP-YLGTGIFSKHDYVSSIVIITKELKIQW---DRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSCPYPE-------------ISKNPCDINKFRESWAIKR--------CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM-------EGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLGTTVIKNCHKCTCQ 3799
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++++N  CG++ G SC +SI   Y    + L R          II  N   SP +   GI      V     I  EL +Q        SV+V  + ++ NN  G CG   ++  ++ R   G + A  +  +  W +    + +C  P               +  P  +                   C ++ S+ FEPCH  +   L+Y+ CV D C      D   VC+++  Y   C  ++I I WR      CP  CP D+ Y+PC    P  C G  S     +       EGC+C     L         P     C    G+   +G TV  +C +CTC+
Sbjct: 4912 CHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATI-PELGVQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRC---HMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCE 5302          

HSP 3 Score: 121.324 bits (303), Expect = 1.855e-26
Identity = 94/360 (26.11%), Postives = 148/360 (41.11%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDN--VDNDLRNRAGIIDADVNAFADSWKLKTSC--PYPEISKNPCDINKFRESWAIKRC-SILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRY-NIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEK 3823
            +C  WG  HY +FDG  F F G C+YV  E +C      F I +   +  +  T     +       +I L +G+  ++  +P   P+  +G+  +     + V     L + W+   S+ + L  +Y N  CGLCG+F+    V   L +   +   +             C  P PE  +N C       S     C  +L  + F  C   V    Y + C QD C C+  D   CVC  +++Y  +C     +   WR  + CP  CP + +Y  C   C +TC     +++C   C+ GC+C   T L D       P+  C    +G  Y  G T   +C  CTC    + C++
Sbjct:   80 VCSTWGSFHYKTFDGDVFRFPGLCNYVFSE-HCGAAYEDFNIQLRRSQESAAPT--LSRVLMKVDGVVIQLTKGSV-LVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRN-C-------STGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQE 427          

HSP 4 Score: 93.2041 bits (230), Expect = 6.911e-18
Identity = 95/408 (23.28%), Postives = 157/408 (38.48%), Query Frame = 2
Query: 1346 HDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLT----QTCH---------------GEVLRQSYLG---LCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATC------RLRQRPNCDNDCIDGCQCPDDMVIEEKTGN-CVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGLWNCT 2464
            H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++V+N FC   + ++C + I + + +    L +  +      E+I N+K+V+ P     G+ +S   V       E G +  +F      +E+  S K+A    G CG    D +D+   P G      SE++  + ++      CH                  +  + +G   +  T+     + + +C       F+ C  ++P   F   C  D C+       + ++  CS+   YA +C+   I   WR  T   CP  CP + VY+ CG S  + C       L   P       +GC CP+ M +   +   CV     +C    G            C  CTC    W  T
Sbjct: 4914 HYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVS-PGFRKNGIVVSRIGVKMYATIPELG-VQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCH------MTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEA-GPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCEAATWTLT 5309          
BLAST of Hemocytin vs. Ensembl Human
Match: MUC5B (mucin 5B, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7516])

HSP 1 Score: 434.876 bits (1117), Expect = 4.251e-122
Identity = 332/1154 (28.77%), Postives = 500/1154 (43.33%), Query Frame = 2
Query:  563 FPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDG-NGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP-AIQMVNCDLNEMATCAKVVSIFGSKFEEI------------CYAEFCQMKNQKNS--CELMRDIAFLS-SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELV--LSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVI--CPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLG---TGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP-------PDREYKPCEKVCPETCIG-TKSCISDC--MEGCYCK---NNTYLKDDE--CVSEKPLCTCKDESGKEYPLGTTV--IKNCHKCTCQINGFECEKEL 3829
             PYS+    +   G Y+ V     L   +N + S  +        Q CGLCG ++G    ++F   +A + P++           +       PDP  +   NC  +E   C +  ++ G  F E             C  + C+      +   E  R  A     P N    WR    C    CP  M   +CG+ C + C        C   C  GC+C           + C    +CPC +        +Y  G      C +C C S GLW+C     C   C + G  H  T+D +   + G C Y  V+ K+        +++ E + C  +++  C K + +    G   T I +++   V +NS    +P        I++F  +S  + ++ G    +  +    +++   L   +  ++ GLCGNFN +  DD     G      +  A  ++    C     R S+   C  S+E    A   C +       F  C +++    F + C  D CNC       + +C C+A S+Y   C+ KG+Q   WR       +  CPK+  Y     +C  TCR       D  C      +DGC CP    + +  G CV  ++C C   G      E   D    C+C  G  +C        + C    V+ DC           C R+C  +++ C    C  GC C  G V D +  CI + +CPC     ++     I     +C  +CTCR+ +WEC  R C G C A+G+ H+++FDG  + F G C Y+L +DYC  N   GTF+IV EN+ CG+ GT+C+K+I+ + + + + L  G    + R P   P       GIF        +VI T  + + WDR+ SV + L  +YK  VCGLCGNFDDN  ND   R+  +  D   F +SWKL  SCP     K+PC  N FR+SWA K+CSIL   TF  C + V    YY+ CV D+CACD G DC C CTA++ Y   C+   + + WR  + CP+ C         +  Y+PC   C +TC   +  C+ D   +EGCY K   +  +  +D+  CV++   C C D+ G  Y +G  V   +NC  C C  +G +C   L
Sbjct:  157 LPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQ-----FGNLQKLDGPTEQCPDPLPLPAGNCT-DEEGICHR--TLLGPAFAECHALVDSTAYLAACAQDLCRCPTCPCATFVEYSRQCAHAGGQPRN----WRCPELCPR-TCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGR-----TYSPGTSFNTTCSSCTC-SGGLWQCQDL-PCPGTCSVQGGAHISTYDEKLYDLHGDCSY--VLSKKCADS--SFTVLAELRKCGLTDNENCLKAVTLSLDGG--DTAIRVQADGGVFLNSIYTQLPLS---AANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANA--RNSFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNC-----ERSEDCLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCR--GLSEADVTCSVSFVPVDGCTCPAGTFLND-AGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDCPCVHNEATYKPGETIR---VDCN-TCTCRNRRWECSHRLCLGTCVAYGDGHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARGPGGDPPYKIRYMGIF--------LVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQ---CGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSL 1256          

HSP 2 Score: 132.109 bits (331), Expect = 1.211e-29
Identity = 110/382 (28.80%), Postives = 163/382 (42.67%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIP-SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCET-----SIEWGKIANE--VCGKFGQG-QFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEEKT-GNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDC 2476
            C   GD H+ TFD       G C Y  V  +   +     ++ +      +   +T      ++  +GL    +   S   V+IN +   +P S+    VE S      D +K+    + +     +    L L  KYA +  GLCG+FNG P  +      A            RLT    G +  Q   G  E       +  G   +E  +C +   G  F +C ALV S  ++  C  D+C C          C C+ +  Y+R C+  G Q + WR PE CP  CP NM ++ECGS C+ TC   QR   C++ C+DGC CP   V+++ T   C+ +  C C + GR Y+        C++CTC  GLW C    C
Sbjct:   77 CSTWGDFHYKTFDGDVFRFPGLCNY--VFSEHCRAAYEDFNVQLRRGLVGSRPVVTRV----VIKAQGL----VLEASNGSVLINGQREELPYSRTGLLVEQS-----GDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNA------------RLTPLQFGNL--QKLDGPTEQCPDPLPLPAGNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCP--------TCPCATFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLPC 421          

HSP 3 Score: 109.768 bits (273), Expect = 6.989e-23
Identity = 96/358 (26.82%), Postives = 143/358 (39.94%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKH--DYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDD--NVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG+ HY +FDG  F F G C+YV  E +C      F + +     GS+       I+   +  ++    G+  I G+     PY  TG+  +   DY+   V I   L   W+ + S  + L P+Y N  CGLCG+F+     +    + A +                 CP P     P       +   I   ++L    F  CH  V    Y   C QD C C       C C    +Y  +C     + + WR  E CP  CP + +++ C   C +TC   +    C   C++GC+C   T L D       PL  C     G+ Y  GT+    C  CTC    ++C+
Sbjct:   76 VCSTWGDFHYKTFDGDVFRFPGLCNYVFSE-HCRAAYEDFNVQLRRGLVGSRPVVTRVVIK--AQGLVLEASNGSVLINGQREEL-PYSRTGLLVEQSGDYIK--VSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPL----PLPAGNCTDEEGICHRTLL-GPAFAECHALVDSTAYLAACAQDLCRCPT-----CPCATFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQ 417          

HSP 4 Score: 102.064 bits (253), Expect = 1.228e-20
Identity = 127/523 (24.28%), Postives = 194/523 (37.09%), Query Frame = 2
Query: 1337 CDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDIT---CAKGIKILFGE-GLNQTEIEIKSKTEVIINSKLVTIPSKINK-GVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANE----------VCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVI-EEKTGNCVKVEDCKC-------EYMGRDYNANEERKDRCNTCTCINGLWN--CTTKDCSSQSYCP-----------NGKVWKDCGGCQRTCRDMNLICDPNS---CEPG----CYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCE 2770
            CD H +C   C + G  H+ TFD       G C Y  V+ +EI +    LS+ ++N +C  S       C + + I +    +  T   +  K E +I    + + S  +K GV +SV   T+  + I A  +   F     +  L  S  +     G CG    +  DD +  DG  A    ++A  + +  +        +  G   T+     +++           +C       F +C  LVP   F   C  D C          +   C +  AYA +C  +G+   WR  T   C + CP   VYK CG    ATC  R +        +GC CP+D ++     G CV+   C C       ++ G  + +N      C +C C  G  +  C    C +Q   P             +    C  C  T    N    P S   C PG    C  E G+     +C P+    C + N +F        G   C + CTC SG  + P   C+
Sbjct: 5065 CDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTY--VLMREIHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSL-FHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPT--GTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHCR-------GRLEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQA--CPCVGPDGFPKFPGERWVSN------CQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPC--CPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQ---LCSY-NGTFYGVGATFPGALPCHM-CTCLSGDTQDPTVQCQ 5560          

HSP 5 Score: 100.523 bits (249), Expect = 4.546e-20
Identity = 86/373 (23.06%), Postives = 143/373 (38.34%), Query Frame = 2
Query: 2762 DCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS----CTKSIRFYYKDH-------IIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSC-------PYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSC--ISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            +CE +C  WG SHY +FDG  + F G+C+YVL+ +  + + G   + ++N  C +  T+    C +++  +YK         ++H       +  + P  S +   G+       +++ +    L   + ++ Q+         + NN  G CG   +N  +D   R G   A     A +W +    K  C       P    +                 C ++ S+ F  CHN V    +++ C+ D C   RG      C ++  Y   C    +   WR      C + CPP + YKPC  + P TC        +    EGC+C  +  L +         C C    G     G   + NC  C C
Sbjct: 5070 ECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMRE-IHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC---RGR-LEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGPDGFPKFPGERWVSNCQSCVC 5437          
BLAST of Hemocytin vs. Ensembl Human
Match: VWF (von Willebrand factor [Source:HGNC Symbol;Acc:HGNC:12726])

HSP 1 Score: 401.364 bits (1030), Expect = 4.974e-112
Identity = 310/1191 (26.03%), Postives = 510/1191 (42.82%), Query Frame = 2
Query:  476 ITIKFLFKDSIEATYLSSQGVKVGNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCDLNEMA-------TCAKVVSIFG--------SKFEEICYAEFCQ-MKNQKNSCELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSS---------------------------QSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPI--IGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP----YP-EISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP----------DREYKPCEKVCPETCIGTK--SCISDCMEGC--YCKNNTYLKD--DECVSEK--PLCTCKDE---SGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +++     +  +     +  V  G+   S PY SK  +  ++ G+Y             +  G+  V        + CGLCG ++   +D F T + ++       DF   W LS   +   +  P     N    EM           K  S+F           F  +C    C+     + +C  + + A   + + +V   W     C  P CP  M +  C + C   C   + +  C + C  GC C +     +  C  + ECPC +  S K+   Y  G  + + C  C+C +   W C ++++C   C++TG  HF +FDN++    G CQY+     +  S     SI++E   C +  D  C + + +    GL+ + +++K    V ++ + V +P  + KG ++ +    +  +++  G+   +      R+ + LS  YA K  GLCGN+NG+  DD + P G       +    ++L   C    L++ +   C  +    + + E C       F+ C   V    ++  C++DVC+C   R      C C A ++YA  C+ +G++  WR P  C + CPK  VY +CG+ C+ TCR    P+  C+  C++GC CP  + ++E+ G+CV    C C Y G  +   +   D    C C +G  +CT                                 +  CP   +  +   C +TC++ +L C    C  GC C  G V   N+C+    CPCF Q + +     +  G   C  +C C+  KW C    C+  C   G +HY++FDG  + F G+C YVL++DYC    GTF+I++ N  C      C K +    +   I L  G   +    ++ T    + +G +        I+++ K L + WDR LS+ V L   Y+  VCGLCGNFD   +NDL +    ++ D   F +SWK+ + C      P + S   C  N  +++     C IL S+ F+ C+  V  + Y D C+ D+C+C+   DC C C  I+ Y H C ++   + WR    CP  C            +  Y  C   C  TC   +  +C   C+EGC  +C     L +    CV  +  P+C        SGK+  L  +  ++C  C C +    CE
Sbjct:   82 VSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLT--SDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACS-PVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVH--SGKR---YPPGTSLSRDCNTCICRN-SQWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQDHS----FSIVIETVQCADDRDAVCTRSVTVRL-PGLHNSLVKLKHGAGVAMDGQDVQLP--LLKG-DLRIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSGLAEPRVEDFGNAWKLHGDCQD--LQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRE-----CLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDER-GDCVPKAQCPCYYDGEIFQPEDIFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIG---CN-TCVCQDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGRY-------IILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVDFGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPYLDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGYECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCE 1235          

HSP 2 Score: 131.724 bits (330), Expect = 1.199e-29
Identity = 121/453 (26.71%), Postives = 195/453 (43.05%), Query Frame = 2
Query: 1367 CIITGDP--HFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKI-EAGDLFSVFRKDDSRIELVLSAK-YARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARY---RLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRD------YNANEERKDRCNTCTCINGL-WNCTTKDCSSQ-----SYCPNGKVWKDCGGCQRTCRDMNLICDPNSCE--PGCYCESG---EVYDNNKCIPKGECPC 2653
            C+ TG    H VTFD Q+  + G C Y+    KE +     L +I+ N  C       C K I++      +   +E+ S  EV +N +LV++P  +   +E++V+      ++    G +F+ F   ++  +L LS K +A K  GLCG  + +  +D ++ DG    D   L   +   R  QTC   +  Q  +             +  C       F +C  ++    F   C+ D C+   +         C   ++YA +C   G+   WRTP+FC + CP ++VY  C   C   C      +C +   +GC CP D V+ E  G+CV  E C  + +G D        A       C  CTC++G   NCTT+ C +        C   ++ ++   C   C +   +CDP SC+  P  +CE G    + +  +C P   C C
Sbjct: 1948 CVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQD-----LEVILHNGACSPGARQGCMKSIEVKH----SALSVELHSDMEVTVNGRLVSVP-YVGGNMEVNVYGAIMHEVRFNHLGHIFT-FTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVP-----------DSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQEQV---------CEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCD-GNVSSCGDHPSEGCFCPPDKVMLE--GSCVPEEACT-QCIGEDGVQHQFLEAWVPDHQPCQICTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQC---CPEYECVCDPVSCDLPPVPHCERGLQPTLTNPGECRPNFTCAC 2362          

HSP 3 Score: 128.642 bits (322), Expect = 1.122e-28
Identity = 102/369 (27.64%), Postives = 165/369 (44.72%), Query Frame = 2
Query: 2759 RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHI-IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE---LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNP---CDINKFRESWAI-KRCSILKSET-FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            R     C  +G     +FDG  + F G CSY LL   C K+S +   +I + + G +      S+  Y  +   IHL        G      PY   G++ + +  +    ++ E      + D   +  V L+  Y N  CGLCGNF+   ++D   + G + +D   FA+SW L +   + E +  P   C+I+       + ++C +LKS + F  CH  V  + +   C +  C C  G +C   C A+ +Y   C +  + +  W ++  C  +CP   EY+ C   C  TC      + C   C++GC C     L +  CV E   C C   SGK YP GT++ ++C+ C C+ + + C  E
Sbjct:   29 RSSTARCSLFGSDFVNTFDGSMYSFAGYCSY-LLAGGCQKRSFS---IIGDFQNGKR-----VSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETE--AGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPLVDPEPFVALCEKTLCECAGGLEC--ACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGMEYRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCV-ESTECPCV-HSGKRYPPGTSLSRDCNTCICRNSQWICSNE 382          

HSP 4 Score: 122.479 bits (306), Expect = 9.041e-27
Identity = 100/386 (25.91%), Postives = 154/386 (39.90%), Query Frame = 2
Query: 2693 TRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHL-------IRG---AAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAI---KRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG-TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKN---CHKCTC 3796
            ++ P + + +C CR   W CP      +C      H ++FDG+ F   G CSYVL ++    K    ++++ N  C       C KSI   +    + L       + G   + P +G N   + Y       + +++  I   T +   ++  QLS   F +  Y     GLCG  D+N  ND   R G +  D       W ++     P  +  P       E   +     C +L    F  CH  +    +Y  C QDSC  ++      VC  I+ Y H C    + + WR  + C + CPP   Y  CE  CP  C G   SC     EGC+C  +  + +  CV E+    C  E G ++      + +   C  CTC
Sbjct: 1930 SQSPVKVEETCGCR---WTCP-----CVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQN----KEQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVYGAIMHEVRFNHLGHIFTFTPQ-NNEFQLQLSPKTFASKTY-----GLCGICDENGANDFMLRDGTVTTDWKTLVQEWTVQR----PGQTCQPI----LEEQCLVPDSSHCQVLLLPLFAECHKVLAPATFYAICQQDSCHQEQ------VCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHCDGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTC 2283          

HSP 5 Score: 55.0694 bits (131), Expect = 2.358e-6
Identity = 47/175 (26.86%), Postives = 81/175 (46.29%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTG--NMVLVQD-CMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYS-KAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW 808
            A C+ +    Y TFD +K +   F G    VLVQD C S P T++I+V       NK      +  K      +E   +    +  G ++   P   +  F++ + G Y+ +   K L++ +++  SI V    T +++VCGLCG +DG  ++   + +  +   E  +DF   W
Sbjct:  865 ATCSTIGMAHYLTFDGLKYL---FPGECQYVLVQDYCGSNPGTFRILV------GNKGCSHPSVKCKKRVTILVEGGEIE---LFDGEVNVKRPMKDETHFEVVESGRYIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVE--EDPVDFGNSW 1025          
BLAST of Hemocytin vs. Ensembl Human
Match: OTOGL (otogelin like [Source:HGNC Symbol;Acc:HGNC:26901])

HSP 1 Score: 383.259 bits (983), Expect = 1.410e-106
Identity = 306/1127 (27.15%), Postives = 468/1127 (41.53%), Query Frame = 2
Query:  335 FDRVKTVQTNFTGN--MVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMK--------PDPAIQMVNCDLNEMATCAKVVSI-FGSKFEEI--------CYAEFCQMKNQKNSCELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSK---INKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTP-EFCPVICPKNMVYKECGSSCSATCRLRQRP-NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY-CPNGKVWKDC---------GG--CQRTCRD--MNLICDPNS-CEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFS---------KHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC 3568
            F+    +   F GN   +  +DC    P Y + V     C+  S   C  +I   F +  E   +    +K   IS + P +  +  I     Y+ VK     ++ ++    I++      K + CGLCG Y+    D F  +       E    F   W SV   +  K        P+P    +         C  ++   F S  E I        C  + C+  + +  C    + A   S     + DWR         C +  +  DC + C   C F    +  +  C  GCYC          C   + CPC +   A     Y  G K+++ C  C+C   G+W C   D C  +C + GD HF TFD +H    G CQYI V  K    D  + +I ++   C  +  + C + I ++  +  N+       +  +    +++T P++   +N  VEI         LK   G L  +F  D  RI + L++ + R+  GLCG FNG+  DD + P G         A  +R++ TC   V     +  C  + +    A   C    Q  F  C   +    +   C+HD C CG        +C C+A + YA +C   G+   +RT   FC V+C K M+Y  C S C  +C     P  C +DC +GC CP+    E+    CV +  C+C Y G  Y   E        C C NG   C      S  + CP GK + DC         GG  C+ TC +  MN  C P+S C  GC C  G      KC     CPC W++  +    VI    +    +C CR G + C    C  +C  +G+ HY SFDG  +D+  DC   L++   +       ++ +N +C      C+KS+     D  I+L          N T      +G F          K  Y   +    K++ I WDR+ ++ + + P++KN + GLCGNFD    ND+     +   +   F DSW L   C  P+ +  PC+ ++ +  +A K CSIL S+ F  C N +    +   C +D+C C+ G DC C+CT+I+ Y ++C +  I I WR+   C + C
Sbjct:  122 FETFDGIYYYFPGNCSYIFAKDCGDLEPRYTVWVHNSPKCLG-SVYSCYRSISLFFSNQ-EEIRIYGHEIKKNGISLTLPQTIGQIFIEKLADYILVKTTFGFSLAWDGISGIYLKLSEDHKGKSCGLCGNYNDIQSDDFIILQEDYT--EDIAMFANSW-SVQTPDDTKCVLTPSDFPNPCSSGMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTDDDETYCRAATEYARACSHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDGLVMDNGTCISLENCPCGFHGLA-----YSVGSKIEQECTECVCVG-GVWNCTEQD-CPVQCSVVGDSHFTTFDGRHYSFIGMCQYILV--KGTGKD--KFTITLQKAPCEQNLGLVCLQSITLILEDDFNK-------QVTLGRGGQILTSPNQGFNLNGIVEIQTLSSLFILLKTTFG-LKILFAIDGERIYIQLTSAWKRRTLGLCGTFNGNIRDDFLSPSGMIEGTPQLHANAWRVSSTCFAPV-HVPVVDPCNINQQNIGYAAH-CDVIHQELFAPCHIYISPGLYYQLCRHDACKCGS-------SCLCNALAHYAYLCGQHGVPIDFRTQISFCAVVCQKGMLYHHCSSFCLHSCISLSSPEQCSDDCAEGCNCPEGKFYEDTLNFCVPIFHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVKCDELATPSAVHICPEGKEYFDCRFPDPELPAGGVNCETTCANLAMNFTCTPSSPCISGCVCAPGMAEHRGKCYVPESCPCIWKDWEYLSGEVIATPCY----TCVCRRGMFNCTYYPCPAVCTIYGDRHYYSFDGLEYDYISDCQVFLIK---SADDSDISVIAQNKKCFDNDIVCSKSVLISVGDTEIYL----------NDTPYKQKQSGFFLENKSTYQLWKAGYYIVVYFPEKDITILWDRKTTIHIKVGPQWKNKLSGLCGNFDKCTSNDMTTSNNLEVRNARVFGDSWALG-QCESPDETIKPCEAHQNKFPYAKKECSILYSDIFASCRNVIDVTSFAKNCHEDTCNCNLGGDCECLCTSIAAYAYKCCQEGISIHWRSSTVCSLDC 1197          

HSP 2 Score: 172.555 bits (436), Expect = 4.394e-42
Identity = 127/467 (27.19%), Postives = 205/467 (43.90%), Query Frame = 2
Query: 2492 CPNGKVWKDCGGC-------QRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHI---IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLS---VDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC--PYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRN-YENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKD--DECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEK 3823
            C +  V +DC  C       ++ C   NL      C  GCYC  G V DN  CI    CPC +   +++  + I +   EC   C C  G W C ++DC   C   G+SH+ +FDG+ + F G C Y+L++     K   F I ++   C    G  C +SI    +D     + L RG   +   N  ++     GI       S  +++     ++    +    + + LT  +K    GLCG F+ N+ +D  + +G+I+      A++W++ ++C  P      +PC+IN+    +A   C ++  E F PCH  +   LYY  C  D+C C       C+C A++ Y + C ++ + I +R     C ++C     Y  C   C  +CI   S   C  DC EGC C    + +D  + CV   P+  C+    G  Y  G  +      C C     +C++
Sbjct:  381 CDDSFVHRDCISCCPPTCTFEKQCLGSNL-----HCLDGCYCPDGLVMDNGTCISLENCPCGFHGLAYSVGSKIEQ---ECT-ECVCVGGVWNCTEQDCPVQCSVVGDSHFTTFDGRHYSFIGMCQYILVKGTGKDK---FTITLQKAPCEQNLGLVCLQSITLILEDDFNKQVTLGRGGQILTSPNQGFNL---NGIVEIQTLSSLFILLKTTFGLKILFAIDGERIYIQLTSAWKRRTLGLCGTFNGNIRDDFLSPSGMIEGTPQLHANAWRVSSTCFAPVHVPVVDPCNINQQNIGYA-AHCDVIHQELFAPCHIYISPGLYYQLCRHDACKCGSS----CLCNALAHYAYLCGQHGVPIDFRTQISFCAVVCQKGMLYHHCSSFCLHSCISLSSPEQCSDDCAEGCNCPEGKFYEDTLNFCV---PIFHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVKCDE 824          

HSP 3 Score: 133.265 bits (334), Expect = 3.674e-30
Identity = 100/366 (27.32%), Postives = 162/366 (44.26%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENV-ECGSKGTSCTKSIRFYYKDH-IIHLIRGAAPIIGRNPTWSPYLGTGIFSK-HDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS-----CPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WR-NYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD---CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            +G+CK WG+ H+ +FDG ++ F G+CSY+  +D C      + + + N  +C     SC +SI  ++ +   I +        G + T    +G     K  DY+  +V  T    + WD    + + L+ ++K   CGLCGN++D   +D          D+  FA+SW ++T         P    NPC            +C IL    F  CH  +   LY   CV D C   + DD    C A ++Y   C+     IQ WR ++  C   C     ++ C   CP TC   K C+     C++GCYC +   + +  C+S +  C C    G  Y +G+ + + C +C C    + C ++
Sbjct:  111 DGICKTWGQYHFETFDGIYYYFPGNCSYIFAKD-CGDLEPRYTVWVHNSPKCLGSVYSCYRSISLFFSNQEEIRIYGHEIKKNGISLTLPQTIGQIFIEKLADYI--LVKTTFGFSLAWDGISGIYLKLSEDHKGKSCGLCGNYNDIQSDDFIILQEDYTEDIAMFANSWSVQTPDDTKCVLTPSDFPNPCSSGMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLC---KTDDDETYCRAATEYARACSHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDGLVMDNGTCISLEN-CPCGFH-GLAYSVGSKIEQECTECVCVGGVWNCTEQ 468          

HSP 4 Score: 127.102 bits (318), Expect = 3.073e-28
Identity = 118/433 (27.25%), Postives = 180/433 (41.57%), Query Frame = 2
Query: 1262 DSYKFGDKMKKG-----CQN-CLCESRGLWKCDTHDQCSSRCIIT--------------GDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGE-VLRQS-YLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTP-EFCPVICPKNMVYKECGSSCSATCRLRQRPNCDN-DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            D+  +G+   KG     C N   C   G   C       +RC I               G  HF TFD  + +  G C YI    K+     P+ ++ V N         +C + I + F    NQ EI I    E+  N   +T+P  I    +I + K+ +D + ++    FS+     S I L LS  +  K  GLCGN+N    DD I+      +D +  A  + +      + VL  S +   C + +   +     C    Q  F  C   +    ++  C +D+C              C A + YAR CS  G   Q WR     C   C  + V+++C S C  TC   ++    N  C+DGC CPD +V++   G C+ +E+C C + G  Y+   + +  C  C C+ G+WNCT +DC  Q
Sbjct:   59 DAINWGESKIKGSCPYECLNGAFCSKTGTCDCQIFQALGTRCQIIPNMGNGRDGICKTWGQYHFETFDGIYYYFPGNCSYI--FAKDCGDLEPRYTVWVHNSPKCLGSVYSCYRSISLFFS---NQEEIRIYGH-EIKKNGISLTLPQTIG---QIFIEKL-ADYILVKTTFGFSLAWDGISGIYLKLSEDHKGKSCGLCGNYNDIQSDDFIILQEDYTEDIAMFANSWSVQTPDDTKCVLTPSDFPNPCSSGMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLC------KTDDDETYCRAATEYARACSHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDGLVMD--NGTCISLENCPCGFHGLAYSVGSKIEQECTECVCVGGVWNCTEQDCPVQ 473          

HSP 5 Score: 81.2629 bits (199), Expect = 2.602e-14
Identity = 96/371 (25.88%), Postives = 153/371 (41.24%), Query Frame = 2
Query: 2741 KWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLE----------DYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSV-DV-----FLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDA---DVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVC-PETCI-----GTKSCISDCMEGCYCKNNTYL---KDDECVSEKPLCTCKDESGKEYPLG 3760
            +WECP R     C    E   ++FDG     +   SY+L+           + C  N+   + K +  +   G     C K +      H I + R A  +   +        +   S  D  S  VI T   L I+W     + D+     F    Y   +CG+C   +++ D+DLR + G I     D+  F +SW+++ S  +    + P  +    E    +   +L    F PCH+ V  + + +K   +       +     C A+S YV  CN+++I IQWR  + C + CP  +EY+PC + C   TC+     G  SC+ +  E C CK  T L      +C+ EK  C C D   +    G
Sbjct: 1520 EWECPCR-----CSMLSELSIITFDGNNAALYSMASYILVRIPGEIIVAHIEKCSMNQNGNSLKKLAPS---GRISGLCFKKLNVTTPIHKIIVNRLARKVEVDSIVVPLPFSSQELSIEDSGSMYVITTPAGLIIKWSHLTGIIDIHFGFRFNLSSYTEGLCGIC---NEDPDDDLRMQNGTIITNMEDIGLFIESWEIEKS--FEVTMRRP--VRNCTEHDCSQCIDLLNRRIFIPCHDKVSPEDFCEKMWINYTYFWNYE-----CDALSAYVALCNKFDICIQWRTPDYCSLSCPEGKEYQPCVRPCEARTCLNQWFYGHTSCL-NLREDCVCKVGTILHRPHSAQCIPEKE-CACTDSEDQPRTAG 1868          

HSP 6 Score: 54.6842 bits (130), Expect = 2.765e-6
Identity = 82/358 (22.91%), Postives = 135/358 (37.71%), Query Frame = 2
Query: 1352 QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAV-MPKEIESDMPQLSIIVENKFCFNSEDITCAKG-IKILFGEGLNQTE-----IEIKSKTEVIINSKLVTIP---SKINKGVEISVFKVTSD-GLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGA--PAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCI---DGCQCPDDMVIEE-KTGNCVKVEDCKC 2374
            +C  RC +  +   +TFD  +  +     YI V +P EI     +   + +N    NS       G I  L  + LN T      I  +   +V ++S +V +P    +++     S++ +T+  GL I+   L  +       I        +    GLCG  N DP+DD  M +G      +D  L       +      +R+      E         ++      +  F  C   V  + F        C    +      N EC A SAY  +C+   I  QWRTP++C + CP+   Y+ C   C A   L Q       C+   + C C    ++    +  C+  ++C C
Sbjct: 1522 ECPCRCSMLSELSIITFDGNNAALYSMASYILVRIPGEIIVAHIEKCSMNQNG---NSLKKLAPSGRISGLCFKKLNVTTPIHKIIVNRLARKVEVDSIVVPLPFSSQELSIEDSGSMYVITTPAGLIIKWSHLTGIID-----IHFGFRFNLSSYTEGLCGICNEDPDDDLRMQNGTIITNMEDIGLFIESWEIEKSFEVTMRRPVRNCTEHD------CSQCIDLLNRRIFIPCHDKVSPEDF--------CEKMWINYTYFWNYECDALSAYVALCNKFDICIQWRTPDYCSLSCPEGKEYQPCVRPCEARTCLNQWFYGHTSCLNLREDCVCKVGTILHRPHSAQCIPEKECAC 1857          
BLAST of Hemocytin vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716849:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 77.0258 bits (188), Expect = 1.266e-13
Identity = 121/535 (22.62%), Postives = 204/535 (38.13%), Query Frame = 2
Query: 1391 FVTFDNQHIFVEGQCQYIAVMP-KEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEI--KSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGD----LFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAK------------------DDSELAARYRLTQT-----CHGEVLRQSYLGLCETSIEWGK------IANEVC-----GKFGQGQFKDCEALVPS--DKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF----QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEK-TGN--CVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQ-----LSCTCRSGKWECPKRDCEGLCKAWG--ESHYMSFDGKF 2824
            +VT+D      +G C Y+   P   + +     S+  +N+       I+    +++     L+   I +  +SKT ++   +++T     NK       + +     IE        F+ +     ++  +     A  + GL GN +G   DD +  +G+                     +D+ +  ++ + +       +G+ L  +      TSI   +       A++ C      + G G F  C+ L     + F   C +D+C     RN +    +C+ ++ + + C +   Q      WR    CP+ CP N     C SSC +TC       CD  C+DGC+C    VI+   TG+  C++++ C C  +  D NA+   K            W   T++C+    C NG +W D     R C D +  C  NS +  C C +G   D   C    EC         +   V T G + C      L   C + K   P+R C  L   WG  ES   S +  F
Sbjct:  196 YVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEV----DLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNN-TNCVSTSISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAF---KCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC--VDSDGNAHRPGKP-----------W--VTQNCTIYHECQNGTMWSD----YRPCSD-DGSCVLNSIDMQCKCNNGYRGDGYNCTDINEC-VETPGICGHGQCVNTPGSYHCTCDDFWLGDNCNTYK---PRRHCADLYVYWGVRESGVNSINPPF 693          

HSP 2 Score: 53.1434 bits (126), Expect = 2.781e-6
Identity = 96/433 (22.17%), Postives = 155/433 (35.80%), Query Frame = 2
Query: 2714 QLSCTCRSG-KWECPKRDCEGLCKAW---GESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTF--KIVIENVECGSKG--TSCTKSIRFYYKDHIIHLI-RGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDR----------QLSVDVFLTPEYK--NNVCGLCGNFDDNVDNDLRNRAGII-------------DADVNAFADSWKL---------------------KTSCPYPEIS--KNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQL--YYDKCVQDSCACDRGDDCLCVCTAISQYVHECN----RYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG--TKSCISDCMEGC-----YCKNNTYLKDDECVSEKPLCTCKDESGKEY-PLGTTVIKNC---HKC 3790
            QL+C C+ G       RDC+   +     G+ HY+++DG  FD+ G C YV  +  C      +    V    E   KG   S    +     +  IH+  R    ++      +P+      +K+ +   +        I+ D+           L V V   PE+     +CGL GN D    +D+ N+ G +              AD     D+W                        T+C    IS  ++  D+    ++    + + +   TF  C       L  +Y  C+ D C      +    CT  + ++  C     +  +   WR   NCP+ CP +     C   CP TC     + C   C++GC     Y  +NT     +C+     C C D  G  + P    V +NC   H+C
Sbjct:  163 QLNCICKPGYTARRNGRDCDMKVQQACMSGDPHYVTYDGLRFDYQGTCPYVFSQP-CTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWY---FPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVSTSISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICR-----NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLD-QCGCVDSDGNAHRPGKPWVTQNCTIYHEC 585          
BLAST of Hemocytin vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716824:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 75.8702 bits (185), Expect = 3.221e-13
Identity = 118/527 (22.39%), Postives = 200/527 (37.95%), Query Frame = 2
Query: 1391 FVTFDNQHIFVEGQCQYIAVMP-KEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEI--KSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGD----LFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAK------------------DDSELAARYRLTQTCHGEVLRQSYLGL---CETSIEWGKIANEVC-----GKFGQGQFKDCEALVPS--DKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF----QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEK-TGN--CVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQ-----LSCTCRSGKWECPKRDCEGLCKAWG--ESHYMSFDGKF 2824
            +VT+D      +G C Y+   P   + +     S+  +N+       I+    +++     L+   I +  +SKT ++   +++T     NK       + +     IE        F+ +     ++  +     A  + GL GN +G   DD +  +G+                     +D+ +  ++ + +      +    L     C+ +      A++ C      + G G F  C+ L     + F   C +D+C     RN +    +C+ ++ + + C +   Q      WR    CP+ CP N     C SSC +TC       CD  C+DGC+C    VI+   TG+  C++++ C C  +  D NA+   K            W   T++C+    C NG +W D     R C D +  C  NS +  C C +G   D   C    EC         +   V T G + C      L   C + K   P+R C  L   WG  ES   S +  F
Sbjct:  196 YVTYDGLRFDYQGTCPYVFSQPCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEV----DLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVAT-----ASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDIC-----RNPAF---KCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGC--VDSDGNAHRPGKP-----------W--VTQNCTIYHECQNGTMWSD----YRPCSD-DGSCVLNSIDMQCKCNNGYRGDGYNCTDINEC-VETPGICGHGQCVNTPGSYHCTCDDFWLGDNCNTYK---PRRHCADLYVYWGVRESGVNSINPPF 681          

HSP 2 Score: 57.3806 bits (137), Expect = 1.363e-7
Identity = 97/421 (23.04%), Postives = 153/421 (36.34%), Query Frame = 2
Query: 2714 QLSCTCRSG-KWECPKRDCEGLCKAW---GESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTF--KIVIENVECGSKG--TSCTKSIRFYYKDHIIHLI-RGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDR----------QLSVDVFLTPEYK--NNVCGLCGNFDDNVDNDLRNRAGII-------------DADVNAFADSW---KLKTSCPYPEISKNP--------CDINKFRESWAIKRCSILKSETFEPCHNTVRYQL--YYDKCVQDSCACDRGDDCLCVCTAISQYVHECN----RYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG--TKSCISDCMEGC-----YCKNNTYLKDDECVSEKPLCTCKDESGKEY-PLGTTVIKNC---HKC 3790
            QL+C C+ G       RDC+   +     G+ HY+++DG  FD+ G C YV  +  C      +    V    E   KG   S    +     +  IH+  R    ++      +P+      +K+ +   +        I+ D+           L V V   PE+     +CGL GN D    +D+ N+ G +              AD     D+W   K     P  E   N         CD+    ++    + + +   TF  C       L  +Y  C+ D C      +    CT  + ++  C     +  +   WR   NCP+ CP +     C   CP TC     + C   C++GC     Y  +NT     +C+     C C D  G  + P    V +NC   H+C
Sbjct:  163 QLNCICKPGYTARRNGRDCDMKVQQACMSGDPHYVTYDGLRFDYQGTCPYVFSQP-CTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWY---FPNKNTWTVRVRFSGSTFTIENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCDVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICR-----NPAFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPFPEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLD-QCGCVDSDGNAHRPGKPWVTQNCTIYHEC 573          
BLAST of Hemocytin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 410.223 bits (1053), Expect = 6.603e-115
Identity = 350/1260 (27.78%), Postives = 559/1260 (44.37%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIK--------DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQM-VNCDLNEMATCAKVVSI---------FGS--------KFEEICYAEFCQMKNQKN--SCE------LMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQY--IAVMPKEIESDMPQLSIIVENKFCFNS-EDITCAKGIKILF-GEGLNQTEIEIKSKTEVIINSK-LVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR-TPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEER----KDRCNTCTCINGLWNCTTKDCSSQ-SYCPNGKVWKDCGGCQ------------RTCRDMN-LICDPNSCEPGCYCESGEVYDNNK--CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIH-LIRGAAPIIGRNPTWSPY--LGTGIFSK-----HDYVSSIVIITK----ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPD-REYKPCEKVCP-ETC-------IGTKSC-ISDCMEGCYCK----NNTYLKDD--ECVSE---KPLCTCKDESGKEYPLG-TTVIKNCHKCTC 3796
            A CT   G + KTFD +   +   + +  L+ D +S   T+ II+   ++C   S   C  T+K L++ S+  T+ +  G     +  + P  K    +   G  V               L + ++ +  + V A   M  +V GLCG  DG  D   +    +   + T   F   W    R    + + + +M    D  E +   K VS+          G              C A++C   N+++  SC       L ++ AF      +   WR  L+    +C    ++  CG N    C  +         C  GC+C +    YK  C   + CPC  R        +K    +KK C  C C++ G W+C T D+C +RC   GDPH+ TFD +     G+C Y  +      +E++    S  V     F + +D +C K + I F       + I++      I+N K +  +P  +  G E+ + + +S  L +E  D   V+    SR+ +        +  GLCG FN + +DD + P+G         A ++R   TC  +         C  + E    A + C    Q  F+DC  LV  ++F   C +D C C          C C   SAY   C  +G++  WR + + C V CP   V+ ECG  C+ +C  L  + +C  +C++GC+CP    + E  G CV  + C C + G  +    +     +   + CTC +G+W+C   +   +  Y P+ ++   C                +TC++M+  + D + C PGC C  G VYD ++  C+    C C    +S+++   I     +C L C CR+G W+C K  CE  C  WG+SH+ +FDG  FDF G C YVL +   +   G F I I+NV CG+ G +C+KS+      H    L+  A      +P  +P   L   + SK     H Y + + ++ +    +L+++WD    V V L  E++  V GLCGN++ N  +D++  +  ++     F  +WKL+  C  P    + C  +  RE+WA  +C  LKS+ F+ CH  V  + ++ +C+ D+CACD+G DC C+CTA++ Y   C +  I I+WR+   CP+ C P   +YK C   C  ETC       I  + C   +C+EGC+ K       YL D   +CV +   KP+C  +D  GK +  G  T   +C  C C
Sbjct:  483 ALCTTWGGINMKTFDGL-VFKAPLSCSHTLITDKVSG--TFDIIL---KACPYGSGYGCAHTLKILWQ-SVLYTFENLNGT----MQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDG--DPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGI--KLEHGWR-NLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGK-----EFKPESTVKKNCNTCTCKN-GQWRC-TEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLG-EVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC----KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNED-GECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKE---DCNL-CECRAGNWKCSKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRD--GKTFYEGDITFTDSCATCRC 1706          

HSP 2 Score: 139.428 bits (350), Expect = 3.365e-32
Identity = 107/371 (28.84%), Postives = 169/371 (45.55%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKD--HIIHLIRGAAPI---IGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK--------TSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCAC-DRGDDCLCVCTAISQYVHECNRYNIKIQ--WRNYENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
             LC  WG  +  +FDG  F     CS+ L+ D   K SGTF I+++    GS G  C  +++  ++   +    + G   +   I + P     +G  +     +V  I + +  LK+ WD +  V V   P+    V GLCG  D + + DL +R G   A V AFAD+W+++         +    E   + C+ +K +++ ++    +L +E    C     Y      C+ D C C +R     C C AI+    EC    IK++  WRN E CPI C   R Y+ C      TC   +   +    C EGC+C   T    + C++ + LC C    GKE+   +TV KNC+ CTC+   + C ++
Sbjct:  483 ALCTTWGGINMKTFDGLVFKAPLSCSHTLITD---KVSGTFDIILKACPYGS-GYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQ-IDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCE-RLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRE-LCPCS-LRGKEFKPESTVKKNCNTCTCKNGQWRCTED 845          

HSP 3 Score: 115.161 bits (287), Expect = 5.966e-25
Identity = 127/515 (24.66%), Postives = 193/515 (37.48%), Query Frame = 2
Query: 2432 CTCINGLWNCTTKDCSSQ--SYCPNGKVWKDC--GGCQRTCRDMN---LICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGS-------KGTSCTKSIRFYYKDHIIHLIRGAAP-------IIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVF----LTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWK-------LKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS-----------------------CI-SDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQING 3808
            C  +N L   TT    +Q    CP+  V  DC    C+ +C +++       P++C PGCYC  G V     C+P  EC                                     +DC  +C + G S YM++D K F F+G+C+Y+L  D       TF++ +   +C         +G SC KS+     DH+IH+ R           + G      PY  + I  +      +V+   E  ++        +F     + +Y + + GLCG+ + N  NDL+       A V+    SW+       L   C   ++ K  C      +   ++      +E F  C   V    Y   C QD   C  G+    VC A++ Y  ECN++ I   WR  + CP  CP D  Y+PC   C + C   K+                       C+ S+  EGC+C     +   +CV E     C D  G   P        C +C C   G
Sbjct: 2952 CLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC-------------------------------------KDC--VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVI-QSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQ---FYNAELFGKCPLAVDPIAYVSACQQD--ICKPGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDD--GLHLPDEKWKKDKCTECQCDSKG 3417          

HSP 4 Score: 90.8929 bits (224), Expect = 1.446e-17
Identity = 186/808 (23.02%), Postives = 298/808 (36.88%), Query Frame = 2
Query:  311 LNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSI-EATYLSSQGVKVGNISYSF------PYSKAEFQISDRGHYVYVKGIK-DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW------------LSVSRENRMKPDPAIQMVNCDLNE-MATCAKVVSIFGSKFEEICYAEFC--QMKNQKNS----CELMRDIA---FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKV---CTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYI----AVMPKEIESDMPQLSIIVENKFCFN------SEDITCAKGIKILFGEGLNQTE-IEIKSKT-EVIINS-KLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIEL------------VLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-----------------RLRQRPNCDNDCI-----DGCQCPDDMVIEEKTGNCVKVEDC-KCEYMGRDYNANEERKDRCNTCTC-INGLWNCTTKDCSSQ 2485
            ++G+S+ TFD   TV      + +L +D  S   ++ I V   + C +++   C   I     ++  E   L    +K     ++       P  KA F +S  G  +     K    +  +  G + V       + V GLCG Y+GN  D   + D  + P      F   W            L   RE + K   A+Q+ N   +   A C K V+ +       C    C   M N  +     C ++          +P   ++ WR    CE  NCP+ ++ +DC          N    DC  +   C PGCYC +        C    EC                        ++C+C S G  K                  ++T+D +     G C Y+     V+P      +    + V    C         E  +CAK + IL G+ +   + +  K K+ +V+++  ++  IP K +    IS+ +V    L         V    +S +EL            V S KY  K+ GLCG+ NG+  +D + P+ A  K   ++   ++  +   G V       + +          + C +F   + F  C   V    +V+ C+ D+C  G     +T    C A +AYA+ C+  GI   WR P+ CP  CP +MVY+ CG  C+  C                  +      D  C+     +GC CP   V++   G CV    C KC+  G      + +KD+C  C C   G   C  K C  +
Sbjct: 2705 ISGKSFTTFD--GTVFKYGPCSHILARDIHSS--SWSISV--HQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIP--NTEKFGDSWYDKRIPKDQCGDLKCPREMQAK---ALQLCNIIHHPTFARCHKAVN-YKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEI-NCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC------------------------KDCVCNSLGASK------------------YMTYDRKSFSFNGNCTYLLSRDVVLP-----GVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDS---WISLRQVVGKEL---------VLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGND-LQPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPG-----NTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMD--GGQCVPEIACTKCDD-GLHLPDEKWKKDKCTECQCDSKGKTTCVEKKCQVE 3429          

HSP 5 Score: 87.8113 bits (216), Expect = 1.419e-16
Identity = 95/345 (27.54%), Postives = 144/345 (41.74%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFY---YKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSS-----IVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPC-DINKFRE--SWAIKRCSILKSETFEPCHNTVRY-QLYYDKCVQDSCAC---DRGDDCLCVCTAISQYVHECNRYNIKIQ---WRNYENCPIMCPPDREYKPC-EKVCPETCIGTKS----CISD-CMEGCYCKNNTYLKDDECVSEKPLCTCKD 3733
            +C+  G+S + +FDG  F + G CS++L  D     S ++ I +           C K I        + +I L        G   T    + + I      VS      + + TK    +Q D    V V ++ ++   V GLCG ++ N  +D R+  G I  +   F DSW  K       I K+ C D+   RE  + A++ C+I+   TF  CH  V Y Q   + C++ +C C   + GD   C C  +  +V +C   N  +Q   WR    C I CP    +  C ++ C  +C          + D C  GCYC   T  K   CV   P+  CKD
Sbjct: 2702 VCEISGKS-FTTFDGTVFKY-GPCSHILARDI---HSSSWSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDK------RIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCV---PISECKD 3032          
BLAST of Hemocytin vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 409.838 bits (1052), Expect = 8.116e-115
Identity = 350/1260 (27.78%), Postives = 559/1260 (44.37%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIK--------DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQM-VNCDLNEMATCAKVVSI---------FGS--------KFEEICYAEFCQMKNQKN--SCE------LMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQY--IAVMPKEIESDMPQLSIIVENKFCFNS-EDITCAKGIKILF-GEGLNQTEIEIKSKTEVIINSK-LVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR-TPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEER----KDRCNTCTCINGLWNCTTKDCSSQ-SYCPNGKVWKDCGGCQ------------RTCRDMN-LICDPNSCEPGCYCESGEVYDNNK--CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIH-LIRGAAPIIGRNPTWSPY--LGTGIFSK-----HDYVSSIVIITK----ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPD-REYKPCEKVCP-ETC-------IGTKSC-ISDCMEGCYCK----NNTYLKDD--ECVSE---KPLCTCKDESGKEYPLG-TTVIKNCHKCTC 3796
            A CT   G + KTFD +   +   + +  L+ D +S   T+ II+   ++C   S   C  T+K L++ S+  T+ +  G     +  + P  K    +   G  V               L + ++ +  + V A   M  +V GLCG  DG  D   +    +   + T   F   W    R    + + + +M    D  E +   K VS+          G              C A++C   N+++  SC       L ++ AF      +   WR  L+    +C    ++  CG N    C  +         C  GC+C +    YK  C   + CPC  R        +K    +KK C  C C++ G W+C T D+C +RC   GDPH+ TFD +     G+C Y  +      +E++    S  V     F + +D +C K + I F       + I++      I+N K +  +P  +  G E+ + + +S  L +E  D   V+    SR+ +        +  GLCG FN + +DD + P+G         A ++R   TC  +         C  + E    A + C    Q  F+DC  LV  ++F   C +D C C          C C   SAY   C  +G++  WR + + C V CP   V+ ECG  C+ +C  L  + +C  +C++GC+CP    + E  G CV  + C C + G  +    +     +   + CTC +G+W+C   +   +  Y P+ ++   C                +TC++M+  + D + C PGC C  G VYD ++  C+    C C    +S+++   I     +C L C CR+G W+C K  CE  C  WG+SH+ +FDG  FDF G C YVL +   +   G F I I+NV CG+ G +C+KS+      H    L+  A      +P  +P   L   + SK     H Y + + ++ +    +L+++WD    V V L  E++  V GLCGN++ N  +D++  +  ++     F  +WKL+  C  P    + C  +  RE+WA  +C  LKS+ F+ CH  V  + ++ +C+ D+CACD+G DC C+CTA++ Y   C +  I I+WR+   CP+ C P   +YK C   C  ETC       I  + C   +C+EGC+ K       YL D   +CV +   KP+C  +D  GK +  G  T   +C  C C
Sbjct:  482 ALCTTWGGINMKTFDGL-VFKAPLSCSHTLITDKVSG--TFDIIL---KACPYGSGYGCAHTLKILWQ-SVLYTFENLNGT----MQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDG--DPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGI--KLEHGWR-NLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGK-----EFKPESTVKKNCNTCTCKN-GQWRC-TEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLG-EVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETAVEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQFYEDCLYDTCAC----KDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDECGDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNED-GECVPKKMCHCNFDGMSFRPGYKEVRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTCKNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKE---DCNL-CECRAGNWKCSKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDG-FSITIQNVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLERFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYKACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKPVCMVRD--GKTFYEGDITFTDSCATCRC 1705          

HSP 2 Score: 139.043 bits (349), Expect = 3.480e-32
Identity = 107/371 (28.84%), Postives = 169/371 (45.55%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKD--HIIHLIRGAAPI---IGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK--------TSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCAC-DRGDDCLCVCTAISQYVHECNRYNIKIQ--WRNYENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
             LC  WG  +  +FDG  F     CS+ L+ D   K SGTF I+++    GS G  C  +++  ++   +    + G   +   I + P     +G  +     +V  I + +  LK+ WD +  V V   P+    V GLCG  D + + DL +R G   A V AFAD+W+++         +    E   + C+ +K +++ ++    +L +E    C     Y      C+ D C C +R     C C AI+    EC    IK++  WRN E CPI C   R Y+ C      TC   +   +    C EGC+C   T    + C++ + LC C    GKE+   +TV KNC+ CTC+   + C ++
Sbjct:  482 ALCTTWGGINMKTFDGLVFKAPLSCSHTLITD---KVSGTFDIILKACPYGS-GYGCAHTLKILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQ-IDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVENSAEMEFGMDSCEQSKLQKAVSVCE-RLLANEKLGDCIKPFNYDALIRTCMADYCNCANREHPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGACNEGCFCPEGTVQYKEACITRE-LCPC-SLRGKEFKPESTVKKNCNTCTCKNGQWRCTED 844          

HSP 3 Score: 115.161 bits (287), Expect = 5.916e-25
Identity = 127/515 (24.66%), Postives = 193/515 (37.48%), Query Frame = 2
Query: 2432 CTCINGLWNCTTKDCSSQ--SYCPNGKVWKDC--GGCQRTCRDMN---LICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGS-------KGTSCTKSIRFYYKDHIIHLIRGAAP-------IIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVF----LTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWK-------LKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS-----------------------CI-SDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQING 3808
            C  +N L   TT    +Q    CP+  V  DC    C+ +C +++       P++C PGCYC  G V     C+P  EC                                     +DC  +C + G S YM++D K F F+G+C+Y+L  D       TF++ +   +C         +G SC KS+     DH+IH+ R           + G      PY  + I  +      +V+   E  ++        +F     + +Y + + GLCG+ + N  NDL+       A V+    SW+       L   C   ++ K  C      +   ++      +E F  C   V    Y   C QD   C  G+    VC A++ Y  ECN++ I   WR  + CP  CP D  Y+PC   C + C   K+                       C+ S+  EGC+C     +   +CV E     C D  G   P        C +C C   G
Sbjct: 2951 CLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC-------------------------------------KDC--VCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVI-QSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQ---FYNAELFGKCPLAVDPIAYVSACQQD--ICKPGNTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDD--GLHLPDEKWKKDKCTECQCDSKG 3416          

HSP 4 Score: 91.2781 bits (225), Expect = 1.318e-17
Identity = 186/808 (23.02%), Postives = 298/808 (36.88%), Query Frame = 2
Query:  311 LNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSI-EATYLSSQGVKVGNISYSF------PYSKAEFQISDRGHYVYVKGIK-DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW------------LSVSRENRMKPDPAIQMVNCDLNE-MATCAKVVSIFGSKFEEICYAEFC--QMKNQKNS----CELMRDIA---FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKV---CTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYI----AVMPKEIESDMPQLSIIVENKFCFN------SEDITCAKGIKILFGEGLNQTE-IEIKSKT-EVIINS-KLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIEL------------VLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-----------------RLRQRPNCDNDCI-----DGCQCPDDMVIEEKTGNCVKVEDC-KCEYMGRDYNANEERKDRCNTCTC-INGLWNCTTKDCSSQ 2485
            ++G+S+ TFD   TV      + +L +D  S   ++ I V   + C +++   C   I     ++  E   L    +K     ++       P  KA F +S  G  +     K    +  +  G + V       + V GLCG Y+GN  D   + D  + P      F   W            L   RE + K   A+Q+ N   +   A C K V+ +       C    C   M N  +     C ++          +P   ++ WR    CE  NCP+ ++ +DC          N    DC  +   C PGCYC +        C    EC                        ++C+C S G  K                  ++T+D +     G C Y+     V+P      +    + V    C         E  +CAK + IL G+ +   + +  K K+ +V+++  ++  IP K +    IS+ +V    L         V    +S +EL            V S KY  K+ GLCG+ NG+  +D + P+ A  K   ++   ++  +   G V       + +          + C +F   + F  C   V    +V+ C+ D+C  G     +T    C A +AYA+ C+  GI   WR P+ CP  CP +MVY+ CG  C+  C                  +      D  C+     +GC CP   V++   G CV    C KC+  G      + +KD+C  C C   G   C  K C  +
Sbjct: 2704 ISGKSFTTFD--GTVFKYGPCSHILARDIHSS--SWSISV--HQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIP--NTEKFGDSWYDKRIPKDQCGDLKCPREMQAK---ALQLCNIIHHPTFARCHKAVN-YKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEI-NCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCVPISEC------------------------KDCVCNSLGASK------------------YMTYDRKSFSFNGNCTYLLSRDVVLP-----GVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDS---WISLRQVVGKEL---------VLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGND-LQPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIPLPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPG-----NTQQGVCVALAAYAKECNQHGICTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMD--GGQCVPEIACTKCDD-GLHLPDEKWKKDKCTECQCDSKGKTTCVEKKCQVE 3428          

HSP 5 Score: 87.8113 bits (216), Expect = 1.419e-16
Identity = 95/345 (27.54%), Postives = 144/345 (41.74%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFY---YKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSS-----IVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPC-DINKFRE--SWAIKRCSILKSETFEPCHNTVRY-QLYYDKCVQDSCAC---DRGDDCLCVCTAISQYVHECNRYNIKIQ---WRNYENCPIMCPPDREYKPC-EKVCPETCIGTKS----CISD-CMEGCYCKNNTYLKDDECVSEKPLCTCKD 3733
            +C+  G+S + +FDG  F + G CS++L  D     S ++ I +           C K I        + +I L        G   T    + + I      VS      + + TK    +Q D    V V ++ ++   V GLCG ++ N  +D R+  G I  +   F DSW  K       I K+ C D+   RE  + A++ C+I+   TF  CH  V Y Q   + C++ +C C   + GD   C C  +  +V +C   N  +Q   WR    C I CP    +  C ++ C  +C          + D C  GCYC   T  K   CV   P+  CKD
Sbjct: 2701 VCEISGKS-FTTFDGTVFKY-GPCSHILARDI---HSSSWSISVHQQCSDETRKVCHKVITIQDTEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLDDIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDK------RIPKDQCGDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAACKCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDCPVLPDACFPGCYCPEGTVRKGPNCV---PISECKD 3031          
BLAST of Hemocytin vs. Ensembl Fly
Match: cv-2 (gene:FBgn0000395 transcript:FBtr0071610)

HSP 1 Score: 117.472 bits (293), Expect = 4.258e-26
Identity = 104/403 (25.81%), Postives = 165/403 (40.94%), Query Frame = 2
Query: 2417 DRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCES--------GEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKR--DCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYL----GTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDAD--VNAFADSWKL---KTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCP 3559
            DRC  CTC+NG   C    C      P  +                   +P+ C P C            G VY NN+    G C     N      A +     +C+ +   +    EC +R  +  G C  +G+ H+ +FDGKFF F G C Y+L  D   K   TF I + N   G++  S  K++    ++  ++L +     +       PY     G  +  +       V++  E  L ++W+    + V +  ++K  +CGLCGNF+ +  +DL  + G    D  V  FA+SWK+   K+     E        +K + ++     S+     F  C+  +  + Y   C  D C C  GD   C C + + Y HEC R  +++  WR+  NCP
Sbjct:  272 DRCTNCTCLNGTSVCQRPTCPILECAPEFQ-------------------EPDGCCPRCAVAEVRSECSLDGIVYQNNETWDMGPCRSCRCNGGTIRCAQMRCPAVKCRANEELKQPPGECCQRCVETAGTCTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMGK---TFHIRLTNEGRGTRRASWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCSRKREFLAATPTCDKRKSNFYCHPLSV--PALFGECNERLNPENYKAACRMDVCECPSGD---CHCDSFAAYAHECRRLGVQLPDWRSATNCP 647          

HSP 2 Score: 86.2705 bits (212), Expect = 2.174e-16
Identity = 67/288 (23.26%), Postives = 129/288 (44.79%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVE-ISVFKVTSDG---LKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDS--ELAARYRL--TQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFG-QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPV 2200
            C + GDPHF TFD +    +G C+Y+  +  +       + +  E +    +   + AK + +     L   ++ +  +  V +N   VT+P  +  G + +++ ++ + G   L+ E G   ++       +++ + AK+ +++ GLCGNFNG   DD    DG    DD     A  +++   ++C     ++ +L    T  +  + +N  C        F +C   +  + +   C+ DVC C       + +C C +++AYA  C   G+Q   WR+   CP 
Sbjct:  383 CTVFGDPHFRTFDGKFFSFQGSCKYL--LASDCMGKTFHIRLTNEGR---GTRRASWAKTVTL----SLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANGGAVMLRSEMG--LTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGRSHGDDEVWHFANSWKVGGPKSCS---RKREFLAATPTCDK--RKSNFYCHPLSVPALFGECNERLNPENYKAACRMDVCEC------PSGDCHCDSFAAYAHECRRLGVQLPDWRSATNCPA 648          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 510.76 bits (1314), Expect = 2.115e-146
Identity = 351/1219 (28.79%), Postives = 560/1219 (45.94%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCDLNEMATCAKVV-----------------SIFGSKFEEICYAEFCQMKNQKNS---CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWS--XXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVE-GQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDND-----CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP--GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITKELKIQ--WDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP--YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD-------CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            + C   +G  ++TFDR      +F G+   +    S   T+ + +    S V ++S  C   ++ +    + + +  +  V    +    P  +    +   G +V+V+    + + ++ + +I++           GLCG+Y+ N DD F T   S++  +    F   W +   +++++  D A    +CDL+   +  +                    +    + + C   FC ++ +      C+ +       +  +I+  WR +  C    CP   ++S                    C   C  GC C +  + +  QC R D+CPC +R       SY  G  +++ C  C+C + G W+C T ++C ++C + G  H  TFD +   ++   C++ AV   E   D  +LSII+    C   E   C + + I        T + +     V++N     +P       ++ V + +S  L I+A     ++  D   + + L   +A KV GLCG  +    DD   P+G      +  AA++ +  +C       S    C T  +  ++A  VC       F+ C  +V  + F+  C  +VC+CG        +C CS  +AYA  C+ +G    WR   FCPV C    VY+ECG  C  +C  L    +C+ D     C+ GCQCPD +  ++  G CV V  C C+     + A     + CNTC C  G+WNCT   C   + CP   ++     C RTC   N   D  + EP  GC C  G V   ++C+   ECPC    + +  +  I++   +C  +C CR  +W C +  C G C A G+ HY++FDG+ + F GDC YVL+++     SG F +  ENV CGS G +CTKS+     +  IHL+RG A  +   P   P  Y G+G+  +   V   V ++  L +   WD  + V V L P     V GLCGNFD + +ND   R GI+++    F +SWK+  SCP    +  ++PC IN  R +WA K+C+++  E F  CH+ V YQ YYD CV D+C CD G DC C+CTA++ Y  ECNR  + ++WR+ E CP+ C     Y+ C   C   C  T S +SD       C+EGC+C   T   DD C+S    C C+ + G  +P G  V ++C  C+C    ++C
Sbjct:  196 STCMSWSGTHFRTFDRK---HFHFQGSCTYLLA-SSTDGTWAVYI----STVCETSGRCRKDLRMMLGLGLVSIHKDNMTVNGLAVPQGEPLFQNGVSVHWLGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVS--QYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLHAGQCVRRDDCPCFHRR-----HSYSAGQTIRQRCNTCVCRA-GQWECST-EKCEAQCSVLGAMHITTFDQKRYGLQTADCRFTAV---EDFVDK-KLSIIIGAGPCAGGE-AGCLREMSIT----ALHTTLTVTDAGSVLVNGHRNPLPVVTG---DLLVRRASSSVLLIQAFGAQLMWHLDGPLLFITLQPGFAHKVRGLCGTLSWSQHDDFTTPEGDVENSAASFAAKF-IVGSCPAPSAMTS--DPCGTLTQRRQLAERVCSVIHSNVFQACHDVVDREPFMRLCVSEVCSCG-----PQASCHCSVLTAYATHCAQEGALLSWRNHTFCPVQCSGGQVYQECGRLCGTSCADLWDGWSCEPDEGSRVCVSGCQCPDGLA-QDAQGQCVPVHMCPCKSGDTLHPAGSSINNNCNTCVCARGVWNCTDLSCPELNQCPGSLIFSP-RSCLRTCSSPNSPLDACT-EPIHGCICPEGTVLLGDQCVKPDECPCHHNGRLYFTNDTISK---DCN-TCVCREQRWHCGQALCSGTCVATGDPHYITFDGRHYSFLGDCEYVLVQE----SSGLFSVSAENVPCGSTGVTCTKSVTLTIGNTAIHLLRGKAVTVNGIPVTLPKSYSGSGLILER--VGLFVSLSSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFTTRQGIMESTPELFGNSWKISPSCPDVADQDLRDPCFINPHRVTWAKKKCAVINQEIFSSCHSEVPYQQYYDWCVFDACGCDSGGDCECLCTAVAAYAEECNRRGVYVRWRSQELCPLQCENGLVYEACGAACSPACPSTPS-LSDSLCSALSCVEGCFCPQGTVYHDDACISPS-QCPCEWD-GSVFPAGAMVTQHCQNCSCSAGLWQC 1361          

HSP 2 Score: 138.658 bits (348), Expect = 6.681e-32
Identity = 100/395 (25.32%), Postives = 172/395 (43.54%), Query Frame = 2
Query: 1325 GLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSY-LGL-CETS--IEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPV-ICPKNMVYKECGSSCSATCRLRQRP---NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            GL +     Q SS C+     HF TFD +H   +G C Y+      + S       +  +  C  S    C K ++++ G GL    + I      +    +         GV +       D + +E+G    +    ++ I L ++A++     GLCG +N +P+DD     G+ ++  +     +R+      +V   +  LG  C+ S  +   + A   C    +  F  C   V    ++  C +  C+  +    + +   C   ++Y R C+ + I   WR   FC   +CP+  V+ +C SSC ATC   + P    C ++C+ GC+CP  + +    G CV+ +DC C +    Y+A +  + RCNTC C  G W C+T+ C +Q
Sbjct:  184 GLLRGVRDPQASSTCMSWSGTHFRTFDRKHFHFQGSCTYL------LASSTDGTWAVYISTVCETSG--RCRKDLRMMLGLGL----VSIHKDNMTVNGLAVPQGEPLFQNGVSVHWL---GDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAV---CDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLH--AGQCVRRDDCPCFHRRHSYSAGQTIRQRCNTCVCRAGQWECSTEKCEAQ 558          

HSP 3 Score: 136.732 bits (343), Expect = 2.693e-31
Identity = 99/367 (26.98%), Postives = 164/367 (44.69%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRN-PTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS-----CPYPEISKNPCDIN---KFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPI-MCPPDREYKPCEKVCPETCIGTK-----SCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C +W  +H+ +FD K F F G C+Y+L     +   GT+ + I  V C + G  C K +R      ++ + +    + G   P   P    G+ S H ++   V +   L  ++++D + ++ + +T E+  N  GLCG +++N D+D     G +     +F +SW+++       C       + CD++     R   A   C +LK   F  CH+ V    Y D C+   C+ +  D    VC  ++ YV EC + +I I WR    C   +CP  + +  C   CP TC   +      C  +C+ GC C    YL   +CV  +  C C       Y  G T+ + C+ C C+   +EC  E
Sbjct:  198 CMSWSGTHFRTFDRKHFHFQGSCTYLLA----SSTDGTWAVYISTV-CETSG-RCRKDLRMMLGLGLVSIHKDNMTVNGLAVPQGEPLFQNGV-SVH-WLGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDFTTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRD-AESACHLLKETPFSHCHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCGTRVCPRGQVFSDCVSSCPATCASPRPPAAGQCRDECVGGCECPQGVYLHAGQCV-RRDDCPCFHRR-HSYSAGQTIRQRCNTCVCRAGQWECSTE 553          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 437.573 bits (1124), Expect = 1.858e-123
Identity = 333/1264 (26.34%), Postives = 564/1264 (44.62%), Query Frame = 2
Query:  257 VASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGN--MVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQIS-------DRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCD----LNEMATCAKVVS----------IFGSKFEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY------------------CPNG------KVWKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHL----IRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP---------DREYKPCEKVCPETCIGTK--SCISDCMEGCY--CKNNTYLKD--DECVSEKPLCTC-----KDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            + ++S  + +   A+C+  + +   TFD V      F G+   +L  DC  R  ++ I+        +       + +  +F+  +      SQG +   + Y+     A +++        + G  + +  + ++ +   K+ S           Q CGLCG Y+   +D++   +  +   +   DF   W +  + E   +  P  Q  N       ++M+ C  + S          +  + F  +C ++ C     K   C+ M + +   +   I +S+W  +  C  P CP  M +SDC   C+  C   N    C + C  GC C        ++C    +C C +        SY     + + C  C+C   G W+C T++ C   C++TG  H+ TFDN+     G C Y+  + K+ +S+    S ++E   C + +D  C + I + F +  NQT + +K    V ++   V  P  IN  + I    ++S  +++  G    +      R+ L L   YA ++ GLCGN+NG+  DD +   G            +++   C    ++ S    C  + +  + A E C      +F+ C  +V  + +V  C++DVC C     A    C C A S+YA  C+ +G+   WR+  +C + CP   VY+ CGS C+ TCR    P+  CD  C +GC CP  + + +  G CV  + C C + G  +  N+   D  + C C +G  +CT+ + +  +                   CP        +  +D G  C +TC+++ L C    C  GC C  G V     CIP+ +CPC+  ++ +     IT    +C  +C C   +W+C +R C+G+C+A G++HY+SFDG  F F G C YVL +DYCN   GTF++++EN  CG  G  C+KSI   Y   +I +    +R   P++    T    + +G++        IV++ K + I WD    + + ++ +Y+  VCGLCGNFD + +NDL + +  ++ D   F +SWK++ SC       + C  +  +     + C +L S  F  C++ V  + Y+D C QD+C+C    DC C C  I+ Y HEC +  + + WR+ + CP+ C           +  Y  C   CP TC   +  SC   C+EGC+  C     L +   +CV       C     +   GK++ L     + C  C C+ N   C
Sbjct:   14 ILNLSDLLLVEGSARCSLFSRQHIHTFDGVIY---EFPGDCSYMLAGDCRQR--SFSIL----GDFSHGKRKGVTVFLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHS----------NQTCGLCGNYNYLAEDEYSAQEGFLT--DDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKECVCQAMLEYSRACASRGITLSNWHTQSQCS-PKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRRYPPASY-----ISQDCNTCVCR-HGSWEC-TNEGCPGECLVTGQSHYKTFDNKFFTFSGICHYL--LAKDCQSN--SFSAVIETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTP-LINGPLRIQNTVLSS--VRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQMQNS--DPCSLNPKRVRFAEEACAVLLSMKFEPCHYMVNPEPYVKNCRYDVCAC-----ADGQECLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSD-AGECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGCVSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSIT---VDCN-TCVCEQRQWKCSERVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKE--TEVEIVRSGLYY-------IVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTCQHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVHDGQRVSHGKQFILNHEDPRLCQICHCESNTLTC 1219          

HSP 2 Score: 122.865 bits (307), Expect = 3.683e-27
Identity = 92/360 (25.56%), Postives = 155/360 (43.06%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS---CPYPEISKNPCDINKFRESWAIKRCSILKSET-FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C  +   H  +FDG  ++F GDCSY+L  D C ++S  F I+ +      KG +      F  +   +HL        G      PY  + +F+ ++ +  + + ++E    I+ D   ++ + L   + N  CGLCGN++   +++   + G +  D   FA+SW +K +   C         C+         +  C  ++S   F  C + V    +   C  D C C  G +  CVC A+ +Y   C    I +  W     C   CP   EY  C   C  +C      + C  +C++GC C     L  D CV +   C+C   +G+ YP  + + ++C+ C C+   +EC  E
Sbjct:   29 CSLFSRQHIHTFDGVIYEFPGDCSYMLAGD-CRQRS--FSILGDFSHGKRKGVTV-----FLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYE-LGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKDQMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKE--CVCQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCV-DVSQCSCT-HAGRRYPPASYISQDCNTCVCRHGSWECTNE 375          

HSP 3 Score: 96.2857 bits (238), Expect = 4.300e-19
Identity = 89/367 (24.25%), Postives = 139/367 (37.87%), Query Frame = 2
Query: 2744 WECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS-CTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQW------------DRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-PYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCM-----------------EGCYCKNNTYLKDDECVSEKPLCTCKDESGKEY 3751
            W CP       C     SH +SF G        CSY+LL      +SG  ++V+    C S     C KS+        + L       +G   T  P+      ++   V+ I  I  +L+ +             +  L++D+ + P    N  GLCG+  D+  + L    G +  D + +  +W L + C  + EI   P  + K         C +L SE F  CH  V  Q Y   C   +C  +       +C  ++ Y   C +  + + WR    CP+ C    EY  C   C E C  ++    D M                 EGC+C   + L +D+CV  +    C + SGK +
Sbjct: 1945 WTCPCS-----CMGSSTSHVVSFSGAALKVKSACSYLLL------RSGGAELVLHTTACQSSPNQICMKSLELREGGTSVVLQDDMKVTVGGVLTAVPFR-----TERVTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKP----NTTGLCGSCSDD-QSGLLLSDGSVTTDPDVYLQAWALGSECVQHQEIQLCPAGLEK--------ACDVLSSEVFSHCHALVPVQDYIQICRSVACQPNA------LCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLMEDKCVDREACSQCVEHSGKTH 2276          

HSP 4 Score: 95.1301 bits (235), Expect = 9.316e-19
Identity = 109/485 (22.47%), Postives = 181/485 (37.32%), Query Frame = 2
Query: 1298 CQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQ------------RPN---CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEE---RKDRCNTCTCIN-GLWNCTTKDCSSQSYCPNGKVWKDCGGCQ--------RTCRDMNLICDPNSCEPG-CYCESG---EVYDNNKCIPKGECPC 2653
            C+N L   R    C     C   C+ +   H V+F    + V+  C Y+ +     E       +++    C +S +  C K +++  G     T + ++   +V +   L  +P +  + V ++        L+ E       F    +   L +        TGLCG+ + D +   ++ DG+   D       + L   C    ++   + LC   +E      + C       F  C ALVP   ++  C+   C           N  C   +AY+ +C  +G+   WRT   CP+ C  +M Y  C S C   C   Q            + N   C N   +GC CP+  V+ E    CV  E C    E+ G+ +   E      + C  C C++    NCT   C+      N K   +CG C+        + C     +CD N   P   +C+ G    + +   C+P  +C C
Sbjct: 1928 CKNNLPALRYNHHCGCTWTCPCSCMGSSTSHVVSFSGAALKVKSACSYLLLRSGGAE-------LVLHTTACQSSPNQICMKSLELREG----GTSVVLQDDMKVTVGGVLTAVPFRTER-VTVTQIGSILHQLRSEQHGFTLTFTPHSNEFMLNMDIAMKPNTTGLCGSCSDD-QSGLLLSDGSVTTDPDVYLQAWALGSEC----VQHQEIQLCPAGLE------KACDVLSSEVFSHCHALVPVQDYIQICRSVACQ---------PNALCDLVTAYSTVCRQQGVCVDWRTSSLCPMSCSDSMEYAACRSGCLEQCGQSQFTPGDMMGDGLLKANGSVCLNTPTEGCFCPEGSVLMED--KCVDREACSQCVEHSGKTHQFMESWNPEDNPCVLCVCLDQQRINCTALPCT------NAKA-PECGQCEVLQEKMGSKCCPQYECVCDINCKRPDPPHCDHGLSVVLTNPGDCLPVYQCVC 2371          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: vwf (von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-070103-1])

HSP 1 Score: 434.106 bits (1115), Expect = 5.948e-123
Identity = 334/1249 (26.74%), Postives = 557/1249 (44.60%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGN--MVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQIS-------DRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNC--DLNEMATCAKVVS----------IFGSKFEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY------------------CPNG------KVWKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHL----IRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP---------DREYKPCEKVCPETCIGTK--SCISDCMEGCY--CKNNTYLKD--DECVSEKPLCTC-----KDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            A+C+  + +   TFD V      F G+   +L  DC  R       ++   S   +      +   F    S++ T   SQG +   + Y+     A +++        + G  + +  + ++ +   K+ S           Q CGLCG Y+   +D++   +  +   +   DF   W +  + E   +  P  Q  N   +  +M+ C  + S          +  + F  +C ++ C     K   C+ M + +   +   I +S+W  +  C  P CP  M +SDC   C+  C   N    C + C  GC C        ++C    +C C +        SY     + + C  C+C   G W+C T++ C   C++TG  H+ TFDN+     G C Y+  + K+ +S+    S ++E   C + +D  C + I + F +  NQT + +K    V ++   V  P  IN  + I    ++S  +++  G    +      R+ L L   YA ++ GLCGN+NG+  DD +   G            +++   C    ++ S    C  + +  + A E C      +F+ C  +V  + +V  C++DVC C     A    C C A S+YA  C+ +G+   WR+  +C + CP   VY+ CGS C+ TCR    P+  CD  C +GC CP  + + +  G CV  + C C + G  +  N+   D  + C C +G  +CT+ + +  +                   CP        +  +D G  C +TC+++ L C    C  GC C  G V     CIP+ +CPC+  ++ +     IT    +C  +C C   +W+C +R C+G+C+A G++HY+SFDG  F F G C YVL +DYCN   GTF++++EN  CG  G  C+KSI   Y   +I +    +R   P++    T    + +G++        IV++ K + I WD    + + ++ +Y+  VCGLCGNFD + +NDL + +  ++ D   F +SWK++ SC       + C  +  +     + C +L S  F  C++ V  + Y+D C QD+C+C    DC C C  I+ Y HEC +  + + WR+ + CP+ C           +  Y  C   CP TC   +  SC   C+EGC+  C     L +   +CV       C     +   GK++ L     + C  C C+ N   C
Sbjct:   15 ARCSLFSRQHIHTFDGVIY---EFPGDCSYMLAGDCRQR----SFSILGDFSHGKRKGVTVFLGEMFELHLSVDGTL--SQGAERLPLPYASSSVFAGYELGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHS----------NQTCGLCGNYNYLAEDEYSAQEGFLT--DDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKECVCQAMLEYSRACASRGITLSNWHTQSQCS-PKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCVDVSQCSCTHAGRRYPPASY-----ISQDCNTCVCR-HGSWEC-TNEGCPGECLVTGQSHYKTFDNKFFTFSGICHYL--LAKDCQSN--SFSAVIETAQCADDQDAICTRSITLRFKDLANQT-VHLKHGGVVSVDGMDVQTP-LINGPLRIQNTVLSS--VRLRYGHDLHLDWDGRGRVLLRLKPAYAGQMCGLCGNYNGNQGDDFLTVGGLVETRVEAFGNSWKMNADCDDVQMQNS--DPCSLNPKRVRFAEEACAVLLSMKFEPCHYMVNPEPYVKNCRYDVCAC-----ADGQECLCDAVSSYAVACAARGVLVNWRSHGYCELTCPDAQVYEMCGSVCNQTCRSLSLPDTGCDGVCEEGCFCPRGLFLSD-AGECVPPQHCSCHHNGEIFEPNDMIGDHHSICVCESGSMHCTSNEATGSTLSDLFFDEQSPSRGRRSLSCPPPLQRFECESARDAGIECAKTCQNLELDCVSLGCVSGCMCPPGTVRYRKDCIPQEQCPCYHNSRPYESGQSIT---VDCN-TCVCEQRQWKCSERVCDGVCRAIGDTHYISFDGLKFSFPGPCQYVLAQDYCNGLDGTFRVLVENSACGIAGYRCSKSITVLYMGGLIVMEHGEVRMKRPVLKE--TEVEIVRSGLYY-------IVLLGKHISITWDTGTRISLQISGQYRGKVCGLCGNFDGSQNNDLLSSSNQMEVDAADFGNSWKVRPSCADAVSVVSQCSTDLVKLVTVEQSCRVLTSAIFRDCNSVVDPEPYWDICTQDTCSCPSVGDCACFCNTIAAYAHECAQKGLPVNWRSNDLCPLSCEDLNKESGVQCEWRYNTCASACPSTCQHPEPLSCPISCVEGCHAVCPPGHLLDEVLRKCVEPSQCQVCVHDGQRVSHGKQFILNHEDPRLCQICHCESNTLTC 1205          

HSP 2 Score: 125.561 bits (314), Expect = 4.798e-28
Identity = 94/358 (26.26%), Postives = 157/358 (43.85%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-PYPEISKNPCDINKFRESWAIKRCSILKSET-FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C  +   H  +FDG  ++F GDCSY+L  D C ++S  F I+ +      KG +      F  +   +HL        G      PY  + +F+ ++ +  + + ++E    I+ D   ++ + L   + N  CGLCGN++   +++   + G +  D   FA+SW +K +  P   +       N   ES  +  C  ++S   F  C + V    +   C  D C C  G +  CVC A+ +Y   C    I +  W     C   CP   EY  C   C  +C      + C  +C++GC C     L  D CV +   C+C   +G+ YP  + + ++C+ C C+   +EC  E
Sbjct:   17 CSLFSRQHIHTFDGVIYEFPGDCSYMLAGD-CRQRS--FSILGDFSHGKRKGVTV-----FLGEMFELHLSVDGTLSQGAERLPLPYASSSVFAGYE-LGYVRLWSEEFGFSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCKRVLPPSQSCNSTGESTKMSACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHCSAGKE--CVCQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGDRCV-DVSQCSCT-HAGRRYPPASYISQDCNTCVCRHGSWECTNE 361          

HSP 3 Score: 122.865 bits (307), Expect = 4.039e-27
Identity = 106/385 (27.53%), Postives = 164/385 (42.60%), Query Frame = 2
Query: 1358 SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIP---SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLT---QTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQG-QFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            S+RC +    H  TFD       G C Y+      +  D  Q S  +   F          KG+ +  GE     E+ +     +   ++ + +P   S +  G E+   ++ S+    E G  FS+       I+L L  +++ +  GLCGN+N   ED+    +G    D  + A  + +    + C   VL  S    C ++ E  K++   C        F  C  LV    FV+ C+ DVC+C     ++   C C A   Y+R C+ +GI    W T   C   CP  M Y +C  +CS +C+ +  +  C  +C+DGC CP   V++     CV V  C C + GR Y         CNTC C +G W CT + C  +
Sbjct:   14 SARCSLFSRQHIHTFDGVIYEFPGDCSYM------LAGDCRQRSFSILGDFSHGKR-----KGVTVFLGEMF---ELHLSVDGTLSQGAERLPLPYASSSVFAGYELGYVRLWSE----EFG--FSIRIDPLHNIQLTLEKRHSNQTCGLCGNYNYLAEDEYSAQEGFLTDDPYDFANSWAMKGADEPCK-RVLPPSQ--SCNSTGESTKMS--ACESMRSSVLFMHCAHLVDPAAFVSVCESDVCHC-----SAGKECVCQAMLEYSRACASRGITLSNWHTQSQCSPKCPVGMEYSDCTPTCSTSCQNVNIQEVCKEECVDGCICPAGKVLDGD--RCVDVSQCSCTHAGRRYPPASYISQDCNTCVCRHGSWECTNEGCPGE 366          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 395.971 bits (1016), Expect = 2.122e-110
Identity = 311/1189 (26.16%), Postives = 510/1189 (42.89%), Query Frame = 2
Query:  176 GKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTG--NMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNK-KGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLD-FIKIWLSVSRE-------NRMKPDPAIQM---VNCDLNEM---------ATCAKVVSIFGSKFEEICYAEFC-QMKNQKNSCELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKL-VTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSY--LGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRT--PEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCG------------GCQRTCRD--MNLICDPN-SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYV------SSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREY 3586
            G+C+ P+ C+C      G +C+           N+    +  C      +Y+TFD +      F G  +  L++DC     +   I +  +   + S   C  +I        E   L    V     S   P+   + ++     Y+ V       + +     S+++          CGLCG ++ +  D  +T   S      DL  F   W     E         + P P   +   V   + E+          +C + VS +   +   C  + C    N    C++  + A   +  D+ + DWR        +CP+++++ +C   C   C      +D    C  GCYC  D  +    C +A +CPCE+         Y  G  +++ C NC C   G+W C  H+ C   C +TGD  F +FD +       CQY  V+ K   S   + ++ ++N  C  + D  C + + ++  E   +TEI +    EV + S+  +++P   +   +I         +K+  G L+  +   + R+ L L  ++     GLCG FNG+ +DD + P G            +R++  C   V R S   L  C+T  +    A E C    Q  F  C   V    F  QC+ DVC CG L       C CS  + YAR C   G+  ++R+  PE C V CP  M Y  C S+C   C     P  C ++C +GC CP+       T  CV   +C C ++G DY+  +          C +G     ++    ++ CP G+ ++DCG             C++TC    +NL C  +  C PGC C +G +   ++C     CPC W+ + +     ++     C   C C+ G ++C  R C  +C A+G+ HY +FDG  FD+ G C   L++   +       +  ENV+C   G  C KS+         H+  G + I+  + T  P   + I  +  Y+      + + ++ ++L + WDR+ ++ +   P ++  + GLCGNFD    N++R    I  +    F +SW        P+I ++PC++N  RE +A ++C IL SE F+ CH  V    +Y  C+ D+C C+RG DC C CT+++ Y H C +  I I WR+    P +CP D EY
Sbjct:   99 GRCVHPDSCNCTLYQAAGTRCQTV--------PNLGFEREMTCRSWGQYNYETFDGLYYY---FPGKCSYTLLRDCEDNARSSVHIQVHNDPECSSSPYSCTRSISLFLPWEGEI-RLQHFSVTFKGQSVLLPHHIHDVELERISDYIVVSQPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKT---SYGVFTQDLAMFGNSWAEEEPELARCTVVPSLYPSPCATLDPHVLLKVEEVCSTLLREPFQSCHEFVSPYS--YMASCSNDLCLSGPNGAVVCQVFTEYARACAHADHPLHDWRTHFPVCNVDCPDELLFRECITCCPMHCKIEQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASDCPCEHHGML-----YPSGHIIQEDCNNCTCFG-GIWNCTEHN-CPGECSVTGDMFFQSFDGRVYTFPATCQY--VLAKSRNSG--KFTVTIQNAPCGANLDGACIQSVNLVVNED-PRTEITMSHSGEVFLASQFRISLPYS-DDMFQIQELSSMFVQVKLSQG-LWLQYNWKEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPSGMIESTPFLFGNAWRVSSAC---VPRPSLPQLDPCDTHQQAASYAVEKCDVLTQEVFSACHEYVSPVGFQLQCRADVCKCGAL-------CLCSILAHYARTCRRHGVIIEFRSHLPE-CAVSCPSTMEYGVCVSACQRRCLFLSLPQPCGDECEEGCVCPEGTYFNMHTHTCVPRNECPCSFLGADYSPGDVIITSSGVQICQDG--KLVSQTSIIETLCPAGQFYEDCGNRVDGPSASKGLACEQTCETYLLNLTCSTHEPCVPGCVCPAGLLKHGDECFKPRACPCLWKGKEYYPGDKVSS---PCH-QCVCQHGTFQCEFRPCPSMCTAYGDRHYRTFDGFLFDYIGVCKVYLVK---SSLDAMLTVTAENVDCFESGVICRKSL---------HISVGRSFIVFDDDTGRPNPSSVIDRQRAYIWQAGYYTIVHLLGEDLTVLWDRKTTIHIQAGPRWQGRLTGLCGNFDQKTANEMRTPENIDSSTPQEFGNSWTAAECVNSPDI-RHPCNLNPLREPFAKRQCGILLSEVFQVCHPVVDVTWFYMNCLVDTCGCNRGGDCECFCTSVAAYAHRCCQKGIPIDWRS----PSICPYDCEY 1222          

HSP 2 Score: 176.792 bits (447), Expect = 1.574e-43
Identity = 122/472 (25.85%), Postives = 218/472 (46.19%), Query Frame = 2
Query: 2492 CPNGKVWKDCGGC-------QRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYY----KDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVII--TKELKIQWD-RQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-PYPEISK-NPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNY-ENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTY--LKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHN 3838
            CP+  ++++C  C       ++ C D  L      C  GCYC    ++++  C+   +CPC      +    +I     +C  +CTC  G W C + +C G C   G+  + SFDG+ + F   C YVL +   ++ SG F + I+N  CG+    +C +S+        +  I     G   +  +     PY    +F   +  S  V +  ++ L +Q++ ++  + + L  ++++N  GLCG F+ N+ +D    +G+I++    F ++W++ ++C P P + + +PCD ++   S+A+++C +L  E F  CH  V    +  +C  D C C      LC+C+ ++ Y   C R+ + I++R++   C + CP   EY  C   C   C+     + C  +C EGC C   TY  +    CV     C C    G +Y  G  +I +     CQ      +  +I  
Sbjct:  404 CPDELLFRECITCCPMHCKIEQMCIDSKL-----QCLDGCYCPDDLIFEDGVCVKASDCPCEHHGMLYPSGHIIQE---DCN-NCTCFGGIWNCTEHNCPGECSVTGDMFFQSFDGRVYTFPATCQYVLAK---SRNSGKFTVTIQNAPCGANLDGACIQSVNLVVNEDPRTEITMSHSGEVFLASQFRISLPY-SDDMFQIQELSSMFVQVKLSQGLWLQYNWKEFRLYLQLEEQWRDNTLGLCGTFNGNIQDDFLAPSGMIESTPFLFGNAWRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCDVLTQEVFSACHEYVSPVGFQLQCRADVCKCG----ALCLCSILAHYARTCRRHGVIIEFRSHLPECAVSCPSTMEYGVCVSACQRRCLFLSLPQPCGDECEEGCVCPEGTYFNMHTHTCVPRNE-CPCS-FLGADYSPGDVIITSSGVQICQDGKLVSQTSIIET 856          

HSP 3 Score: 143.665 bits (361), Expect = 2.212e-33
Identity = 105/373 (28.15%), Postives = 169/373 (45.31%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIEN-VECGSKGTSCTKSIRFYYK-DHIIHLIRGAAPIIGRNPTWSPYLGTGIFSK-HDYVSSIVIITKELKIQWD-RQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSW-----KLKTSCPYPEISKNPCDINKFRESWAIKR-CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WR-NYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD---CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNC 3841
            E  C++WG+ +Y +FDG ++ F G CSY LL D  +    +  I + N  EC S   SCT+SI  +   +  I L   +    G++     ++      +  DY+  +V       + W     SV + ++PE+  + CGLCGNF+ +  +DL+   G+   D+  F +SW     +L      P +  +PC          ++  CS L  E F+ CH  V    Y   C  D C    G +   VC   ++Y   C   +  +  WR ++  C + CP +  ++ C   CP  C   + CI     C++GCYC ++   +D  CV     C C +  G  YP G  + ++C+ CTC    + C +   HNC
Sbjct:  130 EMTCRSWGQYNYETFDGLYYYFPGKCSYTLLRDCEDNARSSVHIQVHNDPECSSSPYSCTRSISLFLPWEGEIRLQHFSVTFKGQSVLLPHHIHDVELERISDYI--VVSQPHVFTLAWQGLTSSVYIKMSPEFVGHTCGLCGNFNADTQDDLKTSYGVFTQDLAMFGNSWAEEEPELARCTVVPSLYPSPCATLDPHVLLKVEEVCSTLLREPFQSCHEFVSPYSYMASCSNDLCL--SGPNGAVVCQVFTEYARACAHADHPLHDWRTHFPVCNVDCPDELLFRECITCCPMHCKIEQMCIDSKLQCLDGCYCPDDLIFEDGVCVKASD-CPC-EHHGMLYPSGHIIQEDCNNCTCFGGIWNCTE---HNC 493          

HSP 4 Score: 81.6481 bits (200), Expect = 1.255e-14
Identity = 89/370 (24.05%), Postives = 143/370 (38.65%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS--------CTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNV--CGLCGNFDDNVDNDLRNRAGII---DADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS----ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVC-------------PETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLG 3760
            CP+ DC   C  + + + ++FDGK    +    YV+ +      + T  I+++  EC     +        C  ++   +K + + + R    +   +    P      F   D  +  +I +   LKIQW     + V     Y N +   GLCG+ D N  NDL    G +     D   F DSW++  +  Y   S+      +   +     CS    +L + TF  CH  V   ++ +  V+D    +        C A++ Y   C+++NI ++WR+ + CP +CP +  Y+ C   C             PE C G         EGC C   T L         P   C C D  G    LG
Sbjct: 2300 CPRWDCPCRCSVFPDLNLITFDGKSVAIYKAALYVVTQ----LPNETVSILVQ--ECSGPDDTLVWNFTNLCLAALNITHKSNEVLVNRLQRRLYVNSRYAKPRFKKYGFEILDTGNMYLIRSPAGLKIQWFHTTGMMVIEMDSYNNRLPTMGLCGSCDGNPLNDLTLSNGTVVPEQEDPAVFIDSWQIPNTTSYVSNSR------RREVNCTTSDCSQCFNMLNNNTFTLCHAYVPPGVFCEMWVRDVEYVNNP------CIALAAYAASCHKFNICMEWRSSDFCPFVCPGNLRYQACLPACTAPSCPNQEFEFVPEQCTGLS-------EGCVCPEGTLLHRPYSALCIPPSKCACTDSFGAPRALG 2644          

HSP 5 Score: 65.855 bits (159), Expect = 8.315e-10
Identity = 79/361 (21.88%), Postives = 141/361 (39.06%), Query Frame = 2
Query: 1355 CSSRCIITGDPHFVTFDNQHIFVEGQCQYIAV-MPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEI----SVFKVTSD-GLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAA---RYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDND-----------CIDGCQCPDDMVIEEK-TGNCVKVEDCKC 2374
            C  RC +  D + +TFD + + +     Y+   +P E  S + Q     ++   +N  ++ C   + I      N+  +  + +  + +NS+    P     G EI    +++ + S  GLKI+       F      +  + S        GLCG+ +G+P +D  + +G    +  + A     +++  T       +     C TS       ++         F  C A VP   F             +R+   +N  C A +AYA  C    I  +WR+ +FCP +CP N+ Y+ C  +C+A       P+C N              +GC CP+  ++    +  C+    C C
Sbjct: 2305 CPCRCSVFPDLNLITFDGKSVAIYKAALYVVTQLPNETVSILVQECSGPDDTLVWNFTNL-CLAALNITHKS--NEVLVN-RLQRRLYVNSRYAK-PRFKKYGFEILDTGNMYLIRSPAGLKIQW------FHTTGMMVIEMDSYNNRLPTMGLCGSCDGNPLNDLTLSNGTVVPEQEDPAVFIDSWQIPNTTSYVSNSRRREVNCTTSD-----CSQCFNMLNNNTFTLCHAYVPPGVFCEM---------WVRDVEYVNNPCIALAAYAASCHKFNICMEWRSSDFCPFVCPGNLRYQACLPACTA-------PSCPNQEFEFVPEQCTGLSEGCVCPEGTLLHRPYSALCIPPSKCAC 2633          
BLAST of Hemocytin vs. Ensembl Zebrafish
Match: muc5.3 (mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562])

HSP 1 Score: 395.201 bits (1014), Expect = 5.775e-110
Identity = 353/1235 (28.58%), Postives = 545/1235 (44.13%), Query Frame = 2
Query:  326 YKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNC-DLN---------EMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS--------SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA---GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ--FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFC---PVICPKNMVYKECGSSCSATCRLRQRPN--CDND--CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTT----KDCSSQSY---CPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-PY--LGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC----PPDR---EYKPCEKVCPETCIGTKSCISD---CMEGCYCKNNTYLKDDECVSEKPL-------CTCKDESG-----KEYPLGTTV--IKNCHKCTCQINGFECE 3820
            YKTFD     Q   T N +L   C S    + + +  +   +N      +IT+K L    IE   LS   + V   + + PYS AE  I     Y+ +K    L   +N+  S  +      + Q CGLCG  D NG   +    +  +   +  D+  +W           D      NC D N           + C  +VSI    F ++C  + C   +   +  L   IA  S         P+    +WR +  C  P CP  M++S CGN C + C  +     C++ C  GC+C     +   +++ C    EC C           Y  G+     C++C C+ +G W C   D C   C + G  H  TFD +     G C Y  V+ K       + +++ +   C  +E  TC K I +   +G+  T I + S   V +N  +  +P   +    +SVFK +S  + IEA   G    +      ++ +  ++ Y  +  GLCGN+N    DD     G       + A  ++   +C    +++S+   C  S E  + A   C         F  C   V  + +   C +D CNC    +     C C+A S+YA  C+ +GI  + WR    C      C    VY    +SC  TCR   + +  C +D   +DGC C +   + E  G+CV+   C C   G+     E       +C C  G  +C+     ++C+       C +     +   CQ++C  +++ C    C  GC C SG V D N  CI K +CPC     ++     I     +C  +C+C++ +W C    C   C  +G+ HY +FD K + F G+C Y L++D+CN  SGTF+++ EN+ CGS GT+C+K+I+ +   + + L  G+  ++ R+     PY     G++        +VI TK  L + WDR+ ++ + L PEY   VCGLCGN+D N +ND   R   +      FA+SWKL +SCP   + ++PC  N +RE+WA ++CSI+ S  F  CH+ V    +YD CV+D+CACD G D  C CTA++ Y   CN     + WR+ + CP+ C    PP      YKPC   C +TC       S+    +EGCY          +C  E+P+       C  ++E G     + Y +G  V   +NC  C C   G  CE
Sbjct:   73 YKTFDG-DYFQLPSTCNYILTSHCSSSYEDFNVQL--RHELLNNEPTVSKITMK-LQGTIIE---LSRDSLSVNGQTVTLPYSSAEVFIERVTSYISIKAALGLVAMWNEDDSFMIRLDEKYRNQTCGLCG--DFNGIPVYNEFVSGGS-SLSVSDYGNLWKLDGPTETCTEDTMFLNENCGDENFCRDIFSSPVFSDCRGLVSI--DSFVQVCIQDLCHCNSSSGAFCLCDTIAEYSRQCVHAGGKPE----EWRTEYFCPHP-CPETMVYSQCGNPCTDTCTNSERGQVCAQHCIDGCFCPPGTVYDDIHQSGCIPYTECSCVLGGKI-----YASGENYTSNCRDCTCD-QGQWDCYIKD-CPHSCSVEGGSHITTFDGKAYTFHGDCTY--VLSKHCSGT--EFTVLGDLVKCGLTETETCLKAITVALFDGI--TVINVDSSGNVEVNRIVAQLPLFTSS---VSVFKPSSFYIIIEAPLIGLRLEIQLVPIMQLYITANSVYQGETCGLCGNYNNMEADDFTTIGGLREGTALDFANTWKTRASCPD--VKRSFENPCSLSTENEQYAQHWCSLLSDSSSVFAPCHTEVNPEVYKANCIYDSCNCERSED-----CMCAALSSYAHACAARGILLEGWRD-AACMKYTETCAATTVYSYQMTSCGRTCRSLSQADGSCTHDHVLVDGCGCAEGKYMNEN-GDCVEAAACSCYDSGKVVALGETISKDGGSCICQQGKLSCSGVSNGEECTEPMRFFNCSSASPGSEGAECQKSCNTLDMACISTGCVSGCVCPSGLVSDGNGGCIDKDQCPCIHNGHTYQSGESIK---IDCN-TCSCQNRRWTCTTNQCSATCSIYGDGHYRTFDDKRYVFSGNCEYSLVQDFCNSTSGTFRVITENIPCGSTGTTCSKAIKLFLGSNELRLTDGSFQVVRRDAGEEIPYQMRTMGLY--------LVIETKNGLMLIWDRKTTIHIKLGPEYNGRVCGLCGNYDGNANNDFTTRTQAVAVQALDFANSWKL-SSCPDATLIQDPCAHNPYREAWAQRQCSIITSSVFSACHSQVDPSPFYDACVRDACACDSGGDYECFCTAVTAYAQACNEAGACVAWRSPKICPLFCDYYNPPGECEWHYKPCGAPCMKTCRNPDEQCSNQIPALEGCY---------PQCPQEQPVFDEDNMKCVKQEECGCFVDMEHYEVGEQVPTTENCQSCNCSSTGVICE 1243          

HSP 2 Score: 106.686 bits (265), Expect = 3.559e-22
Identity = 98/374 (26.20%), Postives = 151/374 (40.37%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKI--QWDRQLSVDVFLTPEYKNNVCGLCGNFDD-NVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS-------ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE-KELIHNC 3841
            E +C  WG  HY +FDG +F     C+Y+L   +C+     F + + +    ++ T     I    +  II L R +  + G+  T  PY    +F   + V+S + I   L +   W+   S  + L  +Y+N  CGLCG+F+   V N+  +        V+ + + WKL            P +       +  + C        I  S  F  C   V    +   C+QD C C+      C+C  I++Y  +C     K  +WR    CP  CP    Y  C   C +TC  +   + C   C++GC+C   T   D       P   C     GK Y  G     NC  CTC    ++C  K+  H+C
Sbjct:   62 ELICSTWGNYHYKTFDGDYFQLPSTCNYILT-SHCSSSYEDFNVQLRHELLNNEPT--VSKITMKLQGTIIELSRDSLSVNGQTVTL-PYSSAEVF--IERVTSYISIKAALGLVAMWNEDDSFMIRLDEKYRNQTCGLCGDFNGIPVYNEFVSGG--SSLSVSDYGNLWKL----------DGPTETCTEDTMFLNENCGDENFCRDIFSSPVFSDCRGLVSIDSFVQVCIQDLCHCNSSSGAFCLCDTIAEYSRQCVHAGGKPEEWRTEYFCPHPCPETMVYSQCGNPCTDTCTNSERGQVCAQHCIDGCFCPPGTVYDDIHQSGCIPYTECSCVLGGKIYASGENYTSNCRDCTCDQGQWDCYIKDCPHSC 417          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 506.523 bits (1303), Expect = 8.120e-145
Identity = 354/1219 (29.04%), Postives = 555/1219 (45.53%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQ----MVNCDLNEMATCAK-----------VVSIFGSK-----FEEICYAEFCQMKNQKNS-----CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVD--CSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC---RLRQRPNCDN--DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEIS--KNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC--IGTKS---CIS-DCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            + C    G  ++TFD  K    + T    L     S    Y    I +E C   +    E+T+  L + ++    +S  GV V       P+ +    I   G +++++    + + ++ + +++V   +  + +  GLCG+Y+ +  D F  V  +++P      F   W       +++ +   Q    M+       + CA             + +F S+     + E C   +CQ     +      CE     A   +   I+ DWR    CE+  CPN   +SDC ++C   C       D  C   C  GC C    +  +  C + +ECPC +R        Y  GD +K+ C  C+C   G W C T D+C+++C + GDPH+VTFD +     G C YI V     +    +L I  EN  C +   ++C + I +      ++T I + +K +  +N + VT+P       ++SV  V+S  L ++    + ++  +     + L   ++ KV GLCG FN +  DD   P+G         A +++++  C    +       C T  +  + A E C          C  LV  + F   C +DVC C     A   NC CSA SAYAR C+ +G    WR   FCPV C    +Y EC   C  TC   R+    +C     C+ GC CP+ +V++E +G CV    C+C +    +    + +  C +C C NG+WNCT   C   +YCP   V+   G C  TC  +      +    GC C  G    ++  +P+ +CPC    + ++ +  I +   +C  +C C++  W C    C G+C A G+ HY++FDG+ F F GDC YVL  +      G F +  ENV CG+ G +CTKS+     + I+H++RG    I       P  Y G GI  +   + ++ I    L + WD    V V L P ++  V GLCGNFD + +ND  +R GI++   + F +SW++   CP       ++PC  N  R +WA K+C +L    F  CH  V  Q YYD CV D+C CD G DC C+CTAI+ Y  +CN+  + I+WR  + CP+ C     Y+ C   CP+TC  +G      C S  C+EGC+C     L +  C+ +   C C    G  +P G  +   C  CTC+   ++C  E
Sbjct:  186 STCVTWGGFHFRTFDG-KHFHFHGTCTYTLASSLDSTWAVY----ISEELCPQPTL---EVTLG-LERVTVRRREVSVNGVTV---PEGVPHLQNGINILWLGDFLFIESGLGVRVKFDGRNNVYVTVTLDQRGRTRGLCGVYNEDPQDDFTEVGGNVSPHAAG--FANSWRIQDSNTQVRTNSFCQFHFSMLIYHFMPSSRCATPRAHLAKPTICFLCLFSSQVDPSGYYETCMYTYCQHSGGASDRAGAVCETFTSYARECAQQKIIIDWRRAGFCEK-KCPNGKEYSDCMSSCPASCAAVGSYEDGQCRDECVSGCECPAGLYLEQGVCVKEEECPCFHRR-----QRYSPGDTIKQRCNQCVCRG-GRWHC-TQDKCAAQCSVVGDPHYVTFDRKRYSFHGTCDYILVQ----DYVDGKLLITAENVACGSKGSVSCLRAITVT----AHKTSIRLSTKGDYTVNGREVTLPFL---SPDLSVRWVSSSFLLLQTFGAYVLWSLEFPAAHITLQPVFSNKVRGLCGTFNWNQNDDFTTPEGDIETSSFSFANKFKVSAEC--PDVGPFTFDPCGTYAQRREFAEEACAVI---LSPACHDLVEWEPFHQLCLYDVCGC-----APNKNCLCSAVSAYARQCAQEGAIMSWRNQTFCPVQCTGGQMYMECTPPCRKTCADLRMAGTGSCQELEGCVAGCNCPEGLVLDE-SGQCVPPNMCQCHHGAETHQPGSKIQQNCKSCVCENGVWNCTGSSCPEAAYCPGNMVYSP-GSCLLTCDSLERNGTCSDTLDGCVCPEGTALLDSCVLPE-DCPCHHHGKLYHPNDTIVK---DCN-TCVCKNRHWSCTDLQCSGVCTATGDPHYVTFDGRSFTFLGDCQYVLARE----NGGLFTVTAENVPCGTSGITCTKSVVVMIGNMIVHMLRGKEVTINGISVRPPKIYSGNGITLERAGLFTMFISQMGLTVLWDGGTRVYVKLDPAFRGRVSGLCGNFDGDTENDFTSRQGIVEPTADLFGNSWRMSLMCPEVNADDFEHPCTENSHRVTWARKKCGVLLQSLFAACHQEVPCQQYYDWCVYDTCGCDSGGDCECLCTAIATYAEQCNQRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTCKNLGLAPDPHCNSLSCVEGCFCPAGKVLHEGRCL-DPSDCPCY-WGGMPFPTGAAIKHGCKNCTCEAGKWQCPTE 1348          

HSP 2 Score: 199.519 bits (506), Expect = 3.173e-50
Identity = 135/435 (31.03%), Postives = 200/435 (45.98%), Query Frame = 2
Query: 1202 NQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR---LRQRPNCDN-DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYC 2494
            + C   ++CPC +         Y   D + K C  C+C++R  W C T  QCS  C  TGDPH+VTFD +     G CQY+         +    ++  EN  C  S  ITC K + ++ G  +    + +    EV IN   V  P KI  G  I++ +     + I    L +V     +R+ + L   +  +V+GLCGNF+GD E+D     G            +R++  C  EV    +   C  +      A + CG   Q  F  C   VP  ++   C +D C C    +     C C+A + YA  C+ +G+  +WRT + CP+ C   MVY+ CG +C  TC+   L   P+C++  C++GC CP   V+ E  G C+   DC C + G  +      K  C  CTC  G W C T+ CSS S+C
Sbjct:  947 DSCVLPEDCPCHHHGKL-----YHPNDTIVKDCNTCVCKNR-HWSC-TDLQCSGVCTATGDPHYVTFDGRSFTFLGDCQYVLA-----RENGGLFTVTAENVPCGTS-GITCTKSVVVMIGNMI----VHMLRGKEVTINGISVR-PPKIYSGNGITLERAGLFTMFISQMGL-TVLWDGGTRVYVKLDPAFRGRVSGLCGNFDGDTENDFTSRQGIVEPTADLFGNSWRMSLMCP-EVNADDFEHPCTENSHRVTWARKKCGVLLQSLFAACHQEVPCQQYYDWCVYDTCGC---DSGGDCECLCTAIATYAEQCNQRGVYIRWRTQDLCPMQCDNGMVYEACGPACPQTCKNLGLAPDPHCNSLSCVEGCFCPAGKVLHE--GRCLDPSDCPCYWGGMPFPTGAAIKHGCKNCTCEAGKWQCPTEPCSSPSHC 1356          

HSP 3 Score: 64.6994 bits (156), Expect = 2.655e-9
Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 2
Query: 2456 NCTTKDCSSQS--YCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPC 2653
             C  + CS ++   CP+GKVWK+CG    +C D++      SC+PGCYC  GEV  NN C+P   CPC
Sbjct: 2919 TCNLRPCSGEAPGVCPDGKVWKECGDGPSSCADLSSETTNGSCQPGCYCHHGEVLLNNLCVPTAACPC 2986          

HSP 4 Score: 54.299 bits (129), Expect = 3.920e-6
Identity = 35/90 (38.89%), Postives = 45/90 (50.00%), Query Frame = 2
Query: 2219 VYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYM--GRDYNANE--ERKDRCNTCTCINGLWNCTTKDC 2476
            V+  CG  C  TC      +C   C  GC CP+  V+ E    CV VE+C C  +  GR Y   E    +D CN CTC+NG  +CT + C
Sbjct: 3086 VFSSCGPPCPRTCD--DITHCMWRCQPGCYCPNGQVLSENGTACVDVEECTCLDIISGRRYLPGEMVPHRDGCNNCTCLNGTLSCTKEPC 3173          

HSP 5 Score: 53.5286 bits (127), Expect = 6.323e-6
Identity = 36/114 (31.58%), Postives = 49/114 (42.98%), Query Frame = 2
Query: 3542 NYENCPIMCPPDREYKPCEKVCPETCI----GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK---------------DESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            N  NC   CP D+ Y  C  VCP+TC     GT+     C  GC C     L +  C+S +  CTC                +E+ KEY  GT +   C+ C C +  F C ++
Sbjct: 4600 NSHNCTPECPGDQVYSDCANVCPQTCADLRPGTECVNETCEPGCSCPVGQVLLNGTCISPE-NCTCSLQPTASMPWAANLTLEETMKEYKAGTAIYHQCNSCVCHMGAFSCTQD 4712          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ENSXETT00000033057.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 451.825 bits (1161), Expect = 7.966e-128
Identity = 360/1230 (29.27%), Postives = 555/1230 (45.12%), Query Frame = 2
Query:  302 CTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFL-FKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKV----VSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNN-KCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCY---CKNNTYLKDD--ECVSEKPLCTCKDESGKEYPLGTTV--IKNCHKCTCQINGFECEKEL 3829
            C+      +KTFD     Q   T N V    C +   TY+   I     + ++  +   TI ++  K       L    V VG    + PY++    I     YV V     L + +N+  ++ +          CGLCG  +    D F+     ++P++   +  K+     + N + P P     +   + M +        + +    + + C  + C  +N  +   L   +A  S           +WR    C+  +CP  M + +CG+ C + C  ++    C+  C  GC+C     +       C    EC C Y        +Y  G+     C+NC C   G W C     C   C + G  H  T+D  H    G C Y  V  K+   +    +++ E   C  ++  TC K I +   +G  QT + +KS   V+IN     IP        I+VF+ ++  L I++  G    V      ++ + L ++Y     GLCG+FN    DD     GA     +  A  ++    C  + ++ SY   C  S+E  K A   C       G F  C A+V    +   C +D CN    ++  ++   C+A S Y   C+++GI    WRT       CPKN  Y+   SSC  TCR    P  D  C      +DGC CP+   ++E +G+CV   +C C Y G    A E   D    CTC +G   C  K       CP   V+ DC           CQ+TC  +++ C    C  GC C  G V +NN  C+P+ +CPC    + ++    I +   +C  +C C+  KW C  + C   C  +GE HY +FDGK F F GDC Y L +DYC  N  +G+F+++ EN+ CGS G +C+KSI+ +  +  + L  G   +I R+      +G+ +  +   +   ++I  +  L + WD++ S+ + L+PE++ NVCGLCGN+D +V N+L  R+  +  +V  F +SWK   +CP  +  ++PC  N +R+SWA K CS++ S  F  C + V    +Y+ CV DSCACD G DC C CTA++ Y   CN   I I WR  E CP+ C    PD E    YKPC   C +TC   + +C +    +EGCY    K+  +  +D  +CV++   C C D+ GK Y +G  V  +KNC  C C   G  C+ +L
Sbjct:   46 CSTWGNFHFKTFDG-DIFQFPGTCNYVFASHCKT---TYEDFNIQ----IRRTPSEERATITYVTMKIEGLVIELEKGQVLVGGERVTLPYTQFGVHIEINSIYVKVSAKLGLVLLWNEDDALSLDLQPKYFNSTCGLCGNMNRVKQDLFKVNGIELSPLQFG-NLQKLDGPTEQCNDVTPSPPKNCSDLACSRMLSNPAFADCELRMPLEPYVQSCVLDLCNCQNSSDVTCLCDTLAEYSRQCAHAGGKPKNWRSHQICQR-SCPMNMTYEECGSPCADTCSNSDRKTTCADHCIDGCFCPPGTVFDDMNNRGCVPLSECSCTYNNK-----NYAVGESYSTNCRNCTCVG-GQWSCQAL-PCPGYCSLQGGSHIFTYDGSHYNFHGDCSY--VFTKDCVGNT--FTVLAELHTCGVTDTETCLKSITLSMDKG--QTVVTVKSSGTVLINGIYAQIPMTTEN---ITVFQASTFYLIIQSFSGLQIQVQLTPVMQLYVTLESEYQGNTCGLCGDFNNVRTDDFRSLSGAMEGTAAAFANTWKSQADC--DNIKDSYNNPCSLSVENEKYAQHWCSMLTDANGPFAPCHAVVNPTLYEKNCMYDSCN--YEKSEDSV---CAAMSFYVHACAVEGISLNGWRTTVCGKCNCPKNTTYQYSISSCQPTCRSLSEP--DPTCSVSFPPVDGCGCPNGTYLDE-SGSCVPDHNCPCYYKGTPMPAGEVIYDNGAMCTCQSGRLQCVGKTLK----CPENMVYFDCANASMGARGAECQKTCHTLDMDCISIQCASGCICPDGLVLNNNGSCVPEEQCPCMHNGEMYHSGETIQQ---DCN-TCVCKDRKWNCTNKACHRSCVVYGEGHYKTFDGKQFHFSGDCEYTLTQDYCASNTGNGSFRVITENIPCGSTGATCSKSIKVFLGNFELQLSEGGFDVIERD------IGSEVPYQIRQMGIYLVIEAKNGLILIWDKKTSIMIKLSPEFQGNVCGLCGNYDGSVYNELTTRSQSVVVNVQEFGNSWKESPTCPDAQPLRHPCVANPYRQSWAQKHCSVIISSVFAKCQSKVDPTTFYEACVHDSCACDSGGDCECFCTAVAAYAAACNDAGICIAWRTPEICPLFCDYYNPDGECEWHYKPCGAPCMKTCRNPSGNCKNQLPGLEGCYPKCPKDRPFFDEDVMKCVAQAN-CGCYDDDGKRYSIGNMVPSVKNCESCICTKKGRRCQMDL 1224          

HSP 2 Score: 123.635 bits (309), Expect = 3.410e-27
Identity = 96/359 (26.74%), Postives = 151/359 (42.06%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP-----YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG  H+ +FDG  F F G C+YV    +C      F I I       + T    +++   +  +I L +G   + G   T  PY   G+  + + +   V     L + W+   ++ + L P+Y N+ CGLCGN  + V  DL    GI  + +  F +  KL           P   KN  D+   R         +L +  F  C   +  + Y   CV D C C    D  C+C  +++Y  +C     K + WR+++ C   CP +  Y+ C   C +TC  +    +C   C++GC+C   T   D       PL  C    + K Y +G +   NC  CTC    + C+
Sbjct:   45 VCSTWGNFHFKTFDGDIFQFPGTCNYVFAS-HCKTTYEDFNIQIRRTPSEERATITYVTMKI--EGLVIELEKGQVLVGGERVTL-PYTQFGVHIEINSIYVKVSAKLGLVLLWNEDDALSLDLQPKYFNSTCGLCGNM-NRVKQDLFKVNGIELSPLQ-FGNLQKLDGPTEQCNDVTPSPPKNCSDLACSR---------MLSNPAFADCELRMPLEPYVQSCVLDLCNCQNSSDVTCLCDTLAEYSRQCAHAGGKPKNWRSHQICQRSCPMNMTYEECGSPCADTCSNSDRKTTCADHCIDGCFCPPGTVFDDMNNRGCVPLSECSCTYNNKNYAVGESYSTNCRNCTCVGGQWSCQ 388          

HSP 3 Score: 95.1301 bits (235), Expect = 1.449e-18
Identity = 71/284 (25.00%), Postives = 122/284 (42.96%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYY-KDHII---HLIRGAA---------PIIGRNPTWSPYLGTGIFSKHDYVSSIV---IITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN 3553
            C ++ CE +C  WG SHY++FDG ++DF G C+YVL++     +   F++ I+N  C  +  +C KS+R  Y KD+I+     ++G           P + RN     Y G  +  +   + + +   +++  +K+  D+           + NN  G CG   +N ++D     G +       A  W        P  + +         + +  R +I  S     CHN V  + +Y  CV D C    G     +C+++  Y   C+   I + WRN  N
Sbjct: 1896 CYQKQCECICGGWGTSHYITFDGTYYDFTGQCTYVLVQQI-TPRFDHFRVYIDNFSCLPEDPTCVKSLRIMYNKDNILLTSQEVKGQPVYFNDERVYPTLSRNGIQISYTGIFLIVEIPELGAYISFNVLSFTIKLPMDK-----------FSNNTEGHCGKCSNNRNDDCILPNGQLAPSCTQMAGQWGA------PSQNSSTSCSASSTSAPSTTRPTIPSST--RSCHNIVPPEPFYQSCVSDGCNNPEGS---LLCSSLQTYAMFCSLEGICVDWRNSTN 2156          

HSP 4 Score: 69.707 bits (169), Expect = 6.796e-11
Identity = 73/282 (25.89%), Postives = 117/282 (41.49%), Query Frame = 2
Query: 1352 QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFG-EGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDL--FSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCN---CGLLRNASTINCECSAYSAYARICSIKGIQFQWR 2179
            QC   C   G  H++TFD  +    GQC Y+ V  ++I        + ++N  C   ED TC K ++I++  + +  T  E+K +  V  N + V  P+    G++IS    T   L +E  +L  +  F      I+L +  K++    G CG  + +  DD I+P+G  A   +++A ++             S       S     I +           + C  +VP + F   C  D CN     LL         CS+   YA  CS++GI   WR
Sbjct: 1900 QCECICGGWGTSHYITFDGTYYDFTGQCTYVLV--QQITPRFDHFRVYIDNFSCL-PEDPTCVKSLRIMYNKDNILLTSQEVKGQ-PVYFNDERV-YPTLSRNGIQIS---YTGIFLIVEIPELGAYISFNVLSFTIKLPMD-KFSNNTEGHCGKCSNNRNDDCILPNGQLAPSCTQMAGQWGAPS--QNSSTSCSASSTSAPSTTRPTIPSST---------RSCHNIVPPEPFYQSCVSDGCNNPEGSLL---------CSSLQTYAMFCSLEGICVDWR 2152          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ENSXETT00000018772.1 (mucin-2-like [Source:NCBI gene;Acc:100495470])

HSP 1 Score: 450.284 bits (1157), Expect = 2.755e-127
Identity = 360/1230 (29.27%), Postives = 553/1230 (44.96%), Query Frame = 2
Query:  302 CTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFL-FKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKV----VSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNN-KCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCY---CKNNTYLKDD--ECVSEKPLCTCKDESGKEYPLGTTV--IKNCHKCTCQINGFECEKEL 3829
            C+      +KTFD     Q   T N V    C +   TY+   I     + ++  +   TI ++  K       L    V VG    + PY++    I     YV V     L + +N+  ++ +          CGLCG  +    D F+     ++P++   +  K+     + N + P P     +   + M +        + +    + + C  + C  +N  +   L   +A  S           +WR    C+  +CP  M + +CG+ C + C  ++    C+  C  GC+C     +       C    EC C Y        +Y  G+     C+NC C   G W C     C   C + G  H  T+D  H    G C Y  V  K+   +    +++ E   C  ++  TC K I +   +G  QT + +KS   V+IN     IP        I+VF+ ++  L I++  G    V      ++ + L ++Y     GLCG+FN    DD     GA     +  A  ++    C  + ++ SY   C  S+E  K A   C       G F  C A+V    +   C +D CN     ++      C+A S Y   C+++GI    WRT       CPKN  Y+   SSC  TCR    P  D  C      +DGC CP+   ++E +G+CV   +C C Y G    A E   D    CTC +G   C  K       CP   V+ DC           CQ+TC  +++ C    C  GC C  G V +NN  C+P+ +CPC    + ++    I +   +C  +C C+  KW C  + C   C  +GE HY +FDGK F F GDC Y L +DYC  N  +G+F+++ EN+ CGS G +C+KSI+ +  +  + L  G   +I R+      +G+ +  +   +   ++I  +  L + WD++ S+ + L+PE++ NVCGLCGN+D +V N+L  R+  +  +V  F +SWK   +CP  +  ++PC  N +R+SWA K CS++ S  F  C + V    +Y+ CV DSCACD G DC C CTA++ Y   CN   I I WR  E CP+ C    PD E    YKPC   C +TC   + +C +    +EGCY    K+  +  +D  +CV++   C C D+ GK Y +G  V  +KNC  C C   G  C+ +L
Sbjct:   46 CSTWGNFHFKTFDG-DIFQFPGTCNYVFASHCKT---TYEDFNIQ----IRRTPSEERATITYVTMKIEGLVIELEKGQVLVGGERVTLPYTQFGVHIEINSIYVKVSAKLGLVLLWNEDDALSLDLQPKYFNSTCGLCGNMNRVKQDLFKVNGIELSPLQFG-NLQKLDGPTEQCNDVTPSPPKNCSDLACSRMLSNPAFADCELRMPLEPYVQSCVLDLCNCQNSSDVTCLCDTLAEYSRQCAHAGGKPKNWRSHQICQR-SCPMNMTYEECGSPCADTCSNSDRKTTCADHCIDGCFCPPGTVFDDMNNRGCVPLSECSCTYNN-----KNYAVGESYSTNCRNCTCVG-GQWSCQALP-CPGYCSLQGGSHIFTYDGSHYNFHGDCSY--VFTKDCVGNT--FTVLAELHTCGVTDTETCLKSITLSMDKG--QTVVTVKSSGTVLINGIYAQIPMTTEN---ITVFQASTFYLIIQSFSGLQIQVQLTPVMQLYVTLESEYQGNTCGLCGDFNNVRTDDFRSLSGAMEGTAAAFANTWKSQADC--DNIKDSYNNPCSLSVENEKYAQHWCSMLTDANGPFAPCHAVVNPTLYEKNCMYDSCNYEKSEDSV-----CAAMSFYVHACAVEGISLNGWRTTVCGKCNCPKNTTYQYSISSCQPTCRSLSEP--DPTCSVSFPPVDGCGCPNGTYLDE-SGSCVPDHNCPCYYKGTPMPAGEVIYDNGAMCTCQSGRLQCVGKTLK----CPENMVYFDCANASMGARGAECQKTCHTLDMDCISIQCASGCICPDGLVLNNNGSCVPEEQCPCMHNGEMYHSGETIQQ---DCN-TCVCKDRKWNCTNKACHRSCVVYGEGHYKTFDGKQFHFSGDCEYTLTQDYCASNTGNGSFRVITENIPCGSTGATCSKSIKVFLGNFELQLSEGGFDVIERD------IGSEVPYQIRQMGIYLVIEAKNGLILIWDKKTSIMIKLSPEFQGNVCGLCGNYDGSVYNELTTRSQSVVVNVQEFGNSWKESPTCPDAQPLRHPCVANPYRQSWAQKHCSVIISSVFAKCQSKVDPTTFYEACVHDSCACDSGGDCECFCTAVAAYAAACNDAGICIAWRTPEICPLFCDYYNPDGECEWHYKPCGAPCMKTCRNPSGNCKNQLPGLEGCYPKCPKDRPFFDEDVMKCVAQAN-CGCYDDDGKRYSIGNMVPSVKNCESCICTKKGRRCQMDL 1224          

HSP 2 Score: 122.865 bits (307), Expect = 5.109e-27
Identity = 96/359 (26.74%), Postives = 151/359 (42.06%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP-----YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG  H+ +FDG  F F G C+YV    +C      F I I       + T    +++   +  +I L +G   + G   T  PY   G+  + + +   V     L + W+   ++ + L P+Y N+ CGLCGN  + V  DL    GI  + +  F +  KL           P   KN  D+   R         +L +  F  C   +  + Y   CV D C C    D  C+C  +++Y  +C     K + WR+++ C   CP +  Y+ C   C +TC  +    +C   C++GC+C   T   D       PL  C    + K Y +G +   NC  CTC    + C+
Sbjct:   45 VCSTWGNFHFKTFDGDIFQFPGTCNYVFA-SHCKTTYEDFNIQIRRTPSEERATITYVTMKI--EGLVIELEKGQVLVGGERVTL-PYTQFGVHIEINSIYVKVSAKLGLVLLWNEDDALSLDLQPKYFNSTCGLCGNM-NRVKQDLFKVNGIELSPLQ-FGNLQKLDGPTEQCNDVTPSPPKNCSDLACSR---------MLSNPAFADCELRMPLEPYVQSCVLDLCNCQNSSDVTCLCDTLAEYSRQCAHAGGKPKNWRSHQICQRSCPMNMTYEECGSPCADTCSNSDRKTTCADHCIDGCFCPPGTVFDDMNNRGCVPLSECSCTYNNKNYAVGESYSTNCRNCTCVGGQWSCQ 388          

HSP 3 Score: 95.1301 bits (235), Expect = 1.406e-18
Identity = 71/284 (25.00%), Postives = 122/284 (42.96%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYY-KDHII---HLIRGAA---------PIIGRNPTWSPYLGTGIFSKHDYVSSIV---IITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN 3553
            C ++ CE +C  WG SHY++FDG ++DF G C+YVL++     +   F++ I+N  C  +  +C KS+R  Y KD+I+     ++G           P + RN     Y G  +  +   + + +   +++  +K+  D+           + NN  G CG   +N ++D     G +       A  W        P  + +         + +  R +I  S     CHN V  + +Y  CV D C    G     +C+++  Y   C+   I + WRN  N
Sbjct: 2080 CYQKQCECICGGWGTSHYITFDGTYYDFTGQCTYVLVQQI-TPRFDHFRVYIDNFSCLPEDPTCVKSLRIMYNKDNILLTSQEVKGQPVYFNDERVYPTLSRNGIQISYTGIFLIVEIPELGAYISFNVLSFTIKLPMDK-----------FSNNTEGHCGKCSNNRNDDCILPNGQLAPSCTQMAGQWGA------PSQNSSTSCSASSTSAPSTTRPTIPSST--RSCHNIVPPEPFYQSCVSDGCNNPEGS---LLCSSLQTYAMFCSLEGICVDWRNSTN 2340          

HSP 4 Score: 68.9366 bits (167), Expect = 1.254e-10
Identity = 73/282 (25.89%), Postives = 117/282 (41.49%), Query Frame = 2
Query: 1352 QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFG-EGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDL--FSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCN---CGLLRNASTINCECSAYSAYARICSIKGIQFQWR 2179
            QC   C   G  H++TFD  +    GQC Y+ V  ++I        + ++N  C   ED TC K ++I++  + +  T  E+K +  V  N + V  P+    G++IS    T   L +E  +L  +  F      I+L +  K++    G CG  + +  DD I+P+G  A   +++A ++             S       S     I +           + C  +VP + F   C  D CN     LL         CS+   YA  CS++GI   WR
Sbjct: 2084 QCECICGGWGTSHYITFDGTYYDFTGQCTYVLV--QQITPRFDHFRVYIDNFSCL-PEDPTCVKSLRIMYNKDNILLTSQEVKGQ-PVYFNDERV-YPTLSRNGIQIS---YTGIFLIVEIPELGAYISFNVLSFTIKLPMD-KFSNNTEGHCGKCSNNRNDDCILPNGQLAPSCTQMAGQWGAPS--QNSSTSCSASSTSAPSTTRPTIPSST---------RSCHNIVPPEPFYQSCVSDGCNNPEGSLL---------CSSLQTYAMFCSLEGICVDWR 2336          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 429.483 bits (1103), Expect = 8.261e-121
Identity = 323/1150 (28.09%), Postives = 514/1150 (44.70%), Query Frame = 2
Query:  545 GNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWL---SVSRENRMKP-----DPAIQMVNCDLNEMATCAKVVSIFGS--------KFEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSS------------QSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP-YPEISK-NPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDRE----------YKPCEKVCPETCIGTK--SCISDCMEGC--YCKNNTYLKD--DECVSEK--PLCTCKDESGKEYPLGTTVIKN------CHKCTCQINGFEC 3817
            G    S PY S   F  S+ G+Y          +  +  G++ V  P     + CGLCG Y+   +D F   +  +   E   DF   W       R  R  P     + + +    D  +     K  S F           +  IC  + C+   + N  C+   + A   +   ++ S+W     C+ P CP  M +++C + C   C   N +  C + C  GC C        ++C    EC C +  S K+   Y  G  +++ C +C C++ G W+C   D C   C +TG  HF +FDN+H    G CQY+       ++     S+ +E   C +  D  C +   +   +  N T I++K    V ++ + + +P  + +G  + +       +++   +   V      ++ + LS  Y+  ++GLCGN+NG+  DD + P G       +    ++L   C  ++++Q     C  + +  + + EVC       F+ C   V    ++  C++DVC+C     ++   C CSA S YA  CS KGI   WRTPEFCP+ C +  +Y++CGS C+ TCR    P+  C   C++GC CP  +   E  G CV   DC C Y G  +  ++   +  + C C NGL +C+T D  S            +  CP          C +TC++  L C  + C  GC C  G V   +KC+    CPCF   + +   + +     +C  +C C + KW+C +  C+  C A G SHY++FDG  + F GDC YVL +DYC   +GTF+I++ N  CG  G  CTK I   +++  I L      I  + P  S      +    +Y   I+++  ++ + WD+ + V V L   Y++ VCGLCGNFD   +NDL +    I+ D   F +SWK+   C  +  +S  + C  N  ++  A   C+IL  + F  C   V  + Y++ C  D+C C+   DC C C +++ Y H C +  I + WR+   CP  C    +          Y  C   CP TC   +  +C   C+EGC  YC     L +  + C+  K  P+CT +   G   P G  +I N      C  C C+    +C
Sbjct:  100 GEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILT--ENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCECAEELNCPCQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKR---YPPGSAIRRDCNSCTCQN-GAWECSNED-CPGECFVTGQSHFKSFDNKHFTFSGICQYLLAT----DAMDSTFSVTIETVQCADDIDAVCTRSASLRLLDMHNIT-IKLKHGGGVSLDGQDILLP--LVQGF-LRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDC-TDLMKQD-TDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSC-----SNGKECLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNED-GECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVE---IDCN-TCVCENRKWKCTENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI--KKP-LSDETSFDVLKSGNYF--ILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIE---GHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1211          

HSP 2 Score: 156.762 bits (395), Expect = 2.675e-37
Identity = 115/365 (31.51%), Postives = 170/365 (46.58%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHI-IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-----PYPEISKNPCDI-NKFRESWAIKRCSILK-SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYN-IKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C  +GE+H  +FDG F+DF+GDCSY+L  D CNK S +      N   G K     KS+  Y  ++  IHL        G      PY   GIF + +      + ++E    ++ D   +V V L  ++ N  CGLCGN++   ++D   + GI+  +   FA+SW L          YP    N C+I ++  E   ++RC +LK S  F  CH+ V    Y   C  D C C   ++  C C    +Y   C ++  I   W  +  C  +CP   EY  C   C +TC      + C   C++GC C +   L  D C+   P+  C    SGK YP G+ + ++C+ CTCQ   +EC  E
Sbjct:   30 CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKHSFSLLADYRN---GKK-----KSVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESE-AGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYP--PSNTCNISSETAEKDFMQRCQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCI---PVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNE 377          

HSP 3 Score: 123.635 bits (309), Expect = 2.863e-27
Identity = 116/474 (24.47%), Postives = 200/474 (42.19%), Query Frame = 2
Query: 1289 KKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKI-EAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLG-LCETSIEWG---KIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEE---RKDRCNTCTCI-NGLWNCTTKDCSSQS--YCPNGKVWKDCGGCQRTCRDMNLICDPNSCE--PGCYCESGEV---YDNNKCIPKGECPC 2653
            K  C N L   +    C     C   C+ +   H VTFD     + G C Y+         ++  + +I+ N  C  +   TC K +++      N+  I + S  +V +N  +V +P   N   E++++      +KI + G +F+    ++  +  +  A ++ + +GLCG  + +  +D  + DG+   D S+    + +  +          LG  CET  +      I++E C       F+ C  + P   + T C+   C+   +         C   +AY  +C I G+   WRTP+FCP+ CP+ MVY  C   C+  C +      C +   +GC CP+  VI    G CV  + C    +  G ++   E        C+ C C+ N + NCT   C +     C   ++ +     ++ C D   +CD  +C+  P  +CE+G V    +   C P  EC C
Sbjct: 1929 KPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVL-----FHDEVHDVKVILHNAECNTTNHQTCMKSVEVKH----NKYSILLSSNMQVSVNGDIVPLPYA-NDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDS----------LGRTCETKPDKACTQPISSE-CKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQDI---------CEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVI--VNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECAC 2370          

HSP 4 Score: 113.235 bits (282), Expect = 4.270e-24
Identity = 106/381 (27.82%), Postives = 148/381 (38.85%), Query Frame = 2
Query: 2720 SCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPE------------YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKN---CHKCTCQIN 3805
            +C CR   W CP      +C      H ++FDG  F   G CSYVL  D  +      K+++ N EC +    +C KS+   +  + I L       +  +    PY           V+    I  E+KI    QL      TP             +     GLCG  D N  ND     G +  D + F   W +  S      +K     +K         C I+ S+TFE CH     + Y+  C + SC    G D   +C  I+ YVH C    + I WR  + CP+ CP    Y  C   C + C  T +   C     EGC+C     + + +CV+EK    C D  G+E+ L  T I     C  C C  N
Sbjct: 1944 TCGCR---WTCP-----CMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDEVHD----VKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF-----EVTLYGEIVHEVKIP---QLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKP----DKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLEN 2294          
BLAST of Hemocytin vs. Ensembl Xenopus
Match: ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:Xenbase;Acc:XB-GENE-945877])

HSP 1 Score: 424.861 bits (1091), Expect = 1.939e-119
Identity = 323/1170 (27.61%), Postives = 518/1170 (44.27%), Query Frame = 2
Query:  545 GNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWL------------------SVSRENRMKPDPAIQMVNCDLNEMAT----CAKVVSIFGSKFEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY--------------------------CPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP-YPEISK-NPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDRE----------YKPCEKVCPETCIGTK--SCISDCMEGC--YCKNNTYLKD--DECVSEK--PLCTCKDESGKEYPLGTTVIKN------CHKCTCQINGFEC 3817
            G    S PY S   F  S+ G+Y          +  +  G++ V  P     + CGLCG Y+   +D F   +  +   E   DF   W                   ++S E   K    +  V C + + ++    C  +V      +  IC  + C+   + N  C+   + A   +   ++ S+W     C+ P CP  M +++C + C   C   N +  C + C  GC C        ++C    EC C +  S K+   Y  G  +++ C +C C++ G W+C   D C   C +TG  HF +FDN+H    G CQY+       ++     S+ +E   C +  D  C +   +   +  N T I++K    V ++ + + +P  + +G  + +       +++   +   V      ++ + LS  Y+  ++GLCGN+NG+  DD + P G       +    ++L   C  ++++Q     C  + +  + + EVC       F+ C   V    ++  C++DVC+C     ++   C CSA S YA  CS KGI   WRTPEFCP+ C +  +Y++CGS C+ TCR    P+  C   C++GC CP  +   E  G CV   DC C Y G  +  ++   +  + C C NGL +C+T D  S  +                          CP          C +TC++  L C  + C  GC C  G V   +KC+    CPCF   + +   + +     +C  +C C + KW+C +  C+  C A G SHY++FDG  + F GDC YVL +DYC   +GTF+I++ N  CG  G  CTK I   +++  I L      I  + P  S      +    +Y   I+++  ++ + WD+ + V V L   Y++ VCGLCGNFD   +NDL +    I+ D   F +SWK+   C  +  +S  + C  N  ++  A   C+IL  + F  C   V  + Y++ C  D+C C+   DC C C +++ Y H C +  I + WR+   CP  C    +          Y  C   CP TC   +  +C   C+EGC  YC     L +  + C+  K  P+CT +   G   P G  +I N      C  C C+    +C
Sbjct:   94 GEKHISMPYASNGIFLESEAGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILT--ENSYDFANSWALHGGARRCRRTYPPSNTCNISSETAEKVYVGLWKVECQMLKTSSAFMQCHHLVD--PDPYIAICEDDMCECAEELNCPCQTFLEYARTCAQHGVITSNWPTHTICK-PLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCIPVFECSCIH--SGKR---YPPGSAIRRDCNSCTCQN-GAWECSNED-CPGECFVTGQSHFKSFDNKHFTFSGICQYLLAT----DAMDSTFSVTIETVQCADDIDAVCTRSASLRLLDMHNIT-IKLKHGGGVSLDGQDILLP--LVQGF-LRIQTTVLSAVRLTYKEDLQVDWDGHGKLLIKLSPIYSGLISGLCGNYNGNQGDDFLTPSGLIETSVEDFGNSWKLNGDC-TDLMKQD-TDPCNLNPKRARFSEEVCFALMDSAFQSCHNEVNPAPYLKNCRYDVCSC-----SNGKECLCSALSTYAAACSRKGILIDWRTPEFCPIQCSEGKIYQQCGSPCNQTCRSLSHPDVDCREFCMEGCYCPPGLYTNED-GECVPKSDCSCYYDGELFQPDDVFSNHYSMCYCENGLMHCSTSDVPSGYFPESFFNQPPARVKRSLDCRPPLNKIICPADNPKATGIECAKTCQNYELECVSHGCISGCTCPDGMVRHKSKCMFPQRCPCFHAGKEYAPGSSVE---IDCN-TCVCENRKWKCTENICDATCSAIGVSHYLTFDGFRYKFPGDCQYVLAQDYCGGVTGTFRILVGNEGCGFSGEKCTKRITILFRNGEIELTNEQIHI--KKP-LSDETSFDVLKSGNYF--ILLLGNQMSVTWDKGMRVYVTLKETYRDKVCGLCGNFDGIENNDLISSNNQIEMDPVNFGNSWKVNPLCADFGAVSPLSLCKDNLMKQMAAENACNILMGDLFAECAKVVNPEPYWEICTYDTCTCESAGDCACFCDSLAAYAHVCAQRGINVHWRSSHLCPQSCEEKNQRDLDYVCEWRYNSCTTACPVTCQHPEPVNCPLKCVEGCQAYCPPGKILDEVSESCIEPKDCPVCTIE---GHTVPHGRKIILNHDDPQRCQLCHCEGKNLQC 1223          

HSP 2 Score: 154.836 bits (390), Expect = 1.085e-36
Identity = 118/385 (30.65%), Postives = 173/385 (44.94%), Query Frame = 2
Query: 2732 RSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHI-IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-----PYPEISKNPCDINK------FRESWAIKRCSILK-SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYN-IKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            R G W    R     C  +GE+H  +FDG F+DF+GDCSY+L  D CNK S +      N   G K     KS+  Y  ++  IHL        G      PY   GIF + +      + ++E    ++ D   +V V L  ++ N  CGLCGN++   ++D   + GI+  +   FA+SW L          YP    N C+I+       +   W ++ C +LK S  F  CH+ V    Y   C  D C C   ++  C C    +Y   C ++  I   W  +  C  +CP   EY  C   C +TC      + C   C++GC C +   L  D C+   P+  C    SGK YP G+ + ++C+ CTCQ   +EC  E
Sbjct:   14 RLGNWSVLAR-----CSLFGENHIQTFDGTFYDFYGDCSYMLAGD-CNKHSFSLLADYRN---GKK-----KSVSLYLGEYFDIHLFLDGTATQGEKHISMPYASNGIFLESE-AGYYKLSSQEHGFMVKIDASGNVQVVLPSKHFNKTCGLCGNYNQFAEDDFMMQEGILTENSYDFANSWALHGGARRCRRTYP--PSNTCNISSETAEKVYVGLWKVE-CQMLKTSSAFMQCHHLVDPDPYIAICEDDMCEC--AEELNCPCQTFLEYARTCAQHGVITSNWPTHTICKPLCPFGMEYNECVSPCVKTCQSLNINEVCQEQCIDGCSCPDGKVLDGDRCI---PVFECSCIHSGKRYPPGSAIRRDCNSCTCQNGAWECSNE 375          

HSP 3 Score: 124.02 bits (310), Expect = 2.666e-27
Identity = 116/474 (24.47%), Postives = 200/474 (42.19%), Query Frame = 2
Query: 1289 KKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKI-EAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLG-LCETSIEWG---KIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEE---RKDRCNTCTCI-NGLWNCTTKDCSSQS--YCPNGKVWKDCGGCQRTCRDMNLICDPNSCE--PGCYCESGEV---YDNNKCIPKGECPC 2653
            K  C N L   +    C     C   C+ +   H VTFD     + G C Y+         ++  + +I+ N  C  +   TC K +++      N+  I + S  +V +N  +V +P   N   E++++      +KI + G +F+    ++  +  +  A ++ + +GLCG  + +  +D  + DG+   D S+    + +  +          LG  CET  +      I++E C       F+ C  + P   + T C+   C+   +         C   +AY  +C I G+   WRTP+FCP+ CP+ MVY  C   C+  C +      C +   +GC CP+  VI    G CV  + C    +  G ++   E        C+ C C+ N + NCT   C +     C   ++ +     ++ C D   +CD  +C+  P  +CE+G V    +   C P  EC C
Sbjct: 1904 KPMCHNNLPAMKIEETCGCRWTCPCMCMGSSTRHIVTFDGLDFKLMGACSYVL-----FHDEVHDVKVILHNAECNTTNHQTCMKSVEVKH----NKYSILLSSNMQVSVNGDIVPLPYA-NDNFEVTLYGEIVHEVKIPQLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDS----------LGRTCETKPDKACTQPISSE-CKIMLSKTFEACHTIFPPKPYFTVCEEASCHGQDI---------CEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVI--VNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLENRMINCTAMPCPTVKPLTCGPCEIPRLKKTSEQCCPDYECVCDLTTCDVNPVPHCENGLVPVLTNPGHCKPNYECAC 2345          

HSP 4 Score: 112.849 bits (281), Expect = 5.808e-24
Identity = 106/381 (27.82%), Postives = 148/381 (38.85%), Query Frame = 2
Query: 2720 SCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPE------------YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKN---CHKCTCQIN 3805
            +C CR   W CP      +C      H ++FDG  F   G CSYVL  D  +      K+++ N EC +    +C KS+   +  + I L       +  +    PY           V+    I  E+KI    QL      TP             +     GLCG  D N  ND     G +  D + F   W +  S      +K     +K         C I+ S+TFE CH     + Y+  C + SC    G D   +C  I+ YVH C    + I WR  + CP+ CP    Y  C   C + C  T +   C     EGC+C     + + +CV+EK    C D  G+E+ L  T I     C  C C  N
Sbjct: 1919 TCGCR---WTCP-----CMCMGSSTRHIVTFDGLDFKLMGACSYVLFHDEVHD----VKVILHNAECNTTNHQTCMKSVEVKHNKYSILLSSNMQVSVNGDIVPLPYANDNF-----EVTLYGEIVHEVKIP---QLGFVFTFTPANNEFVLQLNPAAFSLRTSGLCGICDQNTVNDFTLSDGSVTTDSSKFIKEWTVVDSLGRTCETKP----DKACTQPISSECKIMLSKTFEACHTIFPPKPYFTVCEEASC---HGQD---ICEVIAAYVHVCRINGVCINWRTPDFCPMECPRLMVYHHCHMGCNKECGKTLNGTLCSDSSTEGCFCPEGDVIVNGKCVNEKVCSQCTDRYGEEHQLLETWIPTNAPCSICMCLEN 2269          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 445.662 bits (1145), Expect = 7.169e-126
Identity = 346/1167 (29.65%), Postives = 518/1167 (44.39%), Query Frame = 2
Query:  521 LSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNG-DDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCDLNE-----------MATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGV---EISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVT-GLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFC--PVI-CPKNMVYKECGSSCSATCR-LRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCY--CKNNTYLKDD---ECVSEKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            L+   V V N     P+S++   I     Y+ V     L   +N+  S+ +        + CGLCG ++G+   ++F + +  + P+E    F  +  +    E    P P  Q  NC                + CA +V I  S + E C  + C  ++   S  +   +A  S           DWR    C +  CP  M   +CG+ C + C        C   C  GC+C +        +  C    +C C Y  +      Y  G      C  C C S G W C     C+  C + G  H  TFD +   V G C Y+   P     D    +++VE + C  +E  TC K + +  G G  QTEI +K+  EV +N     +P            + F V    L ++     S   +   R++  L     R +T GLCGNFN    DD     G      +     ++    C    ++  +   C  S+E  K A   C       G F  C A V    F + C +D CNC       + +C C+A S+Y R C+ KG+    WR    C  P I CPK+M Y+   S+C  TCR L ++   D  C      +DGC CP    +++  G CV+   C C Y G      E  +D    CTC  G   C     +    C    ++ DC          GCQ++C  +++ C  + C PGC C +G V D N  C+   +CPC     ++     I  G   C  +CTC +  W+C  + C   C  +G+ HY++FDG+ + F+GDC Y LL+D C     +   F+++ EN+ CG+ GT+C+KSI+ +  ++ + L      ++ ++    P      +  H   + +V+ T   L + WD++ S+ + L+PE+K  VCGLCGNFDDN  ND   R+  + +D+  F +SWKL  SCP   + K+PC  N +R+SWA K+CSI+ SETF  CH  V    YY+ CV D+CACD G DC C CT ++ Y   C+   + + WR  + CP+ C    P+ +    Y+PC   C  TC   T  C+ D   +EGCY  C     + D+   +CVS   +      +GK Y  G +V   KNC  C C  +G  C
Sbjct:  146 LTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE----FGNLQKMDGPTEQCQDPLPVPQK-NCSARSGICEMILKGELFSGCAALVDI--SSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTL-----YAPGTNYSTDCTKCTC-SGGQWSCQ-DIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKP----CDSNAFTVLVELRKCGLTESETCLKTVTLNLGGG--QTEIMVKATGEVFVNQIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGL-----RGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPN--VKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC-----EKSEDCMCAALSSYVRACAAKGVLLSDWRD-GICTKPTITCPKSMTYQYHISTCQPTCRALNEK---DVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGP-APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CN-NCTCENRMWQCTDKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEP-----PYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1264          

HSP 2 Score: 135.191 bits (339), Expect = 7.488e-31
Identity = 120/386 (31.09%), Postives = 169/386 (43.78%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYI--AVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANE-------VCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEE-KTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCS 2479
            C   G+ H+ TFD Q  +  G C Y+  A      E    QL  + E+     S       G+ +              +K+ V++N+  V +P     GV I   ++++  LK+ A  G LF V+ +DDS + L L  KY  K  GLCG+FNG P            K +  L+   RLT    G +  Q   G  E   +   +  +       +C    +G+ F  C ALV    +V  C+ DVC C  L  +   +C C   + Y+R C+  G Q Q WR P  C   CP NM ++ECGS C  TC   Q    C++ CI GC CP+ MV+++     CV V  C C Y G  Y         C  CTC  G W+C    C+
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYEDFNIQLRRVQESNTTTLSRVTMKLDGLVVEL------------TKSSVLVNNHPVQLPFS-QSGVLI---ELSNGYLKVVARLGLLF-VWNEDDSLL-LELDTKYTNKTCGLCGDFNGSP------------KSNEFLSNNVRLTPLEFGNL--QKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPS---DCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDCTKCTCSGGQWSCQDIPCA 430          

HSP 3 Score: 118.627 bits (296), Expect = 8.993e-26
Identity = 91/357 (25.49%), Postives = 152/357 (42.58%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDND--LRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS-ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG  HY +FDG+ F F G C+YV    +C      F I +  V+     T+    +       ++ L + +  ++  +P   P+  +G+  +       V+    L   W+   S+ + L  +Y N  CGLCG+F+ +  ++  L N   +   +   F +  K+       E  ++P  + +   S     C  ILK E F  C   V    Y + C QD C C+  D   C+C  +++Y  +C     + Q WR    C   CP + +++ C   C +TC     ++ C   C+ GC+C     L D   +   P+  C    +G  Y  GT    +C KCTC    + C+
Sbjct:   79 VCSTWGNFHYKTFDGQVFYFPGLCNYV-FSAHCGDAYEDFNIQLRRVQ--ESNTTTLSRVTMKLDGLVVELTKSSV-LVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE---FGNLQKMDGPT---EQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDCTKCTCSGGQWSCQ 425          

HSP 4 Score: 107.457 bits (267), Expect = 1.959e-22
Identity = 99/386 (25.65%), Postives = 168/386 (43.52%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECG-SKGTSCTKSIRF-YYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQ--WDRQLSVDVFLTPE-----YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL--KTSCP-YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM---------EGCYCKNNTYL---KDDECVSEKPLCT-CKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++I+N  C      SC +SI   Y++D ++   R  + ++     ++  + +  F ++  V+S V I   + IQ    R +   +  + E     + NN  G CG   ++  ++ R   G I +  +  +  WK+  + SC   P    +               C ++ S TF+ CH+ +    +Y  C+ D C      D   VC+ +  Y   C    + I WR+  N  C   CP ++ Y+PC    P  C    S IS  +         EGC+C ++T L    D  CV   P C  C    G+    G T+  +C  C C+     C+K+
Sbjct: 2736 CQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDS-ISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICV---PSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKK 3113          

HSP 5 Score: 92.0485 bits (227), Expect = 9.527e-18
Identity = 103/472 (21.82%), Postives = 181/472 (38.35%), Query Frame = 2
Query: 1337 CDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVT--------IPSKINKGVEISVFKVTSDGLKIE-AGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGS----------SCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNG-----KVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGE----VYDNNKCIPKGEC 2647
            C  H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++++N +C   + ++C + I + + +    L +  +      ++I N+K+V+        + S++   + +++ ++   G+++  +G +FSV       +   L   +A    G CG    D +D+  +P G+ A   SE++  +++      +    +   +           + +C       FK C  ++P  +F   C  D C+   L         CS    YA +C+ +G+   WR  T   C   CP N VY+ CG           S S +  L++         +GC CPD   +   T + + V  C+      G            C  C C      C  K C  Q  CP        V  + G C   C   +  C+ + C P  +C         Y+   C P   C
Sbjct: 2735 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEI---GVRVMFSGLIFSV------EVPFNL---FANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYCHMLDLEVV------CSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEA----GPKTEGCFCPDSTTL-FSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKAC-PQPTCPEPGFVPVPVALEAGQC---CPQFSCACNSSHCPPPLHCPKNSSLIVTYEEGACCPTQNC 3177          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 441.425 bits (1134), Expect = 1.159e-124
Identity = 342/1166 (29.33%), Postives = 513/1166 (44.00%), Query Frame = 2
Query:  521 LSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNG-DDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCDLNE-----------MATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEI---SVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVT-GLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCP---VICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCY--CKNNTYLKDD---ECVSEKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            L+   V V N     P+S++   I     Y+ V     L   +N+  S+ +        + CGLCG ++G+   ++F + +  + P+E    F  +  +    E    P P  Q  NC                + CA +V I  S + E C  + C  ++   S  +   +A  S           DWR    C +  CP  M   +CG+ C + C        C   C  GC+C +        +  C    +C C Y  +      Y  G      C N    S G W C     C+  C + G  H  TFD +   V G C Y+   P     D    +++VE + C  +E  TC K + +  G G  QTEI +K+  EV +N     +P            + F V    L ++     S   +   R++  L     R +T GLCGNFN    DD     G      +     ++    C    ++  +   C  S+E  K A   C       G F  C A V    F + C +D CNC       + +C C+A S+Y R C+ KG+    WR    C    + CPK+M Y+   S+C  TCR       D  C      +DGC CP    +++  G CV+   C C Y G      E  +D    CTC  G   C     +    C    ++ DC          GCQ++C  +++ C  + C PGC C +G V D N  C+   +CPC     ++     I  G   C  +CTC +  W+C  + C   C  +G+ HY++FDG+ + F+GDC Y LL+D C     +   F+++ EN+ CG+ GT+C+KSI+ +  ++ + L      ++ ++    P      +  H   + +V+ T   L + WD++ S+ + L+PE+K  VCGLCGNFDDN  ND   R+  + +D+  F +SWKL  SCP   + K+PC  N +R+SWA K+CSI+ SETF  CH  V    YY+ CV D+CACD G DC C CT ++ Y   C+   + + WR  + CP+ C    P+ +    Y+PC   C  TC   T  C+ D   +EGCY  C     + D+   +CVS   +      +GK Y  G +V   KNC  C C  +G  C
Sbjct:  146 LTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE----FGNLQKMDGPTEQCQDPLPVPQK-NCSARSGICEMILKGELFSGCAALVDI--SSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTL-----YAPGTNYSTDCTNTC--SGGQWSCQ-DIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKP----CDSNAFTVLVELRKCGLTESETCLKTVTLNLGGG--QTEIMVKATGEVFVNQIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGL-----RGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPN--VKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC-----EKSEDCMCAALSSYVRACAAKGVLLSDWRD-GICTKPTITCPKSMTYQYHISTCQPTCRALNEK--DVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGP-APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CN-NCTCENRMWQCTDKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEP-----PYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1263          

HSP 2 Score: 128.642 bits (322), Expect = 8.057e-29
Identity = 123/386 (31.87%), Postives = 171/386 (44.30%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYI--AVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANE-------VCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEE-KTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCS 2479
            C   G+ H+ TFD Q  +  G C Y+  A      E    QL  + E      S   T ++    L G  +  T      K+ V++N+  V +P     GV I   ++++  LK+ A  G LF V+ +DDS + L L  KY  K  GLCG+FNG P            K +  L+   RLT    G +  Q   G  E   +   +  +       +C    +G+ F  C ALV    +V  C+ DVC C  L  +   +C C   + Y+R C+  G Q Q WR P  C   CP NM ++ECGS C  TC   Q    C++ CI GC CP+ MV+++     CV V  C C Y G  Y         C T TC  G W+C    C+
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYEDFNIQLRRVQE------SNTTTLSRVTMKLDGLVVELT------KSSVLVNNHPVQLPFS-QSGVLI---ELSNGYLKVVARLGLLF-VWNEDDSLL-LELDTKYTNKTCGLCGDFNGSP------------KSNEFLSNNVRLTPLEFGNL--QKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPS---DCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDC-TNTCSGGQWSCQDIPCA 429          

HSP 3 Score: 109.768 bits (273), Expect = 3.648e-23
Identity = 89/357 (24.93%), Postives = 150/357 (42.02%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDND--LRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS-ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG  HY +FDG+ F F G C+YV    +C      F I +  V+     T+    +       ++ L + +  ++  +P   P+  +G+  +       V+    L   W+   S+ + L  +Y N  CGLCG+F+ +  ++  L N   +   +   F +  K+       E  ++P  + +   S     C  ILK E F  C   V    Y + C QD C C+  D   C+C  +++Y  +C     + Q WR    C   CP + +++ C   C +TC     ++ C   C+ GC+C     L D   +   P+  C    +G  Y  GT    +C   TC    + C+
Sbjct:   79 VCSTWGNFHYKTFDGQVFYFPGLCNYV-FSAHCGDAYEDFNIQLRRVQ--ESNTTTLSRVTMKLDGLVVELTKSSV-LVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE---FGNLQKMDGP---TEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDCTN-TCSGGQWSCQ 424          

HSP 4 Score: 108.227 bits (269), Expect = 1.035e-22
Identity = 99/386 (25.65%), Postives = 168/386 (43.52%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECG-SKGTSCTKSIRF-YYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQ--WDRQLSVDVFLTPE-----YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL--KTSCP-YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM---------EGCYCKNNTYL---KDDECVSEKPLCT-CKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++I+N  C      SC +SI   Y++D ++   R  + ++     ++  + +  F ++  V+S V I   + IQ    R +   +  + E     + NN  G CG   ++  ++ R   G I +  +  +  WK+  + SC   P    +               C ++ S TF+ CH+ +    +Y  C+ D C      D   VC+ +  Y   C    + I WR+  N  C   CP ++ Y+PC    P  C    S IS  +         EGC+C ++T L    D  CV   P C  C    G+    G T+  +C  C C+     C+K+
Sbjct: 2032 CQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDS-ISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICV---PSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKK 2409          

HSP 5 Score: 92.8189 bits (229), Expect = 4.986e-18
Identity = 101/463 (21.81%), Postives = 174/463 (37.58%), Query Frame = 2
Query: 1337 CDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGS----------SCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNG-----KVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGE----VYDNNKCIPKGEC 2647
            C  H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++++N +C   + ++C + I + + +    L +  +      ++I N+K+V+ P     G+  S   +    + I+   +  +F      +E+  +  +A    G CG    D +D+  +P G+ A   SE++  +++      +    +   +           + +C       FK C  ++P  +F   C  D C      +   +   CS    YA +C+ +G+   WR  T   C   CP N VY+ CG           S S +  L++         +GC CPD   +   T + + V  C+      G            C  C C      C  K C  Q  CP        V  + G C   C   +  C+ + C P  +C         Y+   C P   C
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVS-PGFQQNGIVTSRVGIKMY-VTIQEIGVRVMFSGLIFSVEVPFNL-FANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC------HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEA----GPKTEGCFCPDSTTL-FSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKAC-PQPTCPEPGFVPVPVALEAGQC---CPQFSCACNSSHCPPPLHCPKNSSLIVTYEEGACCPTQNC 2473          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5ac (mucin 5, subtypes A and C, tracheobronchial/gastric [Source:MGI Symbol;Acc:MGI:104697])

HSP 1 Score: 441.425 bits (1134), Expect = 1.159e-124
Identity = 342/1166 (29.33%), Postives = 513/1166 (44.00%), Query Frame = 2
Query:  521 LSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNG-DDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNCDLNE-----------MATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEI---SVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVT-GLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCP---VICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCY--CKNNTYLKDD---ECVSEKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            L+   V V N     P+S++   I     Y+ V     L   +N+  S+ +        + CGLCG ++G+   ++F + +  + P+E    F  +  +    E    P P  Q  NC                + CA +V I  S + E C  + C  ++   S  +   +A  S           DWR    C +  CP  M   +CG+ C + C        C   C  GC+C +        +  C    +C C Y  +      Y  G      C N    S G W C     C+  C + G  H  TFD +   V G C Y+   P     D    +++VE + C  +E  TC K + +  G G  QTEI +K+  EV +N     +P            + F V    L ++     S   +   R++  L     R +T GLCGNFN    DD     G      +     ++    C    ++  +   C  S+E  K A   C       G F  C A V    F + C +D CNC       + +C C+A S+Y R C+ KG+    WR    C    + CPK+M Y+   S+C  TCR       D  C      +DGC CP    +++  G CV+   C C Y G      E  +D    CTC  G   C     +    C    ++ DC          GCQ++C  +++ C  + C PGC C +G V D N  C+   +CPC     ++     I  G   C  +CTC +  W+C  + C   C  +G+ HY++FDG+ + F+GDC Y LL+D C     +   F+++ EN+ CG+ GT+C+KSI+ +  ++ + L      ++ ++    P      +  H   + +V+ T   L + WD++ S+ + L+PE+K  VCGLCGNFDDN  ND   R+  + +D+  F +SWKL  SCP   + K+PC  N +R+SWA K+CSI+ SETF  CH  V    YY+ CV D+CACD G DC C CT ++ Y   C+   + + WR  + CP+ C    P+ +    Y+PC   C  TC   T  C+ D   +EGCY  C     + D+   +CVS   +      +GK Y  G +V   KNC  C C  +G  C
Sbjct:  146 LTKSSVLVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE----FGNLQKMDGPTEQCQDPLPVPQK-NCSARSGICEMILKGELFSGCAALVDI--SSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQ-TCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTL-----YAPGTNYSTDCTNTC--SGGQWSCQ-DIPCAGTCSVMGGSHMSTFDGRQYTVHGDCTYVLSKP----CDSNAFTVLVELRKCGLTESETCLKTVTLNLGGG--QTEIMVKATGEVFVNQIYTQLPVSTANATFFRPSTFFIVGETNLGLQLEIQLSPIMQTSVRLKPGL-----RGLTCGLCGNFNSMQADDFQTISGVVEGTAAAFFNTFKTQAACPN--VKNIFQDPCSLSVENEKYAQHWCSLLTNASGPFSQCHATVNPSTFFSNCMYDTCNC-----EKSEDCMCAALSSYVRACAAKGVLLSDWRD-GICTKPTITCPKSMTYQYHISTCQPTCRALNEK--DVTCHVSFIPVDGCTCPKGTFLDD-LGKCVQATSCPCYYKGSTVPNGESVQDSGAICTCTQGALTCIGGP-APTPVCDAPMIYFDCHNATPGDTGAGCQKSCHTLDMTCYSSECVPGCVCPNGLVADGNGGCVVTEDCPCVHNEATYRPGETIQVG---CN-NCTCENRMWQCTDKPCLATCAVYGDGHYITFDGQRYSFNGDCEYTLLQDNCGGNGSSQDAFRVITENIPCGTTGTTCSKSIKIFLGNYELKLSDSKMEVVQKDVGQEP-----PYFVHQMGNYLVVETDIGLVLLWDKKTSIFLRLSPEFKGRVCGLCGNFDDNAINDFTTRSQSVVSDMLEFGNSWKLSPSCPDVLVPKDPCTANPYRKSWAQKQCSIINSETFSACHAHVEPAKYYEACVNDACACDSGGDCECFCTTVAAYAQACHEVGVCVSWRTPDICPLFCDYYNPEGQCEWHYQPCGAPCMRTCQNPTGQCLQDLRGLEGCYPKCPPTAPIFDEGTMQCVSNCTVTFPCRVNGKLYRPGASVPSDKNCDSCICTESGVRC 1263          

HSP 2 Score: 128.642 bits (322), Expect = 8.057e-29
Identity = 123/386 (31.87%), Postives = 171/386 (44.30%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYI--AVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANE-------VCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEE-KTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCS 2479
            C   G+ H+ TFD Q  +  G C Y+  A      E    QL  + E      S   T ++    L G  +  T      K+ V++N+  V +P     GV I   ++++  LK+ A  G LF V+ +DDS + L L  KY  K  GLCG+FNG P            K +  L+   RLT    G +  Q   G  E   +   +  +       +C    +G+ F  C ALV    +V  C+ DVC C  L  +   +C C   + Y+R C+  G Q Q WR P  C   CP NM ++ECGS C  TC   Q    C++ CI GC CP+ MV+++     CV V  C C Y G  Y         C T TC  G W+C    C+
Sbjct:   80 CSTWGNFHYKTFDGQVFYFPGLCNYVFSAHCGDAYEDFNIQLRRVQE------SNTTTLSRVTMKLDGLVVELT------KSSVLVNNHPVQLPFS-QSGVLI---ELSNGYLKVVARLGLLF-VWNEDDSLL-LELDTKYTNKTCGLCGDFNGSP------------KSNEFLSNNVRLTPLEFGNL--QKMDGPTEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPS---DCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDC-TNTCSGGQWSCQDIPCA 429          

HSP 3 Score: 109.768 bits (273), Expect = 3.648e-23
Identity = 89/357 (24.93%), Postives = 150/357 (42.02%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDND--LRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS-ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG  HY +FDG+ F F G C+YV    +C      F I +  V+     T+    +       ++ L + +  ++  +P   P+  +G+  +       V+    L   W+   S+ + L  +Y N  CGLCG+F+ +  ++  L N   +   +   F +  K+       E  ++P  + +   S     C  ILK E F  C   V    Y + C QD C C+  D   C+C  +++Y  +C     + Q WR    C   CP + +++ C   C +TC     ++ C   C+ GC+C     L D   +   P+  C    +G  Y  GT    +C   TC    + C+
Sbjct:   79 VCSTWGNFHYKTFDGQVFYFPGLCNYV-FSAHCGDAYEDFNIQLRRVQ--ESNTTTLSRVTMKLDGLVVELTKSSV-LVNNHPVQLPFSQSGVLIELSNGYLKVVARLGLLFVWNEDDSLLLELDTKYTNKTCGLCGDFNGSPKSNEFLSNNVRLTPLE---FGNLQKMDGP---TEQCQDPLPVPQKNCSARSGICEMILKGELFSGCAALVDISSYVEACRQDVCLCESLDPSDCICHTLAEYSRQCAHAGGQPQDWRGPNLCSQTCPLNMQHQECGSPCVDTCSNPQHSQVCEDHCIAGCFCPEGMVLDDINQMGCVPVSQCACLYNGTLYAPGTNYSTDCTN-TCSGGQWSCQ 424          

HSP 4 Score: 108.227 bits (269), Expect = 1.035e-22
Identity = 99/386 (25.65%), Postives = 168/386 (43.52%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECG-SKGTSCTKSIRF-YYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQ--WDRQLSVDVFLTPE-----YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL--KTSCP-YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM---------EGCYCKNNTYL---KDDECVSEKPLCT-CKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++I+N  C      SC +SI   Y++D ++   R  + ++     ++  + +  F ++  V+S V I   + IQ    R +   +  + E     + NN  G CG   ++  ++ R   G I +  +  +  WK+  + SC   P    +               C ++ S TF+ CH+ +    +Y  C+ D C      D   VC+ +  Y   C    + I WR+  N  C   CP ++ Y+PC    P  C    S IS  +         EGC+C ++T L    D  CV   P C  C    G+    G T+  +C  C C+     C+K+
Sbjct: 2032 CQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVSPGFQQNGIVTSRVGIKMYVTIQEIGVRVMFSGLIFSVEVPFNLFANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC---HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDS-ISPSLTLQEAGPKTEGCFCPDSTTLFSTNDSICV---PSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKK 2409          

HSP 5 Score: 92.8189 bits (229), Expect = 4.986e-18
Identity = 101/463 (21.81%), Postives = 174/463 (37.58%), Query Frame = 2
Query: 1337 CDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGS----------SCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNG-----KVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGE----VYDNNKCIPKGEC 2647
            C  H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++++N +C   + ++C + I + + +    L +  +      ++I N+K+V+ P     G+  S   +    + I+   +  +F      +E+  +  +A    G CG    D +D+  +P G+ A   SE++  +++      +    +   +           + +C       FK C  ++P  +F   C  D C      +   +   CS    YA +C+ +G+   WR  T   C   CP N VY+ CG           S S +  L++         +GC CPD   +   T + + V  C+      G            C  C C      C  K C  Q  CP        V  + G C   C   +  C+ + C P  +C         Y+   C P   C
Sbjct: 2031 CCQHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVFGYFRVLIDNYYCDVGDSVSCPQSIIVEYHQDRVVLTRRPVSGVMTNQIIFNNKVVS-PGFQQNGIVTSRVGIKMY-VTIQEIGVRVMFSGLIFSVEVPFNL-FANNTEGQCGTCTNDKKDECRLPGGSIASSCSEMSLHWKVPNQPSCQGPPPTPTSVVPRPSPTPCPPSPLCELILSNTFKLCHDVIPPLQFYQGCLFDYC------HMLDLEVVCSGLELYASLCAAQGVCIPWRSQTNNTCSFTCPDNQVYQPCGPSNPHYCYRDDSISPSLTLQEA----GPKTEGCFCPDSTTL-FSTNDSICVPSCQWCLGPRGEPVEPGHTISIDCQDCICKEATLTCQKKAC-PQPTCPEPGFVPVPVALEAGQC---CPQFSCACNSSHCPPPLHCPKNSSLIVTYEEGACCPTQNC 2473          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Muc5b (mucin 5, subtype B, tracheobronchial [Source:MGI Symbol;Acc:MGI:1921430])

HSP 1 Score: 426.787 bits (1096), Expect = 9.270e-120
Identity = 342/1154 (29.64%), Postives = 517/1154 (44.80%), Query Frame = 2
Query:  563 FPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDG-NGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNE-----------MATCAKVVSIFGSKFEEICYAEFCQMKNQ--KNSCELMRDIAFLSS-PDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQ---CKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELV--LSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQ--GQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVI---CPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC---NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLG---TGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIG-TKSCISDC--MEGCYCK---NNTYLKDDE--CVSEKPLCTCKDESGKEYPLGTTV--IKNCHKCTCQINGFECEKEL 3829
             PYS+A   +     YV +     L   +N++ S  +        Q CGLCG ++G     +F T +  + P++   +  K+     +   + P     + NC   E              C  +V +  S + + C  + C+          E  R  A     P N    WR+   C    CP  M + +C + C + C        C   C  GC+C         +   C   ++C C +         Y  G+     C++C C   GLWKC     C   C + G  H  TFD +   V G C YI +  K  +S     +++V+ + C  ++   C K + +    G   T I I+    V +NS    +P  ++ G  I++FK +S  + ++ G    +  +    +++   L   Y  ++ GLCGNFN +  DD     G      +  +  ++   +C     + +Y   C  S+E    A E C    +  G F  C A V    F + C  D CNC      ++ +C C+A S+Y   C+ KG+    WR  + C      CP+   Y    SSC  TCR       D  C      +DGC CP+   + +K  +CV VE+C C + G      E   D    C+C NG   C        + C    V+ DC           C ++C  +++ C    C  GC C SG V D N  CI + +CPC     ++    +I     +C  +CTC++ +WEC  + C G C A+G+ H+++FDG+ + F G C Y L +DYC      +GTF+IV ENV CG+ GT+C+K+I+ + + + + L  G   ++ + P+  P       GIF   +  S IV+        WDR+ SV V L   YK  VCGLCGNFDDN  ND   R+  +  DV  F +SWK   SCP   + K+PC  N +R+SWA K+CSI+ S TF  CH+ V    YY+ CV D CACD G DC C CTA++ Y   C    + + WR  + CP+ C    P  E    Y+PC   C +TC   T  C+ D   +EGCY +   +  +  +D+  CV++   C C D++G  + +GT V   +NC  C C   G +C   L
Sbjct:  161 LPYSRAGLLMEKSSGYVKISIRLVLTFLWNEEDSALLELDSKYINQTCGLCGDFNGLPAVSEFYTHNTRLTPVQFG-NLQKLDGPTEQCQDVLPS---AVSNCTDTEDICRRTLLGPAFDKCTALVDV--SMYLDACVQDLCRCPTCPCATFAEYSRQCAHAGGYPQN----WRHPDLCNW-TCPFNMEYRECSSPCVDTCSNPQRSQLCEDHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCTHGGRI-----YAPGESFNTSCRSCTCFG-GLWKCK-DLPCPGTCSVQGGSHIFTFDEKLYNVHGDCSYI-LTKKCADSS---FTVLVDLRKCGVTDTENCLKAVTLNLNSG--DTVIRIQVNGAVFLNSIFTQMP--LSAG-NITIFKPSSFFIIVQTGMGLQLQVQLVPLMQVFVRLDRSYQGQMCGLCGNFNQNQADDFTALSGVVEGTGAAFSNTWKTQASCPNS--KNTYEDPCSYSVENENFAREWCSMLTESSGVFSACHATVSPVPFYSNCLFDTCNC-----ENSEDCMCAALSSYVFACAAKGVLLSGWRD-KVCYKYTNNCPQTKGYFYSVSSCQPTCRSLSE--ADVTCSVPFVTVDGCTCPEGTFLNDK-DHCVPVEECPCYFHGTVVAPREVVTDNGVVCSCTNGKLTCLGALMQKSTECQAPMVYLDCNNASVGHHGAECLKSCHTLDVECFSTQCVSGCVCPSGLVADGNGGCIAEEDCPCIHNEVTYRPGEIIR---VDCN-NCTCKNRRWECTNKPCMGACVAYGDGHFVTFDGERYIFEGSCEYTLAQDYCRGNTSTNGTFRIVTENVPCGTTGTTCSKTIKIFVESYELILHEGNFKVVEQGPSGDPPYKIRFMGIFLVIEIRSGIVV-------SWDRKTSVFVRLQQHYKGRVCGLCGNFDDNAINDFTTRSQSVVGDVLEFGNSWKFSPSCPDAPVPKDPCIANPYRKSWAQKKCSIINSATFAACHSQVDSTKYYEACVHDVCACDSGGDCECFCTAVAAYAQACRDVGVCLSWRTPDICPLFCDYYNPHGECEWHYQPCGAPCLKTCRNPTGHCLVDLPGLEGCYPQCPASQPFFNEDQMKCVAQ---CGCYDDNGNYHDIGTQVPTAENCQSCLCTPGGLQCVYNL 1262          

HSP 2 Score: 119.783 bits (299), Expect = 4.013e-26
Identity = 128/477 (26.83%), Postives = 187/477 (39.20%), Query Frame = 2
Query: 1139 VDC-SKVCTPGCYCRKDFFWYKNQ-CKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMP--KEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVIC----PKN---MVYKECGSSCSATCR------LRQRPNCDN-----------------DCIDGCQCPDDMVIEEKTGNCVKVED--------------------CKCEYMGRDYNANE 2407
            V+C S  C  GC C        N  C   ++CPC +        +Y+ G+ ++  C NC C++R  W+C T+  C   C+  GD HFVTFD +    EG C+Y       +   S      I+ EN  C  +   TC+K IKI F E      I  +   +V+        P KI     + +F V    ++I +G + S  RK  + + + L   Y  +V GLCGNF+ +  +D      +   D  E    ++ + +C    + +           W   A + C       F  C + V S K+   C HDVC C    +     C C+A +AYA+ C   G+   WRTP+ CP+ C    P       Y+ CG+ C  TCR      L   P  +                   C+  C C DD       G  V   +                    C C Y GR YN N+
Sbjct:  828 VECFSTQCVSGCVCPSGLVADGNGGCIAEEDCPCIHNEV-----TYRPGEIIRVDCNNCTCKNR-RWEC-TNKPCMGACVAYGDGHFVTFDGERYIFEGSCEYTLAQDYCRGNTSTNGTFRIVTENVPC-GTTGTTCSKTIKI-FVESYEL--ILHEGNFKVVEQGPSGDPPYKIRF---MGIFLV----IEIRSGIVVSWDRK--TSVFVRLQQHYKGRVCGLCGNFDDNAINDFTTRSQSVVGDVLEFGNSWKFSPSCPDAPVPKDPCIANPYRKSW---AQKKCSIINSATFAACHSQVDSTKYYEACVHDVCAC---DSGGDCECFCTAVAAYAQACRDVGVCLSWRTPDICPLFCDYYNPHGECEWHYQPCGAPCLKTCRNPTGHCLVDLPGLEGCYPQCPASQPFFNEDQMKCVAQCGCYDDNGNYHDIGTQVPTAENCQSCLCTPGGLQCVYNLTACTCTYEGRTYNYND 1278          

HSP 3 Score: 119.783 bits (299), Expect = 4.438e-26
Identity = 105/389 (26.99%), Postives = 160/389 (41.13%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYI-------------AVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCET--SIEWGKIAN-----EVCGKFGQG-QFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEE-KTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNC 2461
            C   GD H+ TFD       G C Y+               + + +E   P ++ ++             A+G+ I    G     + +    E +  S+   +  K +  V+IS+  V           L  ++ ++DS + L L +KY  +  GLCG+FNG P                      RLT    G +  Q   G  E    +    ++N     ++C +   G  F  C ALV    ++  C  D+C C          C C+ ++ Y+R C+  G   Q WR P+ C   CP NM Y+EC S C  TC   QR   C++ C+DGC CP   V+++ +   C+ +E C C + GR Y   E     C +CTC  GLW C
Sbjct:   81 CSTWGDFHYKTFDGDVFRFPGLCNYVFSSHCGATYEDFNIQLRRGLEGSRPTVTYVLLR-----------AQGLVIELSNG----SVLVNGHREKLPYSRAGLLMEKSSGYVKISIRLV-----------LTFLWNEEDSAL-LELDSKYINQTCGLCGDFNGLPAVSEF------------YTHNTRLTPVQFGNL--QKLDGPTEQCQDVLPSAVSNCTDTEDICRRTLLGPAFDKCTALVDVSMYLDACVQDLCRCP--------TCPCATFAEYSRQCAHAGGYPQNWRHPDLCNWTCPFNMEYRECSSPCVDTCSNPQRSQLCEDHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCTHGGRIYAPGESFNTSCRSCTCFGGLWKC 420          

HSP 4 Score: 116.316 bits (290), Expect = 5.021e-25
Identity = 103/389 (26.48%), Postives = 162/389 (41.65%), Query Frame = 2
Query: 2762 DCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG--TSCTKSIRFYYKDHIIHLIRGAAPIIGRNPT---WSPYLGTGIFSKHDYVSSIV--------IITKELKIQWDRQLSVDVFLTPEY-KNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSC---PYPEISKNP-CDINKFRESW---AIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTK--SCISDCMEGCYCKNNTYL---KDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELI 3832
            +CE  C  WG SHY++FDG  + F  +C+ VL+ +  + + G   I+  +  CG+    TSC +++  YY    I ++  +    G++ +   W        FSK+    S+         I T    I +D  +   ++L   Y  +N  G CG   ++  +D R   G I +D    A  W +     +SC   P P  S  P   ++    S    +   C ++ S+ F  CH  +    ++  CV D C  +  D    +C ++  Y   C    +   WRN     C + CPP +EY+PC  + P +C      S      EGC+C  N  L   + D CVSE   C C    G     G   I NC  C C+      + E +
Sbjct: 4117 ECECFCSGWGHSHYLTFDGTSYTFLDNCTSVLMREI-HPRHGNLSILAHSYYCGATTNVTSCPRALSVYYNSMEI-ILTISTTESGKDESLIIWDQMWIRSGFSKNGVTVSLSGATTMSVNISTIGTIITFDGNI-FQIWLPYRYFSSNTEGQCGTCTNSQIDDCRRPDGTIASDCQDMAKEWLVPGNSSSSCLAQPSPLPSTTPQTPVSSTLTSTPCPSAPLCELMLSQVFAECHRLIPPDAFFRSCVSDHCNANITD---MLCQSLEAYAALCRAQGVCTNWRNATGGLCDLSCPPTKEYRPCGPLHPASCNSRTQDSTTGMLAEGCFCPENQLLFNSRMDICVSE---CPCVGPDGLPKFPGEHWISNCQACVCEPGSVSVQCEPV 4496          

HSP 5 Score: 106.301 bits (264), Expect = 4.429e-22
Identity = 94/356 (26.40%), Postives = 143/356 (40.17%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISK--NPCDINKFRESWAIKRCS--------ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTC 3796
            +C  WG+ HY +FDG  F F G C+YV    +C      F I +     GS+ T     +    +  +I L  G+  + G      PY   G+  +       + I   L   W+ + S  + L  +Y N  CGLCG+F+             + A    +  + +L T   +  + K   P +  +     A+  C+         L    F+ C   V   +Y D CVQD C C       C C   ++Y  +C       Q WR+ + C   CP + EY+ C   C +TC     ++ C   CM+GC+C   T L D   +   PL  C     G+ Y  G +   +C  CTC
Sbjct:   80 VCSTWGDFHYKTFDGDVFRFPGLCNYV-FSSHCGATYEDFNIQLRRGLEGSRPT--VTYVLLRAQGLVIELSNGSVLVNGHREKL-PYSRAGLLMEKSSGYVKISIRLVLTFLWNEEDSALLELDSKYINQTCGLCGDFNG------------LPAVSEFYTHNTRL-TPVQFGNLQKLDGPTEQCQDVLPSAVSNCTDTEDICRRTLLGPAFDKCTALVDVSMYLDACVQDLCRCP-----TCPCATFAEYSRQCAHAGGYPQNWRHPDLCNWTCPFNMEYRECSSPCVDTCSNPQRSQLCEDHCMDGCFCPPGTVLDDVRHLGCLPLEQCHCTHGGRIYAPGESFNTSCRSCTC 413          

HSP 6 Score: 90.8929 bits (224), Expect = 2.344e-17
Identity = 126/531 (23.73%), Postives = 203/531 (38.23%), Query Frame = 2
Query: 1304 NCLCESRGL----W---KCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDIT-CAKGIKILFGEGLNQTEIEIK-SKTEVIINSKLVT-----IPSKINK-GVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKY-ARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQS--------YLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYM-GRDYNANEERKDRCNTCTCINGLWN--CTTKDCSSQSYCPN----GKVWKDCGGCQRTCRDMNL-ICDPNSCEPGC-YCESG----EVYDNNKCIPKGECP---CFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCE 2770
            N  C +R L    W    C  H +C   C   G  H++TFD         C   +V+ +EI      LSI+  + +C  + ++T C + + + +    N  EI +  S TE   +  L+      I S  +K GV +S+   T+  + +    + ++   D +  ++ L  +Y +    G CG       DD   PDG  A D  ++A  + +        L Q            +  T       +  +C       F +C  L+P D F   C  D CN      A+  +  C +  AYA +C  +G+   WR  T   C + CP    Y+ CG    A+C  R + +      +GC CP++ ++     + + V +C C    G      E     C  C C  G  +  C    C SQ   P     G V          C    L +C+  +C      CE G    + ++N+ C P   C    C + +  +        GP     +CTC S   + PK +C+
Sbjct: 4094 NVTCANRHLPIKVWDQEPCHFHYECECFCSGWGHSHYLTFDGTSYTFLDNC--TSVLMREIHPRHGNLSILAHSYYCGATTNVTSCPRALSVYY----NSMEIILTISTTESGKDESLIIWDQMWIRSGFSKNGVTVSLSGATT--MSVNISTIGTIITFDGNIFQIWLPYRYFSSNTEGQCGTCTNSQIDDCRRPDGTIASDCQDMAKEWLVPGNSSSSCLAQPSPLPSTTPQTPVSSTLTSTPCPSAPLCELMLSQVFAECHRLIPPDAFFRSCVSDHCN------ANITDMLCQSLEAYAALCRAQGVCTNWRNATGGLCDLSCPPTKEYRPCGPLHPASCNSRTQDSTTGMLAEGCFCPENQLLFNSRMD-ICVSECPCVGPDGLPKFPGEHWISNCQACVCEPGSVSVQCEPVKCESQDKPPQCTEAGFVTVTWPSADNPCCPETLCVCNSTTCPKSLPTCEPGYELVQTHENSSCCPSYSCRPKLCTYNDTIYGVGTTFPGGPCH---TCTCLSDGDQEPKVECK 4606          
BLAST of Hemocytin vs. Ensembl Mouse
Match: Vwf (Von Willebrand factor [Source:MGI Symbol;Acc:MGI:98941])

HSP 1 Score: 419.083 bits (1076), Expect = 1.283e-117
Identity = 325/1251 (25.98%), Postives = 530/1251 (42.37%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTG--NMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMK----PDPAIQMVNCDLN----EMATCAKVVSIFG--------SKFEEICYAEFCQ-MKNQKNSCELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDC-----------SSQSY----------------CPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP-----YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP----------DREYKPCEKVCPETCIGTK--SCISDCMEGC--YCKNNTYLKD--DECVSEK--PLCTC---KDESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            A+C+        TFD       +F G  + +L  DC  R  ++ I+            D   +++     +  +    ++  V  G+ S S PY S+  +   + G+Y             +  G+  V        + CGLCG ++   +D F T + ++       DF   W   S E R K    P    +  + D++    E     K  S+F           F  +C    C      + +C ++ + A   + + +V   W     C  P CP  M + +C + C   C   + +  C + C  GC C +     +++C ++ +CPC +         Y  G  + + C  C+C +  LW C ++++C   C++TG  HF +FDN++    G CQY+  + ++ E      SI++E   C +  D  C + + +     L+ + +++K    V I+ + V +P    +G ++ +       +++   +   +      R+ + LS  Y+ K  GLCGN+NG+  DD + P G       +    ++L   C    LR+ +   C  +    + A E C      +F+ C   V    ++  C++DVC+C   R+     C C+A + YA  C+ KG+   WR P FC + CP+  VY +CG+SC+ TCR    P+  C   C++GC CP  +  +E+ G+CV    C C Y G  +   +   D    C C +G  +CTT              S  S+                CP          C +TC++ +L C    C  GC C  G V   NKC+    CPCF Q   +     +  G   C  +C CR  KW C    C+  C A G +HY++FDG  + F G+C YVL++DYC    GTF+I++ N  C      C K +        + L  G   +       S +    +     YV  I+++ + L + WD  LS+ V L   Y+  VCGLCGNFD   +ND    +  ++ D   F +SWK+ + C        ++S   C  N  +++     C IL S+ F+ C+  V  + Y D C+ D+C+C+   DC C C  I+ Y H C ++   + WR    CP  C            +  Y  C   CP TC   +  +C   C+EGC  +C     L +    CV  +  P+C     +   GK+  L      +C  C C      CE
Sbjct:   33 ARCSLFGDDFINTFDET---MYSFAGGCSYLLAGDCQKR--SFSIL--------GNFQDGKRMSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYLEREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLT--SDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTCATGPECACPVLLEYARTCAQEGMVLYGWTDHSACR-PACPAGMEYKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVHAGK-----RYPPGTSLSQDCNTCICRN-SLWIC-SNEECPGECLVTGQSHFKSFDNRYFTFSGICQYL--LARDCEDHT--FSIVIETMQCADDPDAVCTRSVSVRLS-ALHNSLVKLKHGGAVGIDGQDVQLP--FLQG-DLRIQHTVMASVRLSYAEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLTPAGLVEPLVVDFGNAWKLQGDCSD--LRRQHSDPCSLNPRLTRFAEEACALLTSSKFEACHHAVSPLPYLQNCRYDVCSCSDSRD-----CLCNAVANYAAECARKGVHIGWREPGFCALGCPQGQVYLQCGNSCNLTCRSLSLPDEECSEVCLEGCYCPPGLYQDER-GDCVPKAQCPCYYDGELFQPADIFSDHHTMCYCEDGFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRAQGLECAKTCQNYDLECMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGDTVKIG---CN-TCVCRERKWNCTNHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHF---EVVESGRYV--ILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDFTTSSLQVEEDPVNFGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPYLDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGYECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCEVAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCE 1235          

HSP 2 Score: 127.872 bits (320), Expect = 1.125e-28
Identity = 97/367 (26.43%), Postives = 161/367 (43.87%), Query Frame = 2
Query: 2759 RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHI-IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDY-VSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS---CPYPEISKNPCDINKFRESWAI-KRCSILKSET-FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            R     C  +G+    +FD   + F G CSY+L  D C K+S +   ++ N + G +      S+  Y  +   IHL        G      PY   G++ + +     +   T     + D   +  V ++  + N  CGLCG+F+   ++D R + G + +D   FA+SW L +    C         C+ +      A+ ++C +LK+ + F  CH  V  + +   C +  C C  G +  C C  + +Y   C +  + +  W ++  C   CP   EYK C   CP TC      + C   C++GC C     L +D CV     C C   +GK YP GT++ ++C+ C C+ + + C  E
Sbjct:   29 RPSTARCSLFGDDFINTFDETMYSFAGGCSYLLAGD-CQKRSFS---ILGNFQDGKR-----MSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYLEREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTCATGPE--CACPVLLEYARTCAQEGMVLYGWTDHSACRPACPAGMEYKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSD-CPCV-HAGKRYPPGTSLSQDCNTCICRNSLWICSNE 382          

HSP 3 Score: 124.79 bits (312), Expect = 1.098e-27
Identity = 98/378 (25.93%), Postives = 150/378 (39.68%), Query Frame = 2
Query: 2693 TRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHLIRGA----------APIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS-CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKC 3790
            ++ P   + +C CR   W CP      +C      H ++FDG+ F   G CSYV+ ++    K    ++++ N  C      +C KSI   +      L              AP +G N   S Y       +  ++  I+  T +   ++  QLS   F +  +     GLCG  D+N  ND   R G +  D       W ++   P       P +     +S     C +L S +F  CH  +    ++  C QDSC  +R      VC  I+ Y H C    + + WR  + C + CPP   Y  CE+ CP  C G  S C     EGC+C  +    +  CV E+    C  E G  +    T + +   C
Sbjct: 1930 SQSPVRVEETCGCR---WTCP-----CVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQN----KEQDLEVLLHNGACSPGAKQACMKSIEIKHAGVSAELHSNMEMAVDGRLVLAPYVGENMEVSIYGAIMYEVRFTHLGHILTYTPQ-NNEFQLQLSPKTFASKMH-----GLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQ--PGYTCQAVPEEQCPVSDS---SHCQVLLSASFAECHKVIAPATFHTICQQDSCHQER------VCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHCDGNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQPC 2278          

HSP 4 Score: 118.627 bits (296), Expect = 8.268e-26
Identity = 99/384 (25.78%), Postives = 159/384 (41.41%), Query Frame = 2
Query: 1358 SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGV----EISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSI-EWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKG-IQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            ++RC + GD    TFD       G C Y+      +  D  + S  +   F            + +  GE  +   I + +   V    + +++P   ++G+    E   +K++S+         F+     +   ++++S ++  K  GLCG+FN   EDD    +G    D  + A  + L+               CE+S  +  +   E C        F  C  LV  + FV  C+  +C C     A+   C C     YAR C+ +G + + W     C   CP  M YKEC S C  TC+ L     C   C+DGC CP+  +++E    CV+  DC C + G+ Y         CNTC C N LW C+ ++C  +
Sbjct:   32 TARCSLFGDDFINTFDETMYSFAGGCSYL------LAGDCQKRSFSILGNFQDGKR-----MSLSVYLGEFFD---IHLFANGTVTQGDQSISMPYA-SQGLYLEREAGYYKLSSETFG------FAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTLTSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPLVDPESFVALCEKILCTC-----ATGPECACPVLLEYARTCAQEGMVLYGWTDHSACRPACPAGMEYKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDED--RCVQSSDCPCVHAGKRYPPGTSLSQDCNTCICRNSLWICSNEECPGE 387          

HSP 5 Score: 108.997 bits (271), Expect = 6.121e-23
Identity = 106/419 (25.30%), Postives = 168/419 (40.10%), Query Frame = 2
Query: 1367 CIITGDP--HFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAK-YARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQ---TCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANE------ERKDRCNTCTCINGL-WNCTTKDCSSQSYCPNGKVWKDCGGCQ--RTCRDMNLICDPNSC 2578
            C+ TG    H VTFD Q+  + G C Y+    KE +     L +++ N  C       C K I+I           E+ S  E+ ++ +LV  P  + + +E+S++      ++         +   ++  +L LS K +A K+ GLCG  + +  +D  + DG    D   L   + + Q   TC      Q     C  S       +  C       F +C  ++    F T C+ D C+   +         C   ++YA +C   G+   WRT +FC + CP ++VY  C   C   C       C +   +GC CP   V  E  G+CV  E C  + +G D   ++           C  C C++G   NCT +       CP  +    CG C+  R  +  NL C    C
Sbjct: 1948 CVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQNKEQD-----LEVLLHNGACSPGAKQACMKSIEIKHA----GVSAELHSNMEMAVDGRLVLAP-YVGENMEVSIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRDGTVTTDWKRLVQEWTVQQPGYTCQAVPEEQ-----CPVS------DSSHCQVLLSASFAECHKVIAPATFHTICQQDSCHQERV---------CEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHCD-GNTSFCGDHPSEGCFCPQHQVFLE--GSCVPEEACT-QCVGEDGVRHQFLETWVPDHQPCQICMCLSGRKINCTAQP------CPTARA-PTCGPCEVARLKQSTNLCCPEYEC 2325          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|P98088|MUC5A_HUMAN (Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4)

HSP 1 Score: 436.802 bits (1122), Expect = 4.327e-122
Identity = 343/1192 (28.78%), Postives = 516/1192 (43.29%), Query Frame = 2
Query:  449 VNKSSDDCEITI-KFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGD-DKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAI----------QMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGL--KIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCP---VICPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC---------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDN-NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-PYL--GTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP---PDRE----YKPCEKVCPETCIGTKS-CISDC--MEGCY--CKNNTYLKDD---ECVS---EKPLCTCKDESGKEYPLGTTVI--KNCHKCTCQINGFEC 3817
            + +S +    T+ + L K       L+   V V       P+S++   I     Y  V+    L + +N   S+ +        + CGLCG ++G     +  + +  + P+E   +  K+     +     P+P            ++++  L   + C  +V +    + E C  + C  ++      +   +A  S        +  DWR    C +  CPN M + +C + C + C        C   C  GC+C +        +  C    +C C Y  +A     Y  G      C NC C S G W C     C   C + G  HF TFD +   V G C Y+   P     D    +++ E + C  ++  TC K + +       QT + IK+  EV +N     +P        +++F+ ++  +  +   G   ++      ++ + L+ K   +  GLCGNFN    DD     G      +     ++    C    +R S+   C  S+E  K A   C +     G F  C A V    + + C  D CNC       + +C C+A S+Y   C+ KG+Q   WR    C      CPK+M Y    S+C  TCR       D  C      +DGC CP    +++ TG CV+  +C C + G      E   D    CTC +G  +C     +    C    V+ DC          GCQ++C  +++ C    C PGC C  G V D    CI   +CPC     S+     I  G   C  +CTC S  W C    C   C  +G+ HY++FDG+ + F+GDC Y L++++C  K  T   F++V ENV CG+ GT+C+K+I+ +     + L  G   +IG + +   PY     GI+   D    +V++       WD++ S+ + L+PE+K  VCGLCGNFDD   ND   R+  +  DV  F +SWKL  SCP     K+PC  N FR+SWA K+CSIL   TF  CH  V    YY+ CV D+CACD G DC C CTA++ Y   C+   + + WR    CP+ C    P+ +    Y+PC   C  TC   +  C+ D   +EGCY  C     + D+   +CV+     PL       GK Y  G  V   KNC  C C   G EC
Sbjct:  122 LRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFG-NLQKMDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQL--FSGCVALVDV--GSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQ-KCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAA-----YAPGATYSTDCTNCTC-SGGRWSCQ-EVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKP----CDSSAFTVLAELRRCGLTDSETCLKSVTLSLDGA--QTVVVIKASGEVFLNQIYTQLPIS---AANVTIFRPSTFFIIAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAACPN--IRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNC-----ERSEDCLCAALSSYVHACAAKGVQLGGWRD-GVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSE--GDITCSVGFIPVDGCICPKGTFLDD-TGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCTHGKLSCIGGQ-APAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVG---CN-TCTCDSRMWRCTDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLL-------WDKKTSIFINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVRGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVEC 1268          

HSP 2 Score: 121.709 bits (304), Expect = 6.866e-26
Identity = 104/397 (26.20%), Postives = 162/397 (40.81%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHIIHLIRGAA------PIIGRNPTWSP-YLGTGIFSKHDYVSSIVIITKELKIQW---DRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSCPYPE-------------ISKNPCDINKFRESWAIKR--------CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM-------EGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLGTTVIKNCHKCTCQ 3799
            C    C+ +C  WG+ HY++FDG ++ F  +C+YVL++       G F+++++N  CG++ G SC +SI   Y    + L R          II  N   SP +   GI      V     I  EL +Q        SV+V  + ++ NN  G CG   ++  ++ R   G + A  +  +  W +    + +C  P               +  P  +                   C ++ S+ FEPCH  +   L+Y+ CV D C      D   VC+++  Y   C  ++I I WR      CP  CP D+ Y+PC    P  C G  S     +       EGC+C     L         P     C    G+   +G TV  +C +CTC+
Sbjct: 4912 CHHYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLVQQIV-PVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVSPGFRKNGIVVSRIGVKMYATI-PELGVQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRC---HMTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEAGPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCE 5302          

HSP 3 Score: 120.939 bits (302), Expect = 1.205e-25
Identity = 94/360 (26.11%), Postives = 148/360 (41.11%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDN--VDNDLRNRAGIIDADVNAFADSWKLKTSC--PYPEISKNPCDINKFRESWAIKRC-SILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRY-NIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECEK 3823
            +C  WG  HY +FDG  F F G C+YV  E +C      F I +   +  +  T     +       +I L +G+  ++  +P   P+  +G+  +     + V     L + W+   S+ + L  +Y N  CGLCG+F+    V   L +   +   +             C  P PE  +N C       S     C  +L  + F  C   V    Y + C QD C C+  D   CVC  +++Y  +C     +   WR  + CP  CP + +Y  C   C +TC     +++C   C+ GC+C   T L D       P+  C    +G  Y  G T   +C  CTC    + C++
Sbjct:   80 VCSTWGSFHYKTFDGDVFRFPGLCNYVFSE-HCGAAYEDFNIQLRRSQESAAPT--LSRVLMKVDGVVIQLTKGSV-LVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTDQCQDPVPEPPRN-C-------STGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQE 427          

HSP 4 Score: 92.4337 bits (228), Expect = 4.801e-17
Identity = 95/408 (23.28%), Postives = 157/408 (38.48%), Query Frame = 2
Query: 1346 HDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLT----QTCH---------------GEVLRQSYLG---LCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATC------RLRQRPNCDNDCIDGCQCPDDMVIEEKTGN-CVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGLWNCT 2464
            H QC   C   GDPH++TFD  +      C Y+ V  ++I        ++V+N FC   + ++C + I + + +    L +  +      E+I N+K+V+ P     G+ +S   V       E G +  +F      +E+  S K+A    G CG    D +D+   P G      SE++  + ++      CH                  +  + +G   +  T+     + + +C       F+ C  ++P   F   C  D C+       + ++  CS+   YA +C+   I   WR  T   CP  CP + VY+ CG S  + C       L   P       +GC CP+ M +   +   CV     +C    G            C  CTC    W  T
Sbjct: 4914 HYQCQCVCSGWGDPHYITFDGTYYTFLDNCTYVLV--QQIVPVYGHFRVLVDNYFCGAEDGLSCPRSIILEYHQDRVVLTRKPVHGVMTNEIIFNNKVVS-PGFRKNGIVVSRIGVKMYATIPELG-VQVMFSGLIFSVEVPFS-KFANNTEGQCGTCTNDRKDECRTPRGTVVASCSEMSGLWNVSIPDQPACHRPHPTPTTVGPTTVGSTTVGPTTVGSTTVGPTTPPAPCLPSPICQLILSKVFEPCHTVIPPLLFYEGCVFDRCH------MTDLDVVCSSLELYAALCASHDICIDWRGRTGHMCPFTCPADKVYQPCGPSNPSYCYGNDSASLGALPEA-GPITEGCFCPEGMTLFSTSAQVCVPTGCPRCLGPHGEPVKVGHTVGMDCQECTCEAATWTLT 5309          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q2PC93|SSPO_CHICK (SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 4.353e-122
Identity = 323/1113 (29.02%), Postives = 509/1113 (45.73%), Query Frame = 2
Query:  602 GHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWL------SVSRENRMKPDPAIQM---------VNCDL---NEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNS-----CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVD--CSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC---RLRQRPNC---DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPE--ISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC------IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            G +V V+    +++  + +G+++V     ++    GLCG Y+ +  D F  V+  + P+     F   W        +S  + ++P P   M           C +   +    C + V   G  F E C    C+      S     C+ +       +      +WR    CE+  C +   +SDC ++C   C       +  C   C  GC C       +  C     CPC +R        Y  G  +++ C  C C   G W C T D+C++ C + GD H++TFD +     G C+Y  V     +     L I  E + C   + ++C + + I     +      + S  EV+++ ++V +P        ++V + +S  L ++      ++  +     + L   +A KV GLCG +N D  DD   P G      +  A +YR++  C   VL       C T     ++A   C       F+ C  LV  + F   C +DVC C      +  +C C A +AYAR C+ +G    WR   FC   C    VY+EC S C  TC   RL    +C   DN C+ GC CP+  V+++  G CV    C C++  + Y A  + +  CN C C  G W+CT   C   ++CP   V+   G C RTC              GC C  G V+ + +C+P  ECPC    + ++ +  I R   +C  +C CR  +W+C   DC G C A G+ HY++FDG+ F F GDC YVL+ +     +G F +  ENV CG+ G +CTKS+     + ++H++RG    +       P  Y G G+  +   +  +++    L + WD    V + L P+++  V GLCGNFD + +NDL ++ G+++     F +SW++   CP  +   +++PC  N  R +WA KRCSIL    F PCH+ V  Q +YD C+ D+C CD G DC C+CTAI+ Y  EC++  I I+WR+ + CP+ C   +EY  C   CP+TC      +        C+EGC+C     L +  C+ +   C C  + G  +P    V + C  C+C    ++C
Sbjct:  280 GDFVAVESGLGVHLKLDGRGTVYVTVSAELRGSTKGLCGPYNDDPIDDFLRVEGDVAPLAAS--FGNSWRIPDANPELSCSDAVEPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCHEAVDPHG--FYEACLELHCREGGTGPSPPPAVCDTLATYVRDCAQRRAYIEWRRPGLCEQ-QCGHGQRYSDCVSSCPASCMAAGTAEEGHCRDDCASGCECTPGLLLDRGACIPQSACPCLHRGHI-----YAPGQSIRQRCNQCTCRG-GRWLC-TQDRCAAECAVLGDLHYITFDRRRFSFPGACEYTLVQ----DFVEGTLRITAEQEACGGHQPLSCLRALSIT----VPGASARLHSTGEVVVDGRVVPLPFA---SAALTVRRASSSFLLLQTFGAHLLWGLETPAAYITLQPAFANKVRGLCGTYNWDQRDDFATPAGDVEVGVTAFANKYRVSTDC--PVLSPVPFEPCSTYAPRRELAAAACAILHGASFQPCHHLVDREPFHQLCLYDVCAC-----PAGKHCLCPALAAYARECAQEGAALSWRNESFCGTQCRGGQVYQECSSPCGRTCADLRLDGASSCPSLDNICVSGCNCPEGPVLDDG-GQCVPPGVCPCQHSSQLYPAGSKIRQGCNACMCTAGTWSCTDAPCPDAAFCPGDLVYV-FGSCLRTCDSAEPNGTCTGIADGCVCPPGTVFLDERCVPPEECPCQHNGRLYHPNDTIVR---DCN-TCVCRQQRWQCSSEDCMGTCVATGDPHYITFDGRAFSFLGDCEYVLVRE----ANGLFTVTAENVPCGTSGVTCTKSVVVEMGNTVVHMLRGRDVTVNGVSVRPPKVYSGNGLTLQRAGIFLLLLSRLGLAVLWDGGTRVYIRLQPQHRGRVVGLCGNFDRDAENDLASQQGVLEPTAELFGNSWRVSLLCPEVDGTTAQHPCTDNPHRATWARKRCSILTQRLFAPCHDEVPCQHFYDWCIFDACGCDSGGDCECLCTAIATYAEECSQRGIHIRWRSQDLCPMQCDGGQEYSACGPPCPQTCRNLGLELPEHCDTMSCLEGCFCPEGKVLHEGSCI-DPAECPCFWQ-GIAFPDSAVVQQGCRNCSCTAGLWQC 1350          

HSP 2 Score: 87.8113 bits (216), Expect = 1.427e-15
Identity = 87/366 (23.77%), Postives = 150/366 (40.98%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIH----LIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP----YPEISKNP-CDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSC--ACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS-----CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C  W  S Y SFDG+ F F G+C+Y L          T+ + I      + G+     + F     +       + G A   GR      + G  +    D+V+    +   LK+  D + +V V ++ E + +  GLCG ++D+  +D     G +     +F +SW++  + P       +  +P C +    +  A   C +L ++ F  CH  V    +Y+ C++  C            VC  ++ YV +C +    I+WR    C   C   + Y  C   CP +C+   +     C  DC  GC C     L    C+ +   C C    G  Y  G ++ + C++CTC+   + C ++
Sbjct:  194 CTVWAGSRYRSFDGRHFGFQGECAYSL----AASTDSTWAVSI------TPGSPPVLHMTFGLDTVVAQGHNISVNGVAVPEGRQHL---HGGISVTWLGDFVAVESGLGVHLKL--DGRGTVYVTVSAELRGSTKGLCGPYNDDPIDDFLRVEGDVAPLAASFGNSWRIPDANPELSCSDAVEPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCHEAVDPHGFYEACLELHCREGGTGPSPPPAVCDTLATYVRDCAQRRAYIEWRRPGLCEQQCGHGQRYSDCVSSCPASCMAAGTAEEGHCRDDCASGCECTPGLLLDRGACIPQSA-CPCL-HRGHIYAPGQSIRQRCNQCTCRGGRWLCTQD 542          

HSP 3 Score: 61.2326 bits (147), Expect = 1.675e-7
Identity = 57/230 (24.78%), Postives = 86/230 (37.39%), Query Frame = 2
Query: 2192 CPVICPKNMVYKECGSSCSATCR-LRQRPNC-DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC--------------EYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGC--------------QRTCRDMNLICDP---NSCE-PGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLS----CTCRSGKWECPKRDC 2767
            C   CP++ V++EC ++C   C  LR +  C    C  GC CP   V+++  G CV  E+C+C              E   +++      + RCNTC CI G +NC+ ++C+          W  C                 QR       +  P    +C  P C C  GE +  ++  P  E  C           ++   P  C  S    CTC  G +      C
Sbjct: 4868 CTQECPRSQVHRECANACPHACADLRPQTQCLPQPCQPGCACPPGQVLQD--GACVPPEECRCTLDSTMPGVLNLSREEQEQEHAPGSRLQHRCNTCICIRGTFNCSQEECNVDCLWSPWSPWSPCSVTCGMGERLSHRHPLRQRLYEGAECLGPPVRRAACHLPDCACPEGERWQGHEVPPGCEQSC---------RDILDETPANCTPSPSPGCTCEPGHYRNSSGHC 5086          

HSP 4 Score: 56.225 bits (134), Expect = 5.260e-6
Identity = 64/238 (26.89%), Postives = 87/238 (36.55%), Query Frame = 2
Query: 2078 CGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNC--DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRD--MNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEG 2773
            CG  R   T +C         + C  +  Q      + C   CP  M    C + C   C  L++   C  +  C  GC+CP+  +  E+ G CV +  C+C +  G  +       D CN CTC+ G   CT + C     CP  + W     C  TC D        P +      C+ GE  +N  C   G CP      S+           ECQ  CTC      C    C G
Sbjct: 4092 CGGGRAVRTRSCTRPPPKNGGQRCPGERHQLHLCNAQPCDDSCPPGMALVTCANHCPRHCGDLQEGIVCREEEHCEPGCRCPNGTL--EQDGGCVPLAHCECTDAQGHGWVPGSTHHDGCNNCTCLEGRLRCTDRLCPPLR-CPWSR-WSRWSPCSVTCGDGQQTRFRTPTAGSWDEECQ-GEQMENRGC-AAGPCPPLCPQGSWERRLGDMWLQGECQ-RCTCTPEGTVCEDTTCAG 4322          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q9HC84|MUC5B_HUMAN (Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3)

HSP 1 Score: 434.876 bits (1117), Expect = 2.042e-121
Identity = 332/1154 (28.77%), Postives = 500/1154 (43.33%), Query Frame = 2
Query:  563 FPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDG-NGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP-AIQMVNCDLNEMATCAKVVSIFGSKFEEI------------CYAEFCQMKNQKNS--CELMRDIAFLS-SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELV--LSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVI--CPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLG---TGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCP-------PDREYKPCEKVCPETCIG-TKSCISDC--MEGCYCK---NNTYLKDDE--CVSEKPLCTCKDESGKEYPLGTTV--IKNCHKCTCQINGFECEKEL 3829
             PYS+    +   G Y+ V     L   +N + S  +        Q CGLCG ++G    ++F   +A + P++           +       PDP  +   NC  +E   C +  ++ G  F E             C  + C+      +   E  R  A     P N    WR    C    CP  M   +CG+ C + C        C   C  GC+C           + C    +CPC +        +Y  G      C +C C S GLW+C     C   C + G  H  T+D +   + G C Y  V+ K+        +++ E + C  +++  C K + +    G   T I +++   V +NS    +P        I++F  +S  + ++ G    +  +    +++   L   +  ++ GLCGNFN +  DD     G      +  A  ++    C     R S+   C  S+E    A   C +       F  C +++    F + C  D CNC       + +C C+A S+Y   C+ KG+Q   WR       +  CPK+  Y     +C  TCR       D  C      +DGC CP    + +  G CV  ++C C   G      E   D    C+C  G  +C        + C    V+ DC           C R+C  +++ C    C  GC C  G V D +  CI + +CPC     ++     I     +C  +CTCR+ +WEC  R C G C A+G+ H+++FDG  + F G C Y+L +DYC  N   GTF+IV EN+ CG+ GT+C+K+I+ + + + + L  G    + R P   P       GIF        +VI T  + + WDR+ SV + L  +YK  VCGLCGNFDDN  ND   R+  +  D   F +SWKL  SCP     K+PC  N FR+SWA K+CSIL   TF  C + V    YY+ CV D+CACD G DC C CTA++ Y   C+   + + WR  + CP+ C         +  Y+PC   C +TC   +  C+ D   +EGCY K   +  +  +D+  CV++   C C D+ G  Y +G  V   +NC  C C  +G +C   L
Sbjct:  157 LPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQ-----FGNLQKLDGPTEQCPDPLPLPAGNCT-DEEGICHR--TLLGPAFAECHALVDSTAYLAACAQDLCRCPTCPCATFVEYSRQCAHAGGQPRN----WRCPELCPR-TCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGR-----TYSPGTSFNTTCSSCTC-SGGLWQCQDL-PCPGTCSVQGGAHISTYDEKLYDLHGDCSY--VLSKKCADS--SFTVLAELRKCGLTDNENCLKAVTLSLDGG--DTAIRVQADGGVFLNSIYTQLPLS---AANITLFTPSSFFIVVQTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANA--RNSFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNC-----ERSEDCLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCR--GLSEADVTCSVSFVPVDGCTCPAGTFLND-AGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDCPCVHNEATYKPGETIR---VDCN-TCTCRNRRWECSHRLCLGTCVAYGDGHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESYELILQEGTFKAVARGPGGDPPYKIRYMGIF--------LVIETHGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQ---CGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSL 1256          

HSP 2 Score: 132.109 bits (331), Expect = 5.816e-29
Identity = 110/382 (28.80%), Postives = 163/382 (42.67%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIP-SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCET-----SIEWGKIANE--VCGKFGQG-QFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CDNDCIDGCQCPDDMVIEEKT-GNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDC 2476
            C   GD H+ TFD       G C Y  V  +   +     ++ +      +   +T      ++  +GL    +   S   V+IN +   +P S+    VE S      D +K+    + +     +    L L  KYA +  GLCG+FNG P  +      A            RLT    G +  Q   G  E       +  G   +E  +C +   G  F +C ALV S  ++  C  D+C C          C C+ +  Y+R C+  G Q + WR PE CP  CP NM ++ECGS C+ TC   QR   C++ C+DGC CP   V+++ T   C+ +  C C + GR Y+        C++CTC  GLW C    C
Sbjct:   77 CSTWGDFHYKTFDGDVFRFPGLCNY--VFSEHCRAAYEDFNVQLRRGLVGSRPVVTRV----VIKAQGL----VLEASNGSVLINGQREELPYSRTGLLVEQS-----GDYIKVSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNA------------RLTPLQFGNL--QKLDGPTEQCPDPLPLPAGNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCP--------TCPCATFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLPC 421          

HSP 3 Score: 109.768 bits (273), Expect = 3.357e-22
Identity = 96/358 (26.82%), Postives = 143/358 (39.94%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKH--DYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDD--NVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            +C  WG+ HY +FDG  F F G C+YV  E +C      F + +     GS+       I+   +  ++    G+  I G+     PY  TG+  +   DY+   V I   L   W+ + S  + L P+Y N  CGLCG+F+     +    + A +                 CP P     P       +   I   ++L    F  CH  V    Y   C QD C C       C C    +Y  +C     + + WR  E CP  CP + +++ C   C +TC   +    C   C++GC+C   T L D       PL  C     G+ Y  GT+    C  CTC    ++C+
Sbjct:   76 VCSTWGDFHYKTFDGDVFRFPGLCNYVFSE-HCRAAYEDFNVQLRRGLVGSRPVVTRVVIK--AQGLVLEASNGSVLINGQREEL-PYSRTGLLVEQSGDYIK--VSIRLVLTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPL----PLPAGNCTDEEGICHRTLL-GPAFAECHALVDSTAYLAACAQDLCRCPT-----CPCATFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQ 417          

HSP 4 Score: 102.064 bits (253), Expect = 5.897e-20
Identity = 127/523 (24.28%), Postives = 194/523 (37.09%), Query Frame = 2
Query: 1337 CDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDIT---CAKGIKILFGE-GLNQTEIEIKSKTEVIINSKLVTIPSKINK-GVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANE----------VCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVI-EEKTGNCVKVEDCKC-------EYMGRDYNANEERKDRCNTCTCINGLWN--CTTKDCSSQSYCP-----------NGKVWKDCGGCQRTCRDMNLICDPNS---CEPG----CYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCE 2770
            CD H +C   C + G  H+ TFD       G C Y  V+ +EI +    LS+ ++N +C  S       C + + I +    +  T   +  K E +I    + + S  +K GV +SV   T+  + I A  +   F     +  L  S  +     G CG    +  DD +  DG  A    ++A  + +  +        +  G   T+     +++           +C       F +C  LVP   F   C  D C          +   C +  AYA +C  +G+   WR  T   C + CP   VYK CG    ATC  R +        +GC CP+D ++     G CV+   C C       ++ G  + +N      C +C C  G  +  C    C +Q   P             +    C  C  T    N    P S   C PG    C  E G+     +C P+    C + N +F        G   C + CTC SG  + P   C+
Sbjct: 5065 CDFHYECECICSMWGGSHYSTFDGTSYTFRGNCTY--VLMREIHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSL-FHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPT--GTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHCR-------GRLEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQA--CPCVGPDGFPKFPGERWVSN------CQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPC--CPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQ---LCSY-NGTFYGVGATFPGALPCHM-CTCLSGDTQDPTVQCQ 5560          

HSP 5 Score: 100.523 bits (249), Expect = 2.183e-19
Identity = 86/373 (23.06%), Postives = 143/373 (38.34%), Query Frame = 2
Query: 2762 DCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS----CTKSIRFYYKDH-------IIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSC-------PYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSC--ISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            +CE +C  WG SHY +FDG  + F G+C+YVL+ +  + + G   + ++N  C +  T+    C +++  +YK         ++H       +  + P  S +   G+       +++ +    L   + ++ Q+         + NN  G CG   +N  +D   R G   A     A +W +    K  C       P    +                 C ++ S+ F  CHN V    +++ C+ D C   RG      C ++  Y   C    +   WR      C + CPP + YKPC  + P TC        +    EGC+C  +  L +         C C    G     G   + NC  C C
Sbjct: 5070 ECECICSMWGGSHYSTFDGTSYTFRGNCTYVLMRE-IHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPFFNACISDHC---RGR-LEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGPDGFPKFPGERWVSNCQSCVC 5437          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q98UI9|MUC5B_CHICK (Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 3.834e-115
Identity = 353/1256 (28.11%), Postives = 536/1256 (42.68%), Query Frame = 2
Query:  248 GAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAI---------------QMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVS-----DWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKI--EAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVI-CPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCT-----TKDCSSQSY---CPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVII--TKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC----PPDRE---YKPCEKVCPETC---IGTKSCISDCMEGCY---CKNNTYLKDD--ECVS---------EKPLCT--CKD----ESGKEYPLGTTV 3769
            G E   + Q +    +++CT      + TFD VK      T   V    C      + I +        + SD     I F          +   G+ V       P+S     I D   Y  V     L + +N   ++ +    T K+++CGLCG YDGN  +        M+P +   +F K+     +   ++PD                  +M    L+    C KVV+     +   C  + C      +  +L+      +    S D ++S     +WR K  C +  CP+ M + +CGN+C + C        C   CT GC+C            +C   D CPC ++        Y  G      CQNC C+  G W C +   CS  C I G  H  TFDN+     G C Y  V+ K  +     +  I++   C  S+ +TC K + +  G    +T I+I S   + +N+ +V +P   +    I++F+ ++  +KI   AG    V  K   ++ + +   Y  + +GLCGNFN    DD     GA     +     ++   +C    +  S+   C  S++  K A   C         F  C ++V    ++ +C +D CN      A      CS  S Y+R C+  G+  + WR     P   CP+ MVY      C+ +CR    P  D  C      ++GC CP+   + ++   CV  +DC C Y G+        ++    C CI G  +C       KDC +  Y   C +         CQ++C+  ++ C    C  GC C  G V D +  CIPK +CPC      +     I     +C  +CTC   +W C    C+G C  +G  HYMSFDG+ FDF GDC Y+L +D+C  N  +GTF+IVI+N  CG   + C+  I   ++   I L+ G    I  +P      G     K D     ++I  T+ +   WD++ +V V +TP ++  VCGLCG+FD    ND   R   ++  +  F +SWK+ ++C    ++ + C    F+ +   K CSI+KS  FE CH+ V    YY+ CV D C CD   DC C CT+++ Y   C+   + I WR    CP+ C    PPD+    YKPC   C +TC    G    I   +EGCY     +  Y  ++  ECVS         E+ LCT   KD     +GK YPL  T+
Sbjct:   21 GKEPVQIVQ-VSTVGRSECTTWGNFHFHTFDHVKFTFPG-TCTYVFASHCNDSYQDFNIKI--------RRSDKNSHLIYFTVTTDGVILEVKETGITVNGNQIPLPFSLKSILIEDTCAYFQVTSKLGLTLKWNWADTLLLDLEETYKEKICGLCGNYDGNKKNDLILDGYKMHPRQFG-NFHKVEDPSEKCPDVRPDDHTGRHPTEDDNRCSKYKKMCKKLLSRFGNCPKVVAF--DDYVATCTEDMCNCVVNSSQSDLVSSCICSTLNQYSRDCVLSKGDPGEWRTKELCYQ-ECPSNMEYMECGNSCADTCADPERSKICKAPCTDGCFCPPGTILDDLGGKKCVPRDSCPCMFQGKV-----YSSGGTYSTPCQNCTCKG-GHWSCISL-PCSGSCSIDGGFHIKTFDNKKFNFHGNCHY--VLAKNTDDTFVVIGEIIQ---CGTSKTMTCLKNVLVTLG----RTTIKICSCGSIYMNNFIVKLPVSKDG---ITIFRPSTFFIKILSSAGVQIRVQMKPVMQLSITVDHSYQNRTSGLCGNFNNIQTDDFRTATGAVEDSAAAFGNSWKTRASCFD--VEDSFEDPCSNSVDKEKFAQHWCALLSNTSSTFAACHSVVDPSVYIKRCMYDTCNAEKSEVAL-----CSVLSTYSRDCAAAGMTLKGWRQGICDPSEECPETMVYNYSVKYCNQSCRSLDEP--DPLCKVQIAPMEGCGCPEGTYLNDEE-ECVTPDDCPCYYKGKIVQPGNSFQEDKLLCKCIQGRLDCIGETVLVKDCPAPMYYFNCSSAGPGAIGSECQKSCKTQDMHCYVTECVSGCMCPDGLVLDGSGGCIPKDQCPCVHGGHFYKPGETIR---VDCN-TCTCNKRQWNCTDNPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNMDAGTFRIVIQNNACGKSLSICSLKITLIFESSEIRLLEGRIQEIATDP------GAEKNYKVDLRGGYIVIETTQGMSFMWDQKTTVVVHVTPSFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQEFGNSWKITSTCSNINMT-DLCADQPFKSALGQKHCSIIKSSVFEACHSKVNPIPYYESCVSDFCGCDSVGDCECFCTSVAAYARSCSTAGVCINWRTPAICPVFCDYYNPPDKHEWFYKPCGAPCLKTCRNPQGKCGNILYSLEGCYPECSPDKPYFDEERRECVSLPDCTSCNPEEKLCTEDSKDCLCCYNGKTYPLNETI 1222          

HSP 2 Score: 115.161 bits (287), Expect = 5.357e-24
Identity = 101/376 (26.86%), Postives = 155/376 (41.22%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHIIHLI------RGAAPIIGRNPTWSPYL---GTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPY---PEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM---------EGCYCKNNTYL---KDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            C   +C+ +C  WG  HY++FDG ++ F  +C+YVL+E      S  F I I+N  CG+  G  C+ S+  ++ + ++ L       +G   ++  +    P +   G  I S   Y+  + I   E+ + + R          +Y NN  GLCG   +   +D R R G +       A  WK   S      P IS+ P  I  ++     + C I+ + T   CH  V  Q YY+ CV   C+          C ++  Y   C  + I + WR   N  C   C  D+ YKPC +    TC   +  +   +         EGCYC +   L    D  CVS   +C C  + G           +C  CTC
Sbjct: 1422 CEVFECQCICSGWGNEHYVTFDGTYYHFKENCTYVLVE-LIQPSSEKFWIHIDNYYCGAADGAICSMSLLIFHSNSLVILTQAKEHGKGTNLVLFNDKKVVPDISKNGIRITSSGLYI-IVEIPELEVYVSYSRLAFYIKLPFGKYYNNTMGLCGTCTNQKSDDARKRNGEVTDSFKEMALDWKAPVSTNRYCNPGISE-PVKIENYQHCEPSELCKIIWNLT--ECHRVVPPQPYYEACVASRCSQQHPST---ECQSMQTYAALCGLHGICVDWRGQTNGQCEATCARDQVYKPCGEAKRNTCFSREVIVDTLLSRNNTPVFVEGCYCPDGNILLNEHDGICVS---VCGCTAQDGSVKKPREAWEHDCQYCTC 1786          

HSP 3 Score: 85.1149 bits (209), Expect = 7.635e-15
Identity = 95/387 (24.55%), Postives = 153/387 (39.53%), Query Frame = 2
Query: 1352 QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEG---LNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGL----KIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCH-------GEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATCRLRQ-------RPNCDNDCIDGCQCPD-DMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTC 2440
            +C   C   G+ H+VTFD  +   +  C Y+ V  + I+    +  I ++N +C  ++   C+  + I        L Q +   K    V+ N K V +P     G+     ++TS GL    +I   +++  + +    I+L    KY     GLCG       DD    +G       E+A  ++   + +        E ++      CE S     I N            +C  +VP   +   C    C+    ++ ST   EC +   YA +C + GI   WR  T   C   C ++ VYK CG +   TC  R+         N     ++GC CPD ++++ E  G CV V  C  +  G      E  +  C  CTC
Sbjct: 1426 ECQCICSGWGNEHYVTFDGTYYHFKENCTYVLV--ELIQPSSEKFWIHIDNYYCGAADGAICSMSLLIFHSNSLVILTQAKEHGKGTNLVLFNDKKV-VPDISKNGI-----RITSSGLYIIVEIPELEVYVSYSRLAFYIKLPF-GKYYNNTMGLCGTCTNQKSDDARKRNGEVTDSFKEMALDWKAPVSTNRYCNPGISEPVKIENYQHCEPSELCKIIWN----------LTECHRVVPPQPYYEACVASRCS---QQHPST---ECQSMQTYAALCGLHGICVDWRGQTNGQCEATCARDQVYKPCGEAKRNTCFSREVIVDTLLSRNNTPVFVEGCYCPDGNILLNEHDGICVSVCGCTAQ-DGSVKKPREAWEHDCQYCTC 1786          
BLAST of Hemocytin vs. UniProt/SwissProt
Match: sp|Q700K0|SSPO_RAT (SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo PE=2 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.699e-114
Identity = 288/907 (31.75%), Postives = 429/907 (47.30%), Query Frame = 2
Query: 1145 CSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQ--CQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDY--NANEERKDRCNTCTCIN-GLWNCTTKDCSSQ-SYCPNGKVWKDCGGCQRTCRDM--NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCIS------DCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            C K C  GC C    FW    C  A  CPC YR        Y  GD +K+ C  C+C+  G W C     C + C + GD H+ TFD +     G   CQY  V     +S   QL +++E+  C   E  +C   +    G    +T I+++    V+++ + V +P    +G  +S    +S  L +     + ++   D  + + L  ++A +V GLCG F    +DD + P G      +  A++++++      ++  + L  C T  +    A   C       F++C  LV  + F  +C   +C+C   R+     C CS  SAYA  C+ +G+  QWR    C V CP   VY+EC  +C   C   +       C+ GC CP  ++ + + G CV    C C+  G  Y  N     KD C+ C C   GLWNC    C  Q + CP   ++   G C  TC  +  N  C   S + GC C SG V  +  C+    CPC    Q +  +A I     +C + C C++ +W C  + C G C+A G  HY++FDG  F F G C Y+L+ +      G F + I+N+ CG+ G +CTK++       ++H++RG A  +       P  Y G G+   H  +  ++     L + WD    V V L+P +   V GLCGNFD +V NDLR+R G+++      A SW+L   CP P    +PC +N  R +WA   C ++    F PCH  V  Q YY+ CV D+C CD G DC C+C+AI+ Y  EC R+   ++WR+ E CP+ C   + Y+PC   CP TC      +        C+EGC+C   T L    CV E   C C +  G  +P G  + K+C  CTCQ + + C
Sbjct:  500 CGKECVSGCECPTGLFWDGALCVPAAHCPCYYRRQ-----RYAPGDTVKQQCNPCVCQD-GRWHC-AQAPCPAECAVGGDGHYCTFDGRSFSFRGNPGCQYSLVQ----DSVKGQLLVVLEHGAC---ETGSCLHALSAFLG----KTHIQLRYSGAVLVDGQDVDLPWIGAEGFNVS--HASSTFLLLRWPGAWVLWGVADPAVYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIETSVTAFASKFQVSGDGRCPLVDNTPLSSCSTYSQRLAFAEAACAALHGHAFQECHGLVEREPFRLRCLESMCSCAPGRD-----CLCSVLSAYAHHCAQEGVLLQWRNETLCSVPCPGGQVYQECAPACGHYCGEPEDCKELGSCVAGCNCPPGLLWDLE-GQCVPPSMCPCQLGGHRYAFNTTTTLKD-CSHCICQERGLWNCIAHHCPRQWALCPQELIYAP-GACLLTCDSLGANHSCLAGSTD-GCVCPSGTVLLDKHCVSPDLCPCRHNGQWYPPNATIQE---DCNI-CVCQNQRWHCTGQRCSGWCQASGAPHYVTFDGLVFTFPGACEYLLVRE----AGGRFSVSIQNLPCGASGLTCTKALAVRLDSTVVHMLRGQAVTVNGVSIKLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPHFHGRVTGLCGNFDGDVSNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPCSVNAHRVNWARAHCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECARHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHPELRWHCQAITCVEGCFCPEGTLLHGGTCV-ELTDCPC-EWQGSFFPPGAVLQKDCGNCTCQESQWHC 1367          

HSP 2 Score: 110.538 bits (275), Expect = 1.613e-22
Identity = 101/393 (25.70%), Postives = 163/393 (41.48%), Query Frame = 2
Query: 1358 SSRCIITGDPHFVTFDNQHIFVEGQCQYI--AVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHG-----EVLR--QSYLGLCETSIEWGKI---ANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNA--STINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRL---RQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            S+ C      H+ TFD QH    GQC Y+    M       +       + + C+  + I   + + I  GE      + +K +   +  S+L+   S   +G          D L +  G    V     S I + +  ++  +  GLCG +NG PEDD + P G  A   +     +RL     G     EV R  +  L    T +E GK+   A ++C +  +  F  C   VP D++   C    C      +     +   C+ ++ YA+ C+ + I   WR P FC  +CP   +Y +C SSC  +C      +  +C  +C+ GC+CP  +  +     CV    C C Y  + Y   +  K +CN C C +G W+C    C ++
Sbjct:  192 SATCATWSGFHYQTFDGQHYHFLGQCTYLLAGAMDSTWAVHLRPSVHCPQPRQCWLVQVIMGPEEVLIQDGE------VSVKGQPVPVGESQLLHGMSLQWQG----------DWLVLSGGLGVVVRLDRSSSIIISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLAMLAATFGNSWRLPGYEPGCLDTVEVARGCEGLLEGTLTGLEAGKLQAQAQDLCHQLLEDPFSQCHGQVPPDEYHETCLFAYCVGATAGSGPEEQVKAVCATFANYAQACARQHIYVHWRKPGFCERLCPGGQLYSDCISSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGAL--CVPAAHCPCYYRRQRYAPGDTVKQQCNPCVCQDGRWHCAQAPCPAE 566          

HSP 3 Score: 58.9214 bits (141), Expect = 6.846e-7
Identity = 37/124 (29.84%), Postives = 56/124 (45.16%), Query Frame = 2
Query: 2183 PEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDND--CIDGCQCPDDMVIEEKTGNCVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTC 2542
            P  C   CP  M    C + C  +C  L++   C  D  C  GC+C +  +  E+ G CV V  C+C +  GR +    + +D CN C+C  G  +CT + C   ++C     W     C  +C
Sbjct: 4051 PMPCEKDCPAGMEMVSCANRCPYSCSDLQEAVMCQEDQACQLGCRCSEGFL--EQDGGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQPCPPPAHCAWSH-WSAWSACSHSC 4171          

HSP 4 Score: 58.151 bits (139), Expect = 1.201e-6
Identity = 62/223 (27.80%), Postives = 92/223 (41.26%), Query Frame = 2
Query: 2192 CPVICPKNMVYKECGSSCSATC-RLRQRPNCDND-CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNAN---EERKDR----------CNTCTCINGLWNCTTKDCSSQSYCPNGKVWK--DCGGCQRTCRDMNLICDPNSCE----PGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGE 2794
            CP  CP   V   C + C + C  L     C  + C  GC CP   ++   +G C+  E C C  +   +      EE+             C  CTC  G++ C+  DC     CP G++ +  +   C++TC +MN     ++C     PGC C+ G    +   C+P+  C C W + S +      +   E   SC C  GK  C +  C  L  A GE
Sbjct: 4811 CPE-CPPGQVLSTCATLCPSFCSHLWPGTICVREPCQLGCGCPGGQLLH--SGTCIPPEACPCTRLSLPWGLTLPLEEQAQELPSGTVLTWNCTHCTCQGGVFTCSHTDCQE---CPPGEILQLGELRPCEKTCLEMNKTQAWSNCTEAQVPGCVCQLGHFRSHTGLCVPEDHCEC-WHHGSPHLPGSEWQEACE---SCRCLHGKSVCTQH-CPELSCAQGE 5022          
BLAST of Hemocytin vs. TrEMBL
Match: A0A267DLR6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g2 PE=4 SV=1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 467/1296 (36.03%), Postives = 692/1296 (53.40%), Query Frame = 2
Query:  110 ACCLGWSGKKCNEPVCEKGCGP-GKCIEPNICDCRETNRFGQQCERFGAEVASVS---------QNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENR-MKPD-------PAIQMVNCDLNEMATCAKVVSIF---------------GSKFEEICYAEFCQ--MKNQKNSCELMR-DIAFLSS----PDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE--IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGK-FGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP-GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG-------TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNC 3841
             C LG+ G KC  P+C+  C   G C+ PN C C +    G  C+   A  AS S          N    + A C+   G+ + TFD  K       G+ VL+QDC++    YQ+      +C + +   C++++K +   + +   +    V V     + P       +S+  +++ V+G+ DL I Y+   +I V+AP TM + VCGLCG +DG   + F   D    P+   +DF K W   S +++ + P        P  ++ +   + + +   + SI                 S +E +C  + C   +      C   R + A L S       IV +WR    C  P C N  ++S+C ++CN +CG N  D DC   C  GC+C    FW  ++C   D CPC     ++   SY  G K    C+ C+C+  G WKC   D+C   C ++GDP + TFD +H   EG C+YI +MP+    ES    +++ VENK+C +  D+ CAK + +  G G  Q  I ++S + V ++S  V++P K++   +I++  V++  L++E    F +     +RI++ LS  +  KVTGLCGNFN D +DD I P G   KD  + A  ++   TC  +  R  Y G C TS E+   A  VC K + +  FK C + V     + QCKHDVC+CG  R      CEC+A+++YAR C++ G    WR+   CPV CP  M Y+ECGS+C  TC+  +   C  +C++GCQCP    ++E+ G CV    CKC Y G  Y   + RKD+CN CTC +G W CT   C+  + CP G VW +C  CQR+C ++N+ C  +SC+  GC C  G+V    KC+ KG CPC    + + E++V+ RG   C   C CR G W+C    C   C+ WG+ HY +FDG+++DF G CSYVL EDYC   +GTF+I  EN++CG++G SCTKS++  Y+D ++HL+RG  PII RN  W   L    +  +     +   T++ +++QWD ++ V V L P +   VCGLCGNF++  D+DLR R G +  D  AFADSWK++ +CP P  +      +  R+ WA K+C+IL+S  F  CH+ V    +YDKCV D+CAC + DDCLC CTA+SQYV  CN   +KI+WRN ++CP+MCP    YK C   CP+ CI        T  C S C+EGC+C +  +L+D  C  ++  C+C    GK+   G  +I  C +CTC     EC+   + +C
Sbjct:  176 VCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPD-GYHGDLCQ-VSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDG-KYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPA-KVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDF--TDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNGNATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSR---SYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKT-RFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIA-PCSSERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVC-KKREQCSCV-VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDC 1454          
BLAST of Hemocytin vs. TrEMBL
Match: A0A267GUZ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026350g1 PE=4 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 465/1296 (35.88%), Postives = 689/1296 (53.16%), Query Frame = 2
Query:  110 ACCLGWSGKKCNEPVCEKGCGP-GKCIEPNICDCRETNRFGQQCERFGAEVASVS---------QNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENR-MKPD-------PAIQMVNCDLNEMATCAKVVSIF---------------GSKFEEICYAEFCQ--MKNQKNSCELMR-DIAFLSS----PDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE--IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGK-FGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP-GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG-------TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNC 3841
             C LG+ G KC  P+C+  C   G C+ PN C C +    G  C+   A  AS S          N    + A C+   G+ + TFD  K       G+ VL+QDC++    YQ+      +C + +   C++++K +   + +   +    V V     + P       +S+  +++ V+G+ DL I Y+   +I V+AP TM + VCGLCG +DG   + F   D    P+   +DF K W   S +++ + P        P  ++ +   + + +   + SI                 S +E +C  + C   +      C   R + A L S       IV +WR    C  P C N  ++S+C ++CN +CG N  D DC   C  GC+C    FW  ++C   D CPC     ++   SY  G K    C+ C+C+  G WKC   D+C   C ++GDP + TFD +H   EG C+YI +MP+    ES    +++ VENK+C +  D+ CAK + +  G G  Q  I ++S + V ++S  V++P K++   +I++  V++  L++E    F +     +RI++ LS  +  KVTGLCGNFN D +DD I P G   KD  + A  ++   TC  +  R  Y G C TS E+   A  VC K + +  FK C + V     + QCKHDVC+CG  R      CEC+A+++YAR C++ G    WR+   CPV CP  M Y+ECGS+C  TC+  +   C  +C++GCQCP    ++E+ G CV    CKC Y G  Y   + RKD+CN CTC +G W CT   C+  + CP G VW +C  CQR+C ++N+ C  +SC+  GC C  G+V    KC+ KG CPC    + + E++V+ RG   C   C CR G W+C    C   C+ WG+ HY +FDG+++DF G CSYVL EDYC   +GTF+I  EN++CG++G SCTKS++  Y+D ++HL+RG  PII RN  W   L    +  +     +   T++ +++QWD ++ V V L P +   VCGLCGNF++  D+DLR R G +  D  AFADSWK++ +C            +  R+ WA K+C+IL+S  F  CH+ V    +YDKCV D+CAC + DDCLC CTA+SQYV  CN   +KI+WRN ++CP+MCP    YK C   CP+ CI        T  C S C+EGC+C +  +L+D  C  ++  C+C    GK+   G  +I  C +CTC     EC+   + +C
Sbjct:  176 VCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPD-GYHGDLCQ-VSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDG-KYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPA-KVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDF--TDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNGNATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSR---SYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKT-RFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTC-PKPPPTPIAPCSSERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVC-KKREQCSCV-VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDC 1454          
BLAST of Hemocytin vs. TrEMBL
Match: A0A1I8GY38 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 465/1296 (35.88%), Postives = 687/1296 (53.01%), Query Frame = 2
Query:  110 ACCLGWSGKKCNEPVCEKGCGP-GKCIEPNICDCRETNRFGQQCERFGAEVASVS---------QNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENR-MKPD-------PAIQMVNCDLNEMATCAKVVSIF---------------GSKFEEICYAEFCQ--MKNQKNSCELMR-DIAFLSS----PDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE--IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGK-FGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP-GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG-------TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNC 3841
             C LG+ G KC  P+C+  C   G C+ PN C C +    G  C+   A  AS S          N    + A C+   G+ + TFD  K       G+ VL+QDC++    YQ+      +C + +   C++++K +   + +   +    V V     + P       +S+  +++ V+G+ DL I Y+   +I V+AP TM + VCGLCG +DG   + F   D    P+   +DF K W   S +++ + P        P  ++ +   + + +   + SI                 S +E +C  + C   +      C   R + A L S       IV +WR    C  P C N  ++S+C ++CN +CG N  D DC   C  GC+C    FW  ++C   D CPC     ++   SY  G K    C+ C+C+  G WKC   D+C   C ++GDP + TFD +H   EG C+YI +MP+    ES    +++ VENK+C +  D+ CAK + +  G G  Q  I ++S + V ++S  V++P K++   +I++  V++  L++E    F +           LS  +  KVTGLCGNFN D +DD I P G   KD  + A  ++   TC  +  R  Y G C TS E+   A  VC K + +  FK C + V     + QCKHDVC+CG  R      CEC+A+++YAR C++ G    WR+   CPV CP  M Y+ECGS+C  TC+  +   C  +C++GCQCP    ++E+ G CV    CKC Y G  Y   + RKD+CN CTC +G W CT   C+  + CP G VW +C  CQR+C ++N+ C  +SC+  GC C  G+V    KC+ KG CPC    + + E++V+ RG   C   C CR G W+C    C   C+ WG+ HY +FDG+++DF G CSYVL EDYC   +GTF+I  EN++CG++G SCTKS++  Y+D ++HL+RG  PII RN  W   L    +  +     +   T++ +++QWD ++ V V L P +   VCGLCGNF++  D+DLR R G +  D  AFADSWK++ +CP P  +      +  R+ WA K+C+IL+S  F  CH+ V    +YDKCV D+CAC + DDCLC CTA+SQYV  CN   +KI+WRN ++CP+MCP    YK C   CP+ CI        T  C S C+EGC+C +  +L+D  C  ++  C+C    GK+   G  +I  C +CTC     EC+   + +C
Sbjct:  176 VCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPD-GYHGDLCQ-VSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDG-KYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPA-KVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDF--TDLMNKPLTHVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNGNATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSR---SYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLSD--------LSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKT-RFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLVRGTDPIISRNLYWPVTLPKAKYEIYPAGFYLFFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIA-PCSSERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVC-KKREQCSCV-VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDC 1446          
BLAST of Hemocytin vs. TrEMBL
Match: A0A1I8G0U9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 462/1295 (35.68%), Postives = 688/1295 (53.13%), Query Frame = 2
Query:  110 ACCLGWSGKKCNEPVCEKGCGP-GKCIEPNICDCRETNRFGQQCERFGAEVASVS---------QNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENR-MKPD-------PAIQMVNCDLNEMATCAKVVSIF---------------GSKFEEICYAEFCQ--MKNQKNSCELMR-DIAFLSS----PDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE--IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGK-FGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP-GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG-------TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNC 3841
             C LG+ G KC  P+C+  C   G C+ PN C C +    G  C+   A  AS S          N    + A C+   G+ + TFD  K       G+ VL+QDC++    YQ+      +C + +   C++++K +   + +   +    V V     + P       +S+  +++ V+G+ DL I Y+   +I V+AP TM + VCGLCG +DG   + F   D    P+   +DF K W   S +++ + P        P  ++ +   + + +   + SI                 S +E +C  + C   +      C   R + A L S       IV +WR    C  P C N  ++S+C ++CN +CG N  D DC   C  GC+C    FW  ++C   D CPC     ++   SY  G K    C+ C+C+  G WKC   D+C   C ++GDP + TFD +H   EG C+YI +MP+    ES    +++ VENK+C +  D+ CAK + +  G G  Q  I ++S + V ++S  V++P K++   +I++  V++  L++E    F +     +RI++ LS  +  KVTGLCGNFN D +DD I P G   KD  + A  ++   TC  +  R  Y G C TS E+   A  VC K + +  FK C + V     + QCKHDVC+CG  R      CEC+A+++YAR C++ G    WR+   CPV CP  M Y+ECGS+C  TC+  +   C  +C++GCQCP    ++E+ G CV    CKC Y G  Y   + RKD+CN CTC +G W CT   C+  + CP G VW +C  CQR+C ++N+ C  +SC+  GC C  G+V    KC+ KG CPC    + + E++V+ RG   C   C CR G W+C    C   C+ WG+ HY +FDG+++DF G CSYVL EDYC   +GTF+I  EN++CG++G SCTKS++  Y+D ++HL +   P++  +P  + Y    I+    Y+         +++QWD ++ V V L P +   VCGLCGNF++  D+DLR R G +  D  AFADSWK++ +CP P  +      +  R+ WA K+C+IL+S  F  CH+ V    +YDKCV D+CAC + DDCLC CTA+SQYV  CN   +KI+WRN ++CP+MCP    YK C   CP+ CI        T  C S C+EGC+C +  +L+D  C  ++  C+C    GK+   G  +I  C +CTC     EC+   + +C
Sbjct:  176 VCNLGYKGDKCELPLCKNNCNSVGTCLAPNKCRCPD-GYHGDLCQ-VSALYASDSTAFVAVRAVNNTRYRNSAVCSAFGGKHFLTFDG-KYFDFPAHGSYVLLQDCVNSEAKYQVYFNGSRNCADAAQTRCQVSLKIVAGPA-KVEIMPGGSVFVNEKPVTLPTIAGIVSVSNTANHITVRGLDDLAITYDGDRNINVYAPKTMSRTVCGLCGRFDGKAANDF--TDLMNKPLTRVVDFAKAWRDESPDDKNVYPSVPADAQHPCARLRSKSTSLLESAQSLCSILRSGSSTFSACHSRVNSSVYESMCMKDMCTCLLNGNATVCNEQRCNSATLYSRACTQQGIVINWRQSNLCPAPKCSNGKVFSECSHDCNQKCGTNTVDDDCGTHCVDGCFCPSGRFWDGHKCVIRDNCPCNRAGDSR---SYPVGSKYSHKCEQCVCDRGGSWKCSPTDECYGYCTVSGDPTYRTFDGRHFSFEGHCEYIMMMPQRSAAESLEYPVAVYVENKYCDSVTDVLCAKLVTLQMGSGEKQHTIRLESLSRVKVDSAYVSLPVKVH---DITIRLVSTSMLRVETNKGFDLLWNGRTRIQIRLSKAFRNKVTGLCGNFNNDMKDDTISPTGIDVKDIRQFAKSWKTNPTCDAKT-RFVYNGACATSKEFDSYATSVCNKLYTESVFKACHSRVDPKWALEQCKHDVCSCGSRRKGVMSQCECTAFASYARSCALDGKVLNWRSSSLCPVKCPPTMEYQECGSNCGKTCKRVEASPCIEECVEGCQCPSGQALDEEKGTCVPRNQCKCVYNGVSYTNGQVRKDKCNNCTCTDGNWECTNLTCTDSNTCPAGMVWSECSDCQRSCENINIECPKSSCKSGGCVCPKGQVLHQGKCVDKGNCPCAMAGKVYAENSVVPRGSTRCYNYCMCRKGSWQCTNNKCPSTCRVWGDPHYETFDGRYYDFMGTCSYVLAEDYCGGTAGTFRITGENIKCGAEGMSCTKSVKITYRDVVVHLPK---PLLAGHPAKAKY---EIYPAGFYL--FFRTEDGIEVQWDMKMKVSVTLQPNWMEKVCGLCGNFNNKRDDDLRARTGEVVEDKVAFADSWKVRNTCPKPPPTPIA-PCSSERKRWAEKKCAILRSSEFTSCHSKVEVNEFYDKCVMDTCAC-KLDDCLCYCTAVSQYVLRCNEMGVKIKWRNPDDCPVMCPKTMVYKRCGSTCPQRCIDISKGETITSDCKSTCVEGCFCPDGEFLEDGVC-KKREQCSCV-VGGKKIAYGKKIIYKCQECTCTAGSLECKPYYLGDC 1445          
BLAST of Hemocytin vs. TrEMBL
Match: A0A0L8GSF5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22028776mg PE=4 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 7.037e-164
Identity = 331/974 (33.98%), Postives = 498/974 (51.13%), Query Frame = 2
Query:  560 SFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPD-------PAIQMVNCDLNEMATCAKVVSIFGSKFE-------------------EICYAEFCQ-------MKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW--YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGK-FGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVY---DNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRG---AAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVN--AFADSWKLKTSCPYPEIS-KNPCDINKFRESWA 3346
            S P+   + ++S+  +Y  VKGI DL I Y+   S++ FAP  M  ++CGLCG +DGN  ++F  V+    P+ T  DF  +WL    E R  P        P +++     N+ +  A  V  F S F                     +C  E C         +     CE+    A   S    +  WR    C    CP  M++ +C  NC   CG    + +C + C  GC+C++   W    + C    +CPC YR + ++  +Y  G   K GC++C C   G W C     C   C ++GDPHF TFD +  F EG+C+Y+ +   + +      ++ +ENK+C    D  C K + I FG   N   I ++S  +V +NS  + +P K +   ++ + KV++  +++ A     V     +RI L LS KY  KVTG+CGNFN D  DDN+ P+G    + ++ A  ++    C+       YLG C  S ++ K+A EVC K + +  FK C   V   KFV QCKHDVC CG  R+    +CEC+A++ YAR C +KGI   WR    C + C K M+Y+ECG +C  TCR  Q  NC+ +CI+GC CP     +E+   CV VE+CKC Y    Y     R++ CN C CI+G W CTT+ C+    C    VW +C  C RTC  +N+ C     + GC C  G+V    D+  C+   ECPC      +     I +   +C   C C+ G W+C +R C   C+A+G+ HY++FDGK ++F G C+Y++ +D+CN+  GTF++  ENV CG+ G SCTKS++F   D II+L RG      I  + P  +P      F+  +  + I+I    + + WD+ + + + L  +Y   VCGLCGN+D   +ND R+++   +   +  AFA+SW+++ SC   +    NPC +N  R+SWA
Sbjct:   18 SLPHQVGDLELSEIANYTVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKTNEF--VNYVRKPVATKADFSNVWLD-PMEQRSIPSVKEDSVHPCVRL----RNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCLLGNSLQECSHKRCEVATQYARACSHHGKIMKWRSNTFCPPHTCPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPC-YRGNDQR--AYPIGTLEKSGCESCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYV-LSQYQAKDGGESFAVWIENKYCNKITDAVCTKVVTIKFGSKNNTQIIRLRS-FKVEVNSMSIGLPYKDD---DVVIRKVSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRP-STIYLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCG-QRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINCTKGMIYQECGYNCDQTCRGIQPQNCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRNEYYEPKSSRQELCNECICIDGHWQCTTESCNVHDLCSGDMVWSNCSDCIRTCDSLNVDCVATCSQQGCICPEGKVQLNKDSQNCVEPSECPCNHLGYQYKNGDKIKK---DCN-QCYCKHGTWKCTERHCAATCEAFGDPHYVTFDGKPYNFQGACAYIVAQDFCNETGGTFQVTTENVPCGTLGYSCTKSVKFLIYDTIINLARGTNITYTINNKAPEGTPMAN---FTIKEVGTYIMIEAHGITLVWDKSMRLYITLENKYMGRVCGLCGNYDQIANNDFRDKSSFPEHTQSPLAFANSWRVRESCAIVDKELPNPCVLNSHRQSWA 967          

HSP 2 Score: 152.14 bits (383), Expect = 4.782e-33
Identity = 136/466 (29.18%), Postives = 220/466 (47.21%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDMNLICD-PNSCEPGCYCESGEVYDNN--KCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTC-RSGKWEC-PKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGS-KGTSCTK--SIRFYYKDHI-IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVI---ITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPY--PEISKNPCDINKFRESWAIKRCS-ILKSETFEPCHNTVRYQLYYDKCVQDSCACDR--GDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGT--KSCISDCMEGCYC-KNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            CP   V+K+C   C+++C       +    C  GC+C+ G ++D +   C+ +G+CPC+  N       + T     C+ SCTC   G+W C   +DC G+C   G+ H+ +FDG+ F F G+C YVL +        +F + IEN  C       CTK  +I+F  K++  I  +R     +       PY    +  +   VS+I+I    +  L + WD +  + + L+ +Y+  V G+CGNF+++V++D     G  + +V  FA  WK  T+C      I    C ++K  E  A + C+ + K E+F+ CH  V    + D+C  D C C +  GD   C C A + Y   C    I + WR    C I C     Y+ C   C +TC G   ++C  +C+EGC C     Y ++D        C C   + + Y   ++  + C++C C    ++C  E
Sbjct:  213 CPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQ-RAYPIGTLEKSGCE-SCTCAEGGRWNCIMSKDCPGICTLSGDPHFQTFDGRQFFFEGECEYVLSQYQAKDGGESFAVWIENKYCNKITDAVCTKVVTIKFGSKNNTQIIRLRSFKVEVNSMSIGLPYKDDDVVIRK--VSNILIRLTASIGLDVLWDGRTRIYLKLSNKYQGKVTGMCGNFNNDVNDDNLTPNGENEFNVTKFAMEWKTNTACNSRPSTIYLGACALSKQYEKLATEVCNKMWKEESFKSCHFAVNPSKFVDQCKHDVCMCGQRHGDPRDCECAAFATYARACVLKGITLNWRKSNLCFINCTKGMIYQECGYNCDQTCRGIQPQNCEEECIEGCNCPPGEKYDEEDNVCVPVEECKCYYRN-EYYEPKSSRQELCNECICIDGHWQCTTE 673          

HSP 3 Score: 85.1149 bits (209), Expect = 1.720e-12
Identity = 75/264 (28.41%), Postives = 113/264 (42.80%), Query Frame = 2
Query: 3077 SIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRN---RAGIIDADV-NAFADSWKLKTSCPYPEISKNPCDI--NKFRESW--AIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCL-CV---CTAISQYVHECNRYNIKIQWRNYENCPI-MCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTY--LKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQING 3808
            ++V    +L I +D   SV  F  P+    +CGLCG FD N  N+  N   +     AD  N + D  + ++     E S +PC    NKF ++       CS+   +   F+ CH+TV    Y   C ++ C C  G+    C    C   +QY   C+ +   ++WR+   CP   CP +  +K C K C ++C        C   C++GC+CK  T        CV        +    + YP+GT     C  CTC   G
Sbjct:   35 TVVKGIDDLIILYDGLSSVYAFAPPQMLGKLCGLCGQFDGNKTNEFVNYVRKPVATKADFSNVWLDPMEQRSIPSVKEDSVHPCVRLRNKFSKAADNVEAFCSVFSLDYVVFQKCHSTVPPDEYIAMCSREMCTCLLGNSLQECSHKRCEVATQYARACSHHGKIMKWRSNTFCPPHTCPKNMVFKECSKNCRQSCGSEGFEAECEEFCVDGCFCKEGTLWDTSTSSCVHRGDCPCYRGNDQRAYPIGTLEKSGCESCTCAEGG 298          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 516.538 bits (1329), Expect = 2.656e-148
Identity = 349/1219 (28.63%), Postives = 563/1219 (46.19%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEE-----------------ICYAEFCQMKNQKNS---CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVD--CSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVE-GQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDND-----CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNS--CEP--GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITKELKIQ--WDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCP--YPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCIS------DCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            A C    G  Y++FDR      +F G    V    S   T+ + +    S V      C   ++ +    + +   S+  +    I+   P  +    I   G +V+V+    + I ++   ++++           GLCG+Y+ N +D F     S++  +    F   W    ++     D A    +CD+    +  +       + +E                  C   +C +  ++     C+ +   A   +  +I+  WR    CE   CP   ++SDC ++C   C          C + C  GC C    + ++ QC R D+CPC +R       +Y+ GD +K+ C  C+C+  G W+C + ++C+++C I G  H  TFD +   ++ G CQ+I V   E   D  +L++ +    C       C + + +        T + + SK  VI+N +   +P       +++V + TS  L ++      ++  D S + + L   +A KV GLCG    +  DD   P+G         AA++ +        +       C T  +  + A  VC       F+ C  +V  + +V  C+ +VC+C   R      C C+  +AYA+ C+ +G+   WR   FCPV C    VY+ECG +C  +C  L+Q   C+ +     C+ GCQCP+ + +++  G CV V+ C C + G  +      +  CNTC C  G+WNC+   C     CP   ++   G C RTC  ++    P +   EP  GC C  G V   ++C+   ECPC    + F  +  I++   +C  +C C+  +W C ++ C G C A G+ HY++FDG+ + F GDC Y+L ++     SG F +  ENV CGS G +CTKS+     +  IHL+RG +  +   P   P  Y G+G+    + V   V ++  L +   WD  + V V L P  +  V GLCGNFD + +ND   R GI+++    F +SWK+  SCP    +  ++PC IN  R +WA K+C+++  E F  CH  V YQ YYD CV D+C CD G DC C+CTAI+ Y  ECNR  + I WR+ E CP+ C     Y+PC   C   C  +   +        C+EGC+C + T    D C++    C C+ E G  +P G  + ++C  CTC    ++C
Sbjct:  196 ATCMSWGGVHYRSFDRK---HFHFQGGCTYVLA-SSTDGTWAVYI----STVCDGGGHCSKALQMMLGRDLVSVNKSNMSLNGLIIAQGEPVFQNGVSIHWLGDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSIS--QYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERVGAVCDTLASYARECAQQHIILSWRRPDLCER-VCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCLRKDDCPCFHRR-----HTYQEGDTIKQKCNTCVCQG-GQWQCSS-ERCAAQCSIIGAMHISTFDKKSYNLQAGGCQFIVV---EDFVDK-KLAVTIRAGECVTGGRTGCPQEMSVT----ALHTTVTVNSKGSVILNGQPEALPVLT---ADLAVRRATSSFLLVQVFGARLLWHTDGSLVVITLEPGFAHKVRGLCGTLTWNQHDDFTTPEGDVENSVPSFAAKFNIGSCPLSSAVTSD---PCSTYTQRRQYAESVCAVLHSAVFQACHDVVEREPYVRMCQTEVCSCATHRL-----CHCTVVTAYAQHCAQEGVLVSWRNHTFCPVQCSGGQVYQECGRACGGSCADLQQSWVCEENAGSRTCVPGCQCPEGL-MQDDQGQCVPVDMCPCVHGGAVHQPGSSVQINCNTCVCGKGVWNCSDDPCPEVRECPGSLIFSP-GSCLRTCSSLD---SPQALCTEPIYGCVCPEGTVLLGDQCVTPDECPCHHNGRLFFTNDTISK---DCN-TCVCKQRRWHCTQQLCAGTCVATGDPHYVTFDGRCYSFLGDCEYMLAQEM----SGLFSVSAENVPCGSTGVTCTKSVTLTVGNTAIHLLRGKSVTVNGMPVTLPKSYSGSGLVL--EKVGMFVSLSSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDTENDFTTRQGIVESTPELFGNSWKVSPSCPDVAEQDLRDPCVINPHRVTWAKKKCAVITQELFSLCHAEVPYQQYYDWCVFDACGCDSGGDCECLCTAIAAYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCPSSTPSVHSHCSPLSCVEGCFCPHGTVRHGDGCITPSE-CPCEWE-GSLFPAGAVLTQHCQNCTCSNGTWDC 1360          

HSP 2 Score: 181.8 bits (460), Expect = 5.643e-45
Identity = 153/549 (27.87%), Postives = 229/549 (41.71%), Query Frame = 2
Query: 1166 GCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQL-SIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDS--RIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDN-----DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCE-------PGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDC 2767
            GC C +      +QC   DECPC +         +   D + K C  C+C+ R  W C T   C+  C+ TGDPH+VTFD +     G C+Y+      +  +M  L S+  EN  C  S  +TC K + +  G     T I +     V +N   VT+P K   G  + + KV   G+ +       V    D   R+ + L      +V GLCGNF+GD E+D     G            ++++ +C  +V  Q     C  +      A + C    Q  F  C A VP  ++   C  D C C    +     C C+A +AYA  C+ +G+   WR+ E CP+ C   +VY+ CGS+CSA C     P+  +      C++GC CP   V       C+   +C CE+ G  + A       C  CTC NG W+CT   C     C   + ++   G QR    + L  + + C        P  YC      +  +C     C  +      ++      G F  +  C C  G+++CP   C
Sbjct:  950 GCVCPEGTVLLGDQCVTPDECPCHHNGRL-----FFTNDTISKDCNTCVCKQR-RWHC-TQQLCAGTCVATGDPHYVTFDGRCYSFLGDCEYM------LAQEMSGLFSVSAENVPC-GSTGVTCTKSVTLTVG----NTAIHLLRGKSVTVNGMPVTLP-KSYSGSGLVLEKV---GMFVSLSSRLGVTLLWDGGMRVYVRLEPHLQGRVGGLCGNFDGDTENDFTTRQGIVESTPELFGNSWKVSPSCP-DVAEQDLRDPCVINPHRVTWAKKKCAVITQELFSLCHAEVPYQQYYDWCVFDACGC---DSGGDCECLCTAIAAYAEECNRRGVYIHWRSQELCPLQCEDGLVYEPCGSTCSAVCP-SSTPSVHSHCSPLSCVEGCFCPHGTV--RHGDGCITPSECPCEWEGSLFPAGAVLTQHCQNCTCSNGTWDCTGPACPPLVPCLESE-FQCTRGSQRCIPSIWLCDNEDDCGDGSDEICPSTYCGVVCAEEEFRCS-SSRCILYLHRCDGHDDC----GDFSDERGCVCSLGEFQCPGDQC 1463          

HSP 3 Score: 163.31 bits (412), Expect = 1.812e-39
Identity = 115/468 (24.57%), Postives = 196/468 (41.88%), Query Frame = 2
Query: 2483 QSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEP----GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFH-GDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVF-LTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPE-ISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCI------------GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            +  CP G+++ DC           L      C      GC C  G      +C+ K +CPCF +  ++ E   I +   +C  +C C+ G+W+C    C   C   G  H  +FD K ++   G C ++++ED+ +KK     + I   EC + G T C + +        + +    + I+   P   P L   +  +    S +++     ++ W    S+ V  L P + + V GLCG    N  +D     G ++  V +FA  + +  SCP    ++ +PC     R  +A   C++L S  F+ CH+ V  + Y   C  + C+C      LC CT ++ Y   C +  + + WRN+  CP+ C   + Y+ C + C  +C             G+++C+     GC C       D        +C C        P G++V  NC+ C C    + C  +
Sbjct:  459 ERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCLRKDDCPCFHRRHTYQEGDTIKQ---KCN-TCVCQGGQWQCSSERCAAQCSIIGAMHISTFDKKSYNLQAGGCQFIVVEDFVDKK---LAVTIRAGECVTGGRTGCPQEMSVTALHTTVTVNSKGSVILNGQPEALPVLTADLAVRRATSSFLLVQVFGARLLWHTDGSLVVITLEPGFAHKVRGLCGTLTWNQHDDFTTPEGDVENSVPSFAAKFNIG-SCPLSSAVTSDPCSTYTQRRQYAESVCAVLHSAVFQACHDVVEREPYVRMCQTEVCSCATHR--LCHCTVVTAYAQHCAQEGVLVSWRNHTFCPVQCSGGQVYQECGRACGGSCADLQQSWVCEENAGSRTCV----PGCQCPEGLMQDDQGQCVPVDMCPCVHGGAVHQP-GSSVQINCNTCVCGKGVWNCSDD 911          

HSP 4 Score: 122.479 bits (306), Expect = 5.430e-27
Identity = 100/365 (27.40%), Postives = 158/365 (43.29%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRN-PTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLT--PEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK----TSCPYPEISKNPCDIN---KFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCI-----GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            C +WG  HY SFD K F F G C+YVL     +   GT+ + I  V  G  G  C+K+++      ++ + +    + G       P    G+ S H ++   V +   L ++    LS  V+LT   E+     GLCG +++N ++D   R+G I     +F +SW++       C       + CD+      R   A   C  LK   F  CH+ V    Y D C+   C+    +    VC  ++ Y  EC + +I + WR  + C  +CP  + +  C   CP +C       +  C  +C+ GC C    YL   +C+  K  C C       Y  G T+ + C+ C CQ   ++C  E
Sbjct:  198 CMSWGGVHYRSFDRKHFHFQGGCTYVLA----SSTDGTWAVYISTVCDG--GGHCSKALQMMLGRDLVSVNKSNMSLNGLIIAQGEPVFQNGV-SIH-WLGDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRG-AESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERVGAVCDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHRGQCL-RKDDCPCFHRR-HTYQEGDTIKQKCNTCVCQGGQWQCSSE 551          

HSP 5 Score: 119.398 bits (298), Expect = 3.904e-26
Identity = 88/383 (22.98%), Postives = 165/383 (43.08%), Query Frame = 2
Query: 1358 SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKI-NKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGL-CETS--IEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRP---NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            S+ C+  G  H+ +FD +H   +G C Y+      + S       +  +  C       C+K ++++ G  L        +K+ + +N  ++     +   GV I       D + +E+G    +     + + L ++ ++     GLCG +N + EDD     G+ ++  +     +R+           + LG  C+ +  +   + A   C +  +  F  C   V    +V  C +  C+ G       +   C   ++YAR C+ + I   WR P+ C  +CP   ++ +C SSC  +C     P    C  +C+ GC+CP  + +    G C++ +DC C +    Y   +  K +CNTC C  G W C+++ C++Q
Sbjct:  195 SATCMSWGGVHYRSFDRKHFHFQGGCTYV------LASSTDGTWAVYISTVCDGGGH--CSKALQMMLGRDLVSV-----NKSNMSLNGLIIAQGEPVFQNGVSIHWL---GDFVFVESGLGVRIKFDLSNTVYLTVNTEHFAATRGLCGVYNNNAEDDFTGRSGSISQYAASFGNSWRVPDQQTEGCSDAAELGHSCDVTGDVSLRRGAESACHQLKESPFSHCHHQVDPGPYVDTCLYVYCSLGEKERVGAV---CDTLASYARECAQQHIILSWRRPDLCERVCPGGQLFSDCVSSCPPSCSSALPPASGQCREECVGGCECPPGLYLHR--GQCLRKDDCPCFHRRHTYQEGDTIKQKCNTCVCQGGQWQCSSERCAAQ 556          

HSP 6 Score: 63.1586 bits (152), Expect = 4.320e-9
Identity = 56/201 (27.86%), Postives = 79/201 (39.30%), Query Frame = 2
Query: 2210 KNMVYKE-CGSSCSATCR-LRQRPNC-DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC----EYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY-------------------------------------------CPNGKVWKDCGG-CQRTCRDM--NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPC 2653
            +  VY+  C + C  +C  L +   C    C  GC+CPD  +++E  G CV+V  C+C    E    + +  +     CNTC CING   CT + C +                                              CP G+V+  C G C  +C+D+     C P +C PGC C    V  N  C+P  ECPC
Sbjct: 4499 RGRVYEANCANQCPRSCADLWEHVQCLQGTCHPGCRCPDGWLLQE--GECVRVTACRCGLPTENGTLELSPGQNVTVDCNTCVCINGSLVCTNQPCPTYGSWGSWSECSVSCGTGQRIRRRSCTHKPGGPPCSETEQNQTCTQPCPAGQVFSACAGSCPFSCQDLWPESECVPGACSPGCACPPATVMFNGTCVPHSECPC 4697          

HSP 7 Score: 59.3066 bits (142), Expect = 7.175e-8
Identity = 39/108 (36.11%), Postives = 53/108 (49.07%), Query Frame = 2
Query: 2480 SQSYCP----NGKVWKDCGG-----CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGL 2776
            SQ  CP    +G V++ CG      C  +   ++  C P SC  GC+C  G V   + CI   ECPC W+   F   AV+T+    CQ +CTC +G W+C    C  L
Sbjct: 1265 SQELCPLQCEDGLVYEPCGSTCSAVCPSSTPSVHSHCSPLSCVEGCFCPHGTVRHGDGCITPSECPCEWEGSLFPAGAVLTQ---HCQ-NCTCSNGTWDCTGPACPPL 1368          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:103041546])

HSP 1 Score: 440.269 bits (1131), Expect = 2.391e-124
Identity = 322/1177 (27.36%), Postives = 537/1177 (45.62%), Query Frame = 2
Query:  494 FKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW-LSVSRENRMKPDPAIQMVNC------DLNEMATCAKVVSIF--------GSKFEEICYAEFCQ-MKNQKNSCELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY------------------CPNG------KVWKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHL----IRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDRE---------YKPCEKVCPETCIGTK--SCISDCMEGCY--CKNNTYLKD--DECVSEKPLCTCKDESGKEYPLGTTVIKN------CHKCTCQINGFEC 3817
            F+  +    + SQG +   + Y+     A F++     +    G    +I  +   +I +          CGLCG Y+    D++   +  +   E   DF   W ++ + E   +  P  Q  N       DL       +   +F           F  +C ++ C  +  Q+  C+ + + A   +S   ++ +W  +  C  P CP  M +S+C   C+  C   N    C + C  GC C        ++C    +C C++         Y  G  + + C  C+C   G W+C T+++C  +C+++G  H+ TFD++     G CQY+  + K+ ++++   S I++   C + +D  C + + + F E  NQT + +K    V ++   V +P  IN  + +    ++S  +++  GD   +      R+ L LS  YA K+ GLCGN+NG+  DD +   G            +++   C  + +++     C  + +  + A E C      +F+ C   V    ++  C++DVC+C     A    C C+A S YA  CS +G+   WR   +C + CP N VY+ CGS C+ TCR R  P+  C + C +GC CP  + + + TG CV  + C C Y G  Y  N+   D  + C C NG   C++ +  +                     CP        +  +D G  C RTC++++L C    C  GC C  G V    +C+P  +CPCF  N +++    I     +C  +C C   +W+C +R C+G+C   G+SHY+SFDG  F F G C Y+L +DYCN   GTF+I++EN  CG+ G  C KSI  +Y   +I +    ++   P++    T    + +G +        IV++ K + I WD    + + ++ +Y+  VCGLCGNFD + +NDL +    I+ D   F +SWK++ SC       + C  +  ++    + C +L S+ F  C++ V  + Y++ C  D+C+C    DC C C AI+ Y HEC +  + + WR+ + CP+ C    +         +  C+  CP+TC   +  SC   C+EGC+  C     L +    CV E   C     +G+    G  +I N      C  C C+ N   C
Sbjct:   85 FELHLSVGGVLSQGAERLPLPYASSSVFAGFELGSVRLWSEEFG---FSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLT--EDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQECVCQALLEYARTCASHGLVLPNWHTQSQCT-PKCPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDGDRCVEVSQCSCQHTGK-----RYPPGSTISQDCNTCVCR-HGSWEC-TNEECPGQCVVSGQSHYKTFDDKFFTFSGFCQYL--LAKDCQTNL--FSAIIDTVQCADDQDAVCTRSVTLKFHELANQT-VRLKHGGVVSVDGLDVQMP-LINGLLRVQSTVLSS--VRLNYGDDLQLDWDGRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGLVETRVEGFGNAWKMNAEC--DNIQKQPSDPCSLNPKRVRFAEEACALLLSPKFEPCHHEVNPYPYLKNCRYDVCSC-----ADGQECLCAAVSNYAAACSARGVLINWRGQGYCELTCPGNQVYEVCGSVCNQTCRSRSLPDSACRSMCEEGCFCPRGLYLTD-TGECVPPDQCSCHYDGEIYQPNDMFADHHSICYCENGSMRCSSSELPASVLSDLFFDEPPLSRERRSVSCPAPLQQLRCESVRDVGIECARTCQNLDLECVSQGCISGCVCPPGTVRHRRECVPPDQCPCFHNNHAYSPGQSIK---IDCN-TCVCGGRQWKCTQRVCDGVCHTVGDSHYISFDGLKFTFPGPCQYILAQDYCNGLDGTFRILVENSACGTIGHRCRKSISVFYMGGLIVMEQEEVKMKKPVMKE--TDVEIVRSGFY-------YIVLLGKNISITWDTGTRIILQISGQYRGKVCGLCGNFDGSQNNDLLSSNNQIEVDPLDFGNSWKVQPSCANAVQVPSQCSTDMSKQVTVEQSCRVLNSDLFRECNSVVDPEPYWEICTHDTCSCASVGDCACFCDAIAAYAHECAQKGVVVDWRSNDLCPLSCEELNKDAGVECMWRFNACDTACPKTCQHPEQLSCPIACLEGCHASCPQGQILDEVLRRCV-EPSECQVCMHNGERISHGKQIILNHGDPHLCQICHCEENTLTC 1218          

HSP 2 Score: 140.584 bits (353), Expect = 1.456e-32
Identity = 99/362 (27.35%), Postives = 163/362 (45.03%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL---KTSCPYPEISKNPCDINKFRESWAIKRCSILK-SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            G C  +G  H  +FDG  ++F GDCSY L  D C+ +  TF I+ +      KG +      F  +   +HL  G     G      PY  + +F+  + + S+ + ++E    I+ D   ++ + L+  + N+ CGLCGN++    ++   + G +  D   FA+SW +     +C         C+         + RC  L+ S  F  C + V    +   C  D C C  G +  CVC A+ +Y   C  + + +  W     C   CP   +Y  C + C  +C      + C  +C++GC C     L  D CV E   C+C+  +GK YP G+T+ ++C+ C C+   +EC  E
Sbjct:   26 GRCSLFGRHHVHTFDGVIYEFPGDCSYKLAGD-CHHR--TFSILGDLSHGRRKGVTV-----FLGETFELHLSVGGVLSQGAERLPLPYASSSVFAGFE-LGSVRLWSEEFGFSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHCVDGQE--CVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDGDRCV-EVSQCSCQ-HTGKRYPPGSTISQDCNTCVCRHGSWECTNE 374          

HSP 3 Score: 126.716 bits (317), Expect = 2.530e-28
Identity = 100/380 (26.32%), Postives = 150/380 (39.47%), Query Frame = 2
Query: 1364 RCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIP---SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQ-FKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            RC + G  H  TFD       G C Y      ++  D    +  +              KG+ +  GE     E+ +     +   ++ + +P   S +  G E+   ++ S+    E G  FS+       I+L LS  +A    GLCGN+N  P D+    +G   +D  + A  + +                C  +    +     C        F  C  LV +D F   C+ DVC+C          C C A   YAR C+  G+    W T   C   CP  M Y EC  +CS +C+ L     C  +C+DGC C    V++     CV+V  C C++ G+ Y         CNTC C +G W CT ++C  Q
Sbjct:   27 RCSLFGRHHVHTFDGVIYEFPGDCSY------KLAGDCHHRTFSILGDLSHGRR-----KGVTVFLGETF---ELHLSVGGVLSQGAERLPLPYASSSVFAGFELGSVRLWSE----EFG--FSIRIDPAHNIQLTLSKHHANHTCGLCGNYNSVPTDEYTAQEGFLTEDPYDFANSWAMNGASEACKRVTPPAQTCNNTGASARDLMSRCETLRTSPVFLHCAHLVDTDAFAAVCESDVCHC-----VDGQECVCQALLEYARTCASHGLVLPNWHTQSQCTPKCPIGMQYSECSQACSTSCQSLNIHEVCREECVDGCSCAVGKVLDGD--RCVEVSQCSCQHTGKRYPPGSTISQDCNTCVCRHGSWECTNEECPGQ 379          

HSP 4 Score: 89.7373 bits (221), Expect = 4.101e-17
Identity = 106/488 (21.72%), Postives = 182/488 (37.30%), Query Frame = 2
Query: 1298 CQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVF--RKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDC---------------IDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEE---RKDRCNTCTCING-LWNCTTKDCSSQSYCPNGKVWKDCGGCQ--------RTCRDMNLICDPNSCE----PGCYCESGEVYDN-NKCIPKGECPC 2653
            C+N L   R    C    +C   C+ +   H V+F    + ++G C Y+ +     E       +++    C +S +  C K +++  G     T + +K   +V ++  +  +P +   GV ++        L+ E       F    ++  I L L+       TG+CG+ + D +   ++PDG+P+ D       + +     GE +    + +CE  +  G      C       F  C A++P   +V  CK   C+   +         C   +AY+ +C  +G+   WR  + C      +M Y  C + C   C   Q    D D                 +GC CP   V+ E  G CV  E C    +  G+ +   E      + C  C C++    NCT   C+             CG C+        + C +   +CD  +C+    P C      V  N  +C P  +C C
Sbjct: 1936 CKNNLRAVRVNQTCGCSWKCPCMCMGSSTSHVVSFGGTALKLKGACSYLLLHSGGTE-------LVLHTATCDSSPNQICMKSLELKEG----GTSVMLKDDMKVTVDGAVTAVPFR-RGGVSVTQIGALLHQLRSETQGFTLTFTPHSNEFTISLDLTMITNTSTTGICGSCSDD-QAHLLLPDGSPSTDPDAYLQAWAV-----GECVWNKNVSVCEAGVAQG------CELLASSVFGQCHAVLPPQDYVEMCKQLACHPTAM---------CDLITAYSSVCRQQGVCVNWRNADLCRKSLLFSMEYDACRTGCVEQCGHGQAALGDMDVRGDGLGGSSQCWSAPTEGCFCPHGTVLLE--GECVGREACSQCVDQHGQAHQLMESWTPNDNPCILCVCLDKQRINCTALPCTKAKA-------PVCGKCEILLEKTDSKCCPEYECVCDTANCKVSDPPQCENGLSPVLTNPGECAPIYQCVC 2381          

HSP 5 Score: 85.5001 bits (210), Expect = 7.442e-16
Identity = 88/381 (23.10%), Postives = 139/381 (36.48%), Query Frame = 2
Query: 2741 KWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS-CTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQ----------WDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINK---FRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCI-----------------GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKC 3790
             W+CP      +C     SH +SF G      G CSY+LL       SG  ++V+    C S     C KS+        + L       +    T  P+   G+      V+ I  +  +L+ +             + ++ + LT     +  G+CG+  D+    L    G    D +A+  +W +             C  NK     E+   + C +L S  F  CH  +  Q Y + C Q +C          +C  I+ Y   C +  + + WRN + C        EY  C   C E C                  G+  C S   EGC+C + T L + ECV  +    C D+ G+ + L  +   N + C
Sbjct: 1952 SWKCP-----CMCMGSSTSHVVSFGGTALKLKGACSYLLLH------SGGTELVLHTATCDSSPNQICMKSLELKEGGTSVMLKDDMKVTVDGAVTAVPFRRGGV-----SVTQIGALLHQLRSETQGFTLTFTPHSNEFTISLDLTMITNTSTTGICGSCSDD-QAHLLLPDGSPSTDPDAYLQAWAV-----------GECVWNKNVSVCEAGVAQGCELLASSVFGQCHAVLPPQDYVEMCKQLAC------HPTAMCDLITAYSSVCRQQGVCVNWRNADLCRKSLLFSMEYDACRTGCVEQCGHGQAALGDMDVRGDGLGGSSQCWSAPTEGCFCPHGTVLLEGECVGREACSQCVDQHGQAHQLMESWTPNDNPC 2298          

HSP 6 Score: 52.373 bits (124), Expect = 7.171e-6
Identity = 82/378 (21.69%), Postives = 139/378 (36.77%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQG--VKVGNISYSFPYSKAEFQI-SDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLD-FIKIWLSVSRENRMKPDPAIQMVNCDLNEM------ATCAKVVSIFGSKFEEICYAE---FCQMKN-----------QKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSX-XXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWY-KNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHD 1351
             QC       YKTFD      + F    +L +DC +        +I    C +     C  ++   F +    T     G  V V  +    P      ++ S     V +    DL + ++ +G + +        ++CGLCG Y+GN  D F T       +ET ++ F   W   +  + ++  P+     C LN          CA ++S    KFE  C+ E   +  +KN           Q+  C  + + A   S   ++ +WR +  CE   CP   ++              +  D  C  +C  GC+C +  +     +C   D+C C Y       + Y+  D        C CE+ G  +C + +
Sbjct:  378 GQCVVSGQSHYKTFDDKFFTFSGFC-QYLLAKDCQTN---LFSAIIDTVQCADDQDAVCTRSVTLKFHELANQTVRLKHGGVVSVDGLDVQMPLINGLLRVQSTVLSSVRLNYGDDLQLDWDGRGRVVLRLSPVYAGKMCGLCGNYNGNQGDDFLTAGGL---VETRVEGFGNAWKMNAECDNIQKQPSDP---CSLNPKRVRFAEEACALLLS---PKFEP-CHHEVNPYPYLKNCRYDVCSCADGQECLCAAVSNYAAACSARGVLINWRGQGYCEL-TCPGNQVYEVCGSVCNQTCRSRSLPDSACRSMCEEGCFCPRGLYLTDTGECVPPDQCSCHYDG-----EIYQPNDMFADHHSICYCEN-GSMRCSSSE 734          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 392.119 bits (1006), Expect = 2.178e-109
Identity = 319/1211 (26.34%), Postives = 513/1211 (42.36%), Query Frame = 2
Query:  119 LGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTG--NMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNI-FYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLD-FIKIWL-------SVSRENRMKPDP-AIQMVNCDLNEMATCAKVVS---------IFGSKFEEICYAEFC-QMKNQKNSCELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKL-VTIPS-----KINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSY--LGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKG--IQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRP-NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCG------------GCQRTCRD--MNLICDPN-SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKH------DYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREY 3586
            L W G++   P        G+C+ P+ C+C      G  C+           N  L  +  C      +Y+TFD +      F G  +  L++DC        +I +  +         C  ++        E   L    V     S   P++  + ++     YV V   +   + ++   GSI++        + CGLCG ++ + +D  +T   S      DL  F   W+       + S    + P P + Q  +  L     CA ++          +    +   C  + C    N    C++  + A   +  D+ ++ WR  +      CP ++ + +C   C   C      +D    C  GCYC+ D  +    C +A +CPCE+R        Y  G  +++ C NC C S G W C T  +C   C +TGD +F +FD +       CQY  V+ K   S     ++ ++N  C  + D  C + + ++  E   +TE+ +    EV + S+  +++P      +I +   + V   TS GL ++       +   + R+ L L   +     GLCG FNG+ +DD + P G            +R++  C   V R S   L  C+T  +    A E C    Q  F  C   V    F  QC+ DVC CG         C CSA + YAR C      I+F+   PE C V CP  M Y  C SSC   C     P +C ++C +GC CP        T +CVK  +C C ++G DY+  +          C +G      +   +   CP G++++DCG             C RTC    +NL C  +  C PGC C +G +   ++C     CPC W+ + +     ++     C L C C+ G ++C  R C  +C A+G+ HY +FDG  FD+ G C   LL+   +       +  EN++C   G  C K++             G + I+  + T  P   + I  ++       Y + + +   EL + WDR+ ++ +   P ++  + GLCGNFD    N++R    +  A    F +SW        P+I ++PC +N  RE++A K+C IL SE F+ CH  V    +Y  C+ D+C C RG DC C C++++ Y H C    + + WR+    P +CP D EY
Sbjct:   79 LRWEGRRARGPCTFPCLNGGQCVYPDSCNCSLYQATGTHCQTV--------PNSGLEREMTCRSWGQYNYETFDGLYYY---FPGKCSYTLLKDCEENIQPSLLIQVHNDPECTSFPYSCTRSVSLFLPWEGEI-RLQDLNVTFKGQSVKLPHNIHDLELEQIADYVLVSQPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKT---SYGVFTEDLAMFGNSWVEEEPQKATCSMIPYLYPSPCSGQDSHVLLKVEEVCATLLKEPFKSCHEFVSPYSYMASCSNDLCLSGPNGDVVCQVFTEYARACAHADHPLNKWRTHVPVCGVECPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPCEHRGML-----YPSGHTIQEECNNCTC-SGGAWNC-TEQKCPGECSVTGDMYFQSFDGRVYTFLATCQY--VLAKSRNSG--GFTVTIQNAPCGPNLDGACIQSVNVVLNED-PRTEVTLSHSGEVFMASQFRISLPYSDDVFQIQELSSLFVQVKTSQGLLLQ-------YNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQLFGNAWRVSSAC---VPRPSLPQLDPCDTHQQAASYAVEKCEVLMQEVFAVCHEHVSPVGFQLQCRADVCKCG-------TPCLCSALAHYARTCRKHNVIIEFRSHVPE-CSVACPATMEYGLCVSSCQRRCLSFSMPQSCGDECEEGCVCPQGTYYSTHTHSCVKRNECPCSFLGTDYSPGDVIMTSSGVQICRDG--QIVLQSTITDKLCPPGQIYEDCGNMVDGPSVSKGLACDRTCESYLLNLTCSTHEPCVPGCVCPTGLLKHGDECFEPVACPCLWKGKEYYPGDKVSS---TCHL-CVCQQGTFQCEFRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLLKSSADVM---VSVTTENIDCFESGVICRKALLISV---------GRSFIVFDDETGKPSPSSVIDRQNVLIWSAGYFTIVHLSQYELSVLWDRKTTIHIQAGPRWQGKLSGLCGNFDLKTVNEMRTPDNMDSATPQEFGNSWTAAECVNSPDI-RHPCSLNPLREAFAKKQCGILLSEVFQVCHPVVDVTWFYMNCLADTCGCSRGGDCECFCSSVAAYAHRCCHQGVTVDWRS----PSLCPYDCEY 1221          

HSP 2 Score: 177.563 bits (449), Expect = 7.451e-44
Identity = 114/412 (27.67%), Postives = 199/412 (48.30%), Query Frame = 2
Query: 2492 CPNGKVWKDCGGC-QRTCRDMNLICDPN-SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKDHI---IHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVII--TKELKIQWD-RQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-PYPEISK-NPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNY-ENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTY 3682
            CP    +++C  C    CR   +  D    C  GCYC+   +Y++  C+   +CPC  +   +     I     EC  +CTC  G W C ++ C G C   G+ ++ SFDG+ + F   C YVL +   ++ SG F + I+N  CG     +C +S+     +     + L       +      S      +F   +  S  V +  ++ L +Q++ R+  + + L   ++++  GLCG F+ N+ +D    +G+I++    F ++W++ ++C P P + + +PCD ++   S+A+++C +L  E F  CH  V    +  +C  D C C  G  CLC  +A++ Y   C ++N+ I++R++   C + CP   EY  C   C   C+     +SC  +C EGC C   TY
Sbjct:  403 CPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASDCPCEHRGMLYPSGHTIQE---ECN-NCTCSGGAWNCTEQKCPGECSVTGDMYFQSFDGRVYTFLATCQYVLAK---SRNSGGFTVTIQNAPCGPNLDGACIQSVNVVLNEDPRTEVTLSHSGEVFMASQFRISLPYSDDVFQIQELSSLFVQVKTSQGLLLQYNWREFRLYLQLGELWRDDTVGLCGTFNGNIQDDFLAPSGMIESTPQLFGNAWRVSSACVPRPSLPQLDPCDTHQQAASYAVEKCEVLMQEVFAVCHEHVSPVGFQLQCRADVCKC--GTPCLC--SALAHYARTCRKHNVIIEFRSHVPECSVACPATMEYGLCVSSCQRRCLSFSMPQSCGDECEEGCVCPQGTY 803          

HSP 3 Score: 141.354 bits (355), Expect = 8.336e-33
Identity = 103/372 (27.69%), Postives = 170/372 (45.70%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIEN-VECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDY----VSSIVIITKE--LKIQWD-RQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSW----KLKTSCPY-PEISKNPCDINKFRESWAIKR-CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNY-ENCPIMCPPDREYKPCEKVCPETCIGTKSCISD---CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            E  C++WG+ +Y +FDG ++ F G CSY LL+D       +  I + N  EC S   SCT+S+  +          G   +   N T+         + HD     ++  V++++     + W     S+ + ++PE+    CGLCGNF+ +V++DL+   G+   D+  F +SW      K +C   P +  +PC          ++  C+ L  E F+ CH  V    Y   C  D C      D   VC   ++Y   C   +  + +WR +   C + CP + +Y+ C   CP  C   + CI     C++GCYC+++   +D  CV     C C +  G  YP G T+ + C+ CTC    + C ++
Sbjct:  129 EMTCRSWGQYNYETFDGLYYYFPGKCSYTLLKDCEENIQPSLLIQVHNDPECTSFPYSCTRSVSLFLP------WEGEIRLQDLNVTFKGQSVKLPHNIHDLELEQIADYVLVSQPQVFTLAWHGLNGSIYIKMSPEFVGRTCGLCGNFNADVNDDLKTSYGVFTEDLAMFGNSWVEEEPQKATCSMIPYLYPSPCSGQDSHVLLKVEEVCATLLKEPFKSCHEFVSPYSYMASCSNDLCLSGPNGD--VVCQVFTEYARACAHADHPLNKWRTHVPVCGVECPAELQYRECIPCCPVHCRTEQMCIDSKLQCLDGCYCQDDLIYEDGLCVKASD-CPC-EHRGMLYPSGHTIQEECNNCTCSGGAWNCTEQ 490          

HSP 4 Score: 79.7221 bits (195), Expect = 3.744e-14
Identity = 94/368 (25.54%), Postives = 143/368 (38.86%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS--------CTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEY--KNNVCGLCGNFDDNVDNDLRNRAGIIDA---DVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS----ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCI-----------SDCMEGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLG 3760
            CPK DC   C  + + + ++FDG         SYV+ +      + T  I+++  EC S   +        C  ++   ++ + + + R    +        P      F   D  +  +I +   LKIQW     + V  T  Y  K +  GLCG  D N  NDL    G I A   D   F DSW++  +  Y   S+      +   + +   CS    +L + TF  CH  V    + +  V+D+   +        C A++ YV  C+++NI I+WR+ + CP +CP    Y+ C   C        SC            S   EGC C   T L         P   C C D  G    LG
Sbjct: 2359 CPKWDCPCRCSVFPDLNVVTFDGNNVAIFKAASYVVTQ----LPNETVSILVQ--ECNSSDNTLVWNFTNLCLAALNITHESNQVLINRLQRRLYVNTRYAKPRFKKYGFEILDTGNMYLIRSPAGLKIQWFHSTGMMVIETETYTHKLSTMGLCGCCDGNPLNDLTLSNGSIMAESEDPAVFIDSWQVPNTTSYISHSR------RREVNCSTSDCSACLNMLNNLTFTACHPFVPPATFCEVWVRDAEYVNNP------CVALAAYVASCHKFNICIEWRSPDYCPFICPESLRYQACLPAC-----TAPSCPNQEFEYDAGQCSGLAEGCVCPQGTLLHRPYSALCIPPNKCACTDSFGAPRALG 2703          

HSP 5 Score: 69.3218 bits (168), Expect = 5.930e-11
Identity = 86/393 (21.88%), Postives = 156/393 (39.69%), Query Frame = 2
Query: 1355 CSSRCIITGDPHFVTFDNQHIFVEGQCQYIAV-MPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIE--------LVLSAKYARKVT--GLCGNFNGDPEDDNIMPDG---APAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDND-----------CIDGCQCPDDMVIEEK-TGNCVKVEDCKC-EYMGRDYNANEERKDRCNTCTCINGL 2452
            C  RC +  D + VTFD  ++ +     Y+   +P E  S + Q     +N   +N  ++ C   + I      NQ  I  + +  + +N++    P     G EI           ++ G+++ +      +I+        ++ +  Y  K++  GLCG  +G+P +D  + +G   A ++D +     +++  T       +     C TS       +          F  C   VP   F        C    +R+A  +N  C A +AY   C    I  +WR+P++CP ICP+++ Y+ C  +C+A       P+C N              +GC CP   ++    +  C+    C C +  G      E  K   + C C++G+
Sbjct: 2364 CPCRCSVFPDLNVVTFDGNNVAIFKAASYVVTQLPNETVSILVQECNSSDNTLVWNFTNL-CLAALNITHES--NQVLIN-RLQRRLYVNTRYAK-PRFKKYGFEI-----------LDTGNMYLIRSPAGLKIQWFHSTGMMVIETETYTHKLSTMGLCGCCDGNPLNDLTLSNGSIMAESEDPAVFIDSWQVPNTTSYISHSRRREVNCSTSD-----CSACLNMLNNLTFTACHPFVPPATF--------CEV-WVRDAEYVNNPCVALAAYVASCHKFNICIEWRSPDYCPFICPESLRYQACLPACTA-------PSCPNQEFEYDAGQCSGLAEGCVCPQGTLLHRPYSALCIPPNKCACTDSFGAPRALGEVWKASVDGC-CMSGV 2718          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: ENSAMXT00000019204.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001825.1:10421:34530:-1 gene:ENSAMXG00000018303.2 transcript:ENSAMXT00000019204.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 381.719 bits (979), Expect = 4.813e-108
Identity = 319/1151 (27.72%), Postives = 487/1151 (42.31%), Query Frame = 2
Query:  302 CTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNG--DDKFETVDA----SMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTP------EFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDC--IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGG---------CQRTCRDMNLICDPNSCEPGCYCESGEVYDN-NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE----LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC-----PPD--REYKPCEKVCPETCI 3622
            C+      +KTFD     Q        LV  C      + + V   E   +   +   +TI  +      A  L+   V V +     P+  A   +     Y+ +     L++ +NK  ++ V        Q CGLCG ++G    ++      A    S  P  ++L   K W S +  + + P+P IQ    D                     C++    +++    C  + + +   S       +WR K D     CP  M +S+ G+ C + C   +  + C +    GCYC     +       C   ++C C++         Y  GD +    + C+C   G W C++       C +    HF TFD +     G+C YI     E ES    L  ++    C + E  TC K + +L     N   + IK    V  N  L T+P        I VF+ +S  + ++   G    V      ++ + L   Y  K  GLCGNFN    D+   P G      S  A  ++    C      +S    C  +I+    A   C K    +G F  C + V  + +  +CK+  C C       T NC C  +S+Y R C+ KGI  Q WR        E CP     +   + C  +C +     +RP C N    +DGC CPD +  E + G CV ++ C C + G      +    +   C C NG  +C +   S    CP  KV+ +C           C +TC    + C    C  GC C SG + D    C+P+  CPC      +   + IT    +C  +CTC+ GKW+C +  C G C  +G  HY +FD + F F GDC Y+  ++ C  K+GTF ++ ENV CG+ GT+C+KS+R       + LI G           +  L +G   K+   +  + +  E    L + WDR+ +V + L P++   VCGLCGNF+ N  +D   +  +  +DV  FA+SWK+ + CP      +PC     R +WA  +CSI+  +TF+ CH+ V    Y+D CV+DSCACD G DC C CTA++ Y   CN   + + WR  E CP+ C     P +    Y PC   C +TC+
Sbjct:    4 CSMWGNFHFKTFDG-DVYQFQGICEYNLVSHCHGSVQDFSVHVKRSEFTGDSKINRVLVTIGDM------AIKLTKNLVMVNDDVVKLPHYVAGVLLEQYATYIKLYAKLGLSVMWNKDDAVMVELEAKYTNQTCGLCGDFNGMAILNEFISEAQACDYSSQRPGCSELLEDKAWKSCT--SIVSPEPYIQACVVDR--------------------CWSRPGDIEDSLPLCTTLSEYSRQCSHAGGTPPNWR-KPDFCAVKCPYNMEYSESGSPCVDTCSHTDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKHNKV------YNSGDVLHMEDKECVCH-HGSWTCESLPT-PGLCAVEEGSHFTTFDGKEFTFHGECYYILSQDCE-ESKFTVLGQLIP---CVDHETDTCLKSVVLLPNNDKNNALV-IKDDGTVKQNGDL-TLPYA---SANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCRDR--SESLDDPCSYNIDSESYAEHWCSKLLEKEGPFAKCHSSVNPESYYKRCKYSTCTC-----EKTENCLCGVFSSYVRACTAKGIFLQGWRDTVCKKYTEHCPATQTFSYKLQGCQRTCDSLSL--ERPACINTYLPVDGCACPDGL-YENENGVCVALDKCSCYHNGERIKPGKSITIKNEHCVCTNGKLHCHSWKPSVMD-CPAPKVFFNCSEAGPEEHGLECAKTCAQKTVDCFLTGCTSGCQCPSGLLDDGRGHCVPQHNCPCKHNGHYYPPGSQITD---QCN-TCTCKQGKWKCTEEKCPGTCTIYGSGHYNTFDNRRFGFSGDCGYIAAQNKCGNKTGTFHVITENVPCGTTGTTCSKSVRIVLGKTQLDLIDGKVT--------NTDLESGTLIKYRVRNVGLYLAIEADIGLTVLWDRKTTVRIILQPQHMGEVCGLCGNFNGNGKDDFTTQGQLQVSDVLEFANSWKVNSHCPDAVPDFDPCSKAHNRHTWAKMQCSIITGKTFKECHSMVDPAPYFDNCVRDSCACDTGGDCECFCTAVAAYAQACNEAGVCVAWRTPEICPVFCEFYNDPLECLWHYSPCHTPCYKTCL 1084          

HSP 2 Score: 165.622 bits (418), Expect = 2.551e-40
Identity = 130/467 (27.84%), Postives = 212/467 (45.40%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCR--DMNLICDPNSCEPGCYCESGEVYDN---NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGT-SCTKSIRFYYKD--HIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK---ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC-PYPEISKNPCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNY------ENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCM--EGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            CP    + + G  C  TC   D +L+C+ +  + GCYC  G V+D+     CIP+ +C C   N+ +N   V+     EC     C  G W C      GLC     SH+ +FDGK F FHG+C Y+L +D    K   F ++ + + C    T +C KS+     +  +   +I+    +        PY    I         I++ T     +++Q    + + + L   Y+   CGLCGNF+  + ++L+   G+++   ++FA+SWK +++C    E   +PC  N   ES+A   CS L  K   F  CH++V  + YY +C   +C C++ ++CLC     S YV  C    I +Q WR+       E+CP       + + C++ C    +   +CI+  +  +GC C +  Y  ++        C+C     +  P  +  IKN H C C      C 
Sbjct:  236 CPYNMEYSESGSPCVDTCSHTDTSLLCEEHKMD-GCYCPPGTVFDDISDRGCIPQEQCQCK-HNKVYNSGDVLHMEDKEC----VCHHGSWTCESLPTPGLCAVEEGSHFTTFDGKEFTFHGECYYILSQDCEESK---FTVLGQLIPCVDHETDTCLKSVVLLPNNDKNNALVIKDDGTVKQNGDLTLPYASANIIVFRPSSFHIIVQTSFGLRMQVQLVPVMQLYITLDRSYQTKTCGLCGNFNMVLSDELKTPQGLVEGTASSFANSWKAQSNCRDRSESLDDPCSYNIDSESYAEHWCSKLLEKEGPFAKCHSSVNPESYYKRCKYSTCTCEKTENCLC--GVFSSYVRACTAKGIFLQGWRDTVCKKYTEHCPATQTFSYKLQGCQRTCDSLSLERPACINTYLPVDGCACPDGLYENENGVCVALDKCSCYHNGERIKPGKSITIKNEH-CVCTNGKLHCH 690          

HSP 3 Score: 98.5969 bits (244), Expect = 5.726e-20
Identity = 88/358 (24.58%), Postives = 144/358 (40.22%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGD--DCLCVCTAISQYVHECNRY-NIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            + +C  WG  H+ +FDG  + F G C Y L+  +C+     F + ++  E    G S    +     D  I L +    ++  +    P+   G+  +  Y + I +  K  L + W++  +V V L  +Y N  CGLCG+F         N   I++  ++                     CD +  R   +     +L+ + ++ C + V  + Y   CV D C    GD  D L +CT +S+Y  +C+        WR  + C + CP + EY      C +TC  T +   C    M+GCYC   T   D       P   C+ +  K Y  G  +     +C C    + CE
Sbjct:    1 DNVCSMWGNFHFKTFDGDVYQFQGICEYNLVS-HCHGSVQDFSVHVKRSE--FTGDSKINRVLVTIGDMAIKLTKNLV-MVNDDVVKLPHYVAGVLLEQ-YATYIKLYAKLGLSVMWNKDDAVMVELEAKYTNQTCGLCGDF---------NGMAILNEFIS-----------------EAQACDYSSQRPGCS----ELLEDKAWKSCTSIVSPEPYIQACVVDRCWSRPGDIEDSLPLCTTLSEYSRQCSHAGGTPPNWRKPDFCAVKCPYNMEYSESGSPCVDTCSHTDTSLLCEEHKMDGCYCPPGTVFDDISDRGCIPQEQCQCKHNKVYNSGDVLHMEDKECVCHHGSWTCE 323          
BLAST of Hemocytin vs. Ensembl Cavefish
Match: ENSAMXT00000041370.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:1809499:1822580:1 gene:ENSAMXG00000037407.1 transcript:ENSAMXT00000041370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 385.571 bits (989), Expect = 5.997e-108
Identity = 307/1090 (28.17%), Postives = 482/1090 (44.22%), Query Frame = 2
Query:  566 PYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGD-DKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNC-DLN---------EMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKE-IESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTP--EFCPVICPKNMVYKECGSSCSATCRLRQRPN--CDND--CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCT----TKDCSSQSYCPN--GKVWKDCGG-CQRTCRDMNLICDP------NSCEPGCYCESGEVYDNNK-CIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKS--GTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-PYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC----PPDR---EYKPCEKVCPETC---IGTKSCISDCMEGCY 3664
            P+  +   I     Y+ VK    L   +N+  ++ +        Q CGLCG ++G    ++F    A ++      D+  +W         +  P     NC D N           ++C  +VS+    F ++C  + CQ  +   S  L   +A  S          ++WR +  C    CP   ++ +CG+ C + C        C + C  GC+C  D  +       C     C C +   A     Y  G+     C+ C C S G W C    QC   C + G  H +TFD +     G C Y  V+ KE   +D   L  +V+   C  ++  TC K + +    G N     +    E+ IN     I        +IS+FK +S  + I+   G    +      ++ +    K+  ++ GLCGNFN    DD     G       + A  ++   +C    +++++   C  S E  K A   C       G F  C + +    +   C +D CNC       T +C C+A S+Y   C+ KGI  + WR    +   + CP  MVY    +SC  +CR   + +  C +    +DGC C +   + EK   CV    C C          E       TCTC  G  NC      ++C+S     N    V    G  C ++C+ +++ C          C  GC C SG V D+N  CI +  CPC     S+     +     +C  +CTC+  +W+C    C   C  +G+ HY++FD K + F+G+C Y L +D+C+  +  GTF+++ EN+ CG+ GT+C+K+I+ +   + + L  G+  ++ R+     PY    I +  +Y+  ++     + + WDR+ S+ + LTP++   VCGLCGNFD N +ND   R+  +  +   F +SWK   +CP   + + PC  N +RE+WA ++CSI+ S+ F  CH+ V    +Y  CV+D+CACD G DC C CTA++ Y   CN   + + WR  + CP+ C    PP      YKPC   C +TC    GT S     MEGCY
Sbjct:   98 PHLGSGVFIETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKDGAQLS----ATDYGNLWKMDGPTETCEEQPERVNENCGDENFCQNLFLSKAFSSCTDLVSV--EPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPM-KCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKA-----YASGEGYSSSCRECTC-SGGQWNC-VDKQCPGTCSVEGGAHIITFDGKPYTFHGDCSY--VLSKECTGTDFTILGDLVK---CGITDSETCLKAVTLALSNGTN-----VSLSCELNINLLFKKIFRLTQTESDISIFKPSSFYIVIQTTIGLRLEIQLTPIMQVYITADPKFQGQMCGLCGNFNNIQADDFTTMGGLTEGTAVDFANTWKTRASCLD--VQRTFENPCSLSTENEKYAQYWCSLLSDASGVFSSCHSEINPATY-KNCIYDTCNC-----EKTEDCMCAALSSYVHACAAKGIYIKGWRDVACKSYTLSCPNTMVYSYNMTSCGRSCRSLSQTDFSCSSQFVAVDGCGCAEGTYLNEKE-ECVDPSGCPCYDSNTVIQPGETVSREGTTCTCKQGQLNCIGSGKVQECTSPMTYLNCSAAVPGSTGSECAKSCKTLDMACVSYHIKYTRGCVSGCVCPSGLVSDDNGGCITEDLCPCVHNGASYKPGETVKE---DCN-TCTCKDRRWQCTTNQCSATCSIYGDGHYITFDDKRYVFNGNCEYTLAQDFCSSSNTNGTFRVITENIPCGTTGTTCSKAIKLFIGSNELVLSDGSYQVVQRDAGQEIPYQ---IRTMGNYL--VIETNNGVVLIWDRKTSMYIKLTPDFNGRVCGLCGNFDGNANNDFTTRSQELVVNALDFGNSWKFSPTCPEAMVVQEPCAHNPYREAWAQRQCSIINSDVFSACHSKVDPASFYSACVRDACACDTGGDCECFCTAVAAYAEACNAVGVCVAWRTPKVCPLFCDYYNPPGECEWHYKPCGAPCMKTCRNPAGTCSLQLPAMEGCY 1145          

HSP 2 Score: 104.76 bits (260), Expect = 9.172e-22
Identity = 86/362 (23.76%), Postives = 151/362 (41.71%), Query Frame = 2
Query: 2774 LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVI-ENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVII--TKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFD--DNVDNDLRNRAGIIDADVNAFADSWKL----KTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIK-IQWRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            +C  WG  H+ ++DG  F     C+++L    C      F I +   VE G    S    I       ++ +              +P+LG+G+F   + +SS +++  T  L   W+   ++ + L  ++ N  CGLCG+F+     +  +++ A +   D   + + WK+    +T    PE     C    F +       ++  S+ F  C + V  + +   C++D C C+      C+C  +++Y  +C     +   WR    CP+ CP  + Y  C   C +TC      + C   C++GC+C ++T   D       PL  C     GK Y  G     +C +CTC    + C
Sbjct:   28 VCSTWGNYHFKTYDGDVFQLPSTCNHILTSQ-CRGSYEAFNIQLRRQVENGEPTIS---KITMKLDGTVVDV-------------KAPHLGSGVF--IETISSYIMVKATVGLTAMWNEDDALMIELNAKFINQTCGLCGDFNGVPTYNEFIKDGAQLSATD---YGNLWKMDGPTETCEEQPERVNENCGDENFCQ-------NLFLSKAFSSCTDLVSVEPFTKVCIEDLCQCNSSAGSSCLCDTLAEYSRQCVHAGGQPANWRTEHFCPMKCPESKVYMECGSPCMDTCSNPERGQVCGEHCIDGCFCPSDTVFDDVTNTGCIPLSNCSCIHGGKAYASGEGYSSSCRECTCSGGQWNC 360          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010519.1 (pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 gene:ENSPMAG00000009527.1 transcript:ENSPMAT00000010519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 382.489 bits (981), Expect = 6.556e-111
Identity = 305/1101 (27.70%), Postives = 473/1101 (42.96%), Query Frame = 2
Query:  521 LSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSI-FGSKFEEICYAEFCQMKNQKNS----CELMRDIAFLS----SPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQI-DSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEA--GDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRT------PEFCPVICPKNMVYKECGSSCSAT----CRLRQRPNCD---NDCIDGCQCPDDMVIEEKTGNCVKVEDCKC--EYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDC--------GGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNN-KCIPKGECPCFWQNQSFNESAVITRGPFECQL--SCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS-CPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP--------DREYKPCEKVCPETCIGTKS-CISDC--MEGCY 3664
            L+ +G  +       PY     QI   G Y+    I   ++ +++  +I V        +  GLCG ++G  DD +      +N + T        L+         +P   + +   +E+ +C  V+     S    I +++ C++     +    C+    IA  S      +     WR    C    CP   +  +CG+ C + C   +  V+C   C  GC+C +              C  +      Q+  SY  G+ +  GC+NC CE +G W CD+   C   C I G  +F TFD++     G C Y        +    + S++ E   C   +  TC   + I + +G+    +  K+  +V+++   V +P        +++ + +S  L+ E   G    V  K   ++ +  +  Y  K  GLCGNFN +   D+    G      +     ++   TC      +  +  C   I   + A   CG      G F  C ++V +D++ T+CK+D C+C          C C+A SAYA  CS  G+    WR+       E CPV    +    ECGS+   T    CR  + P  +      ++GC C   +  +E  G CV   DC C  E  G    A          C C  G  +C      S + C     + +C          CQRTC + + IC    C  GC C  G + D+N  C+ + +C C    + ++    IT      QL   CTC + +W C    C+GLC  +GE H+ +FDGK + F G C Y+L +D C   SG+F+I  EN  CG+ GT+C+K + FY     + L  G       +   SP+       +   + ++V  +  + I WD   +V V + P+ K  VCGLCG++D  V ND   R G + A    FA  WK   S CP      +PC IN  RESWA K+CS+LK   F+ CHN V Y  YY  CV+DSC CD G DC C+CTA++ Y   C    + ++WR  + CP+ C          +  Y+ C + C  +C    + C ++   +EGCY
Sbjct:   66 LTREGQSISGQRVQLPYKDHSIQIEMVGSYIKCSSIMGFSLLWDQNNAITVKLDPKFNTKTTGLCGDFNGIADDFY------LNVMSTTSVLFSFLLTCD-------EPTQHIEHLFEDELLSCVSVMDHQLKSLLVNILWSDICRLDCNGTAGLYPCDGCATIAEFSRRCTQANESPGTWRSPEFCGV-TCPRGQVHRECGSVCKDTCSNPSASVNCPSTCVDGCFCPEGTAGTVWDDVSGSGCIPQSNCGCNQLGQSYASGESLITGCKNCTCE-QGQWNCDSR-PCYGTCKILGGSYFSTFDSKTYRFHGDCFYTLT----TDCAGNKFSVLGELTKCEGRDSKTCLNSV-IFYIDGIRT--VVFKASGDVLVHENKVPLPFV---SASVTIVQESSFYLRAETNFGLRLRVQLKPLMQLYITAATAYHNKTCGLCGNFN-EVTGDDFTHSGIVDATAATFCNVWKAQATCPDR--EEVTMDPCSVYITNNEYAKAHCGLLMDNDGPFSTCHSVVSADEYYTRCKYDTCSCSYPEP-----CLCAALSAYAYACSAHGVVLVGWRSDICSLDAENCPVSHEFSYAAPECGSASCRTSREVCRGVRPPPFELPSPSPVEGCVCGAGLYDDEH-GVCVLKSDCPCYSEMSGDLIRAGVTVDLHDTQCLCTGGELHCFGLSPISGNTCEGLMTYHNCSDGSSEGSAACQRTCANPHSICYSPGCVSGCVCPGGLIVDHNGNCVSEEQCTCEHNGRHYDPGDTIT------QLCNKCTCMNARWSCTSEVCQGLCFVYGEGHHTTFDGKQYVFDGSCQYILSQDSCGNSSGSFRITTENEPCGTTGTTCSKKVHFYAGADELVLTDGTVKGSSLDFPGSPF-----HVRRMGIYTVVETSLGVTIIWDGHTAVSVHVNPQLKGRVCGLCGDYDGKVANDFVTRTGSVAASAPEFAAGWKESGSGCPDLSRVSDPCTINHHRESWAHKQCSVLKDGVFKQCHNMVEYLPYYAACVRDSCGCDTGGDCHCLCTALASYAQACGSAGVCLRWRTPDLCPLGCDLYNKDEGQCEWHYRECGRGCQRSCTNRNAICTANLPPLEGCY 1120          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008773.1 (pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1 gene:ENSPMAG00000007891.1 transcript:ENSPMAT00000008773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 387.882 bits (995), Expect = 3.801e-109
Identity = 340/1234 (27.55%), Postives = 511/1234 (41.41%), Query Frame = 2
Query:  302 CTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIK-DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP-----AIQMVNCDL----NEMATCAKVVSI---FGSKFEEICY-----AEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDC--EEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFW---YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTS--DGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCG--KFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVI---CPKNMVYKECGSSCSATCRLRQRPNC----DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCG---------GCQRTCRDMNLICDPNSCEPGCYCESGEVY-DNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKS--GTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPI--IGRNP-TWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC----PPDR---EYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKP-------LCTCKDESGKEYPLGTTVIKNCHKCTCQINGFE 3814
            C+      +KTFD  K      + N +   +C    P + +I+        +S ++ +I              LS++G  V   S   P+++   QI   G  V +        +F+NKK S+ +    + + + CGLCG Y  NGD ++      +  +       K +  + + ++++  P     ++    C+L     E A C   + +    G+   + C       +F  ++     C   R I    +P N    WR   +     P C    I+ +CG  C N C   +    C + C PGC+C +   W       C   +EC C +        +Y  GD + + CQ+C+C   G+W C+    C+  C + G  H  TFD       G C Y   M    +      +++V+ K C      TC K + ++ G   N  +I I    EV +N   V +P   N    I++F  +S    L    G    V      ++ L L   +     GLCG++NG   DD    +G         A  ++   TC      +S    C  S+   + A ++C   K   G F  C   V  + F  +C +D C+C       +  C C+A S+YA  C+ K +  +      C      CP + VY      C  TCR+ Q            +DGC CP     +   G C+  E+C C Y G         +     C C  G   C      +   CP+  V+ +C           C +TC      C    C  GC C  G VY D+  CI    CPC    Q       I     +C  +CTC + KWEC    C   C  +G+ HY +FDG+ F F G C+YV+ +D C   +  GTF I  ENV CG+ GT+C++SI     + +I L + +  I  +G  P T +P+       KH  +  +V  +  + + WD+   V + L PEYK  VCGLCGN D    NDL  R  ++  D   F +SWKL   C   + + +PC +   R  WA +RC ILKS+TF  CH  V    +++ CV D+C CD G DC C+C A++ Y   CN     I+WR  + CP+ C     PD     Y+PC + CP+TC   +   ++C EG       Y K   C   KP       LC   D  G     G +   N   C C  NG +
Sbjct:    1 CSTWGQNHFKTFDG-KFFDLGISCNYLFASNCKDATPNFNVII-------RRSVNNPQIISSINISIIDINIDLSAEGAAVNKESQDLPFNQYGIQIIALGDDVKITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDY--NGDAEYPEFKGGILSVAEYALNNKYYDPMVQCDQIEQPPTPDDCSMHESLCELVLNTPEFADCKARLDVRPYIGACIVDQCSCTSDCPDFGTVEEYSREC---RSIG--GTPGN----WRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKH-----TYNAGDILHQDCQDCVCHG-GVWNCE-EQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAM----DCRTHLFNLMVKLKPCETKN--TCLKSLALILGR--NVLKIMISDSGEVSVNDVEVNLPYDSNA---ITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPT--ESTEEPCMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCSC-----QDSEACLCAALSSYALACASKHVVLEGWREHLCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKG-TYDSGGGFCMAPEECPCYYRGNVLPLGNSVQQGKYICECRAGTMLCMNPQGPTPQPCPHPMVYFNCNQSTANGNSFPCHQTCSLQE--CYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIE---VDCN-TCTCVNRKWECTNNTCLSTCSLYGQGHYRTFDGQRFLFEGSCTYVIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSGPETINPFQ-----IKHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMVVEDPLEFGNSWKLSGLCADAKETSSPCALMSHRLPWAQQRCGILKSDTFASCHALVDVLPFHEACVHDACGCDTGGDCECLCNAVAVYAKACNEAGQCIKWRTPDLCPLFCEYYDAPDDCTWHYRPCGQSCPKTC---RDPHAECREGVQRFEGCYPK---CTESKPYFDEDNMLCVSWDSCGTCSESGISCQYNRSVCFCTHNGIK 1172          

HSP 2 Score: 184.496 bits (467), Expect = 9.931e-47
Identity = 141/526 (26.81%), Postives = 231/526 (43.92%), Query Frame = 2
Query: 2309 CPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCG-GCQRTCRDMNL--ICDPNSCEPGCYCESGEVYD---NNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS--PYLGTGI---FSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYP-EISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNY------ENCPIMCPPDREYKPCEKVCPETCIGTKSCISD--CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            C   + +    G C+ V+ C C     D+   EE    C +     G W  T++ C +   C  G ++++CG  C  +C   +L  +C    C PGC+C  G ++D   +  CIP  EC C +   ++N   ++ +   +CQ  C C  G W C ++ C   C   G SH  +FD   F FHGDC Y +  D    ++  F ++++   C +K T C KS+      +++ ++   +  +  N      PY    I   +    Y+     I   L +Q    + + + L P +    CGLCG+++    +D +   G+I+     FA+SWK + +CP P E ++ PC ++   + +A   CS +K+    F  CH TV  + +Y +C+ D+C+C   + CLC   A+S Y   C   ++ ++ WR +      ENCP          PC   C         C S    ++GC C   TY            C C    G   PLG +V +  + C C+     C
Sbjct:  197 CKARLDVRPYIGACI-VDQCSCTSDCPDFGTVEEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCI-EECVPGCFCPRGTIWDDLTDKGCIPLEECSCVFNKHTYNAGDILHQ---DCQ-DCVCHGGVWNCEEQPCTRTCALEGGSHIKTFDQNQFTFHGDCYYFMAMDC---RTHLFNLMVKLKPCETKNT-CLKSLALILGRNVLKIMISDSGEVSVNDVEVNLPYDSNAITIFYQSSFYIHLHTSIGVNLLVQLSPVMQLYLTLDPSFHTATCGLCGDYNGIQSDDFKTSNGLIEGTAIYFANSWKAQNTCPPPTESTEEPCMLSLNHKQYAEDMCSNMKTPDGPFSACHGTVSPEAFYKRCLYDTCSCQDSEACLCA--ALSSYALACASKHVVLEGWREHLCAKYTENCPGSQVYSYNALPCVNTCRVLQETGSQCFSSGVAVDGCTCPKGTYDSGGGFCMAPEECPCY-YRGNVLPLGNSVQQGKYICECRAGTMLC 709          

HSP 3 Score: 115.161 bits (287), Expect = 1.191e-25
Identity = 104/381 (27.30%), Postives = 154/381 (40.42%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVE-CGSKGTSCTKSIRFYYK--DHIIHLIRGAAPI--------IGRNPTWS----PYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK-TSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM--------------EGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            C + +CE +C AWG+ HY +FDG ++ F  DC+YVL+E         F++ + N   C   G +C +SI   Y   + I+   +   P         +G  P +S        +GI ++ D      +IT E  +++   L    F      NN  G CG   +N  +D R R G++D      A  WK+   SC     S  P D+           C+++ S+ F  C   +  Q +   C  D CA  R DD  C+  +I  Y  +C    I + WRN+ N  C   CP  + Y  C    P TC  T+      +              EGC+C   T L + +       C C   +G     G   I NC  C C
Sbjct: 1323 CIRYECECICSAWGDPHYTTFDGTYYTFTDDCTYVLVEQIIPVLPD-FRVTVNNFRGCSGGGPACPRSITITYNGTNVIMETSQRKKPTRLFVKFNGVGVTPVYSENGMTVASSGISTRVDIPEIEAVITFEY-VRFSITLPYKFFF-----NNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKVPDPSCKTNPSSSPPPDVTCPPHPL----CNLIGSDLFAECKRVIDPQPFVMGCQFDWCA-TRKDDIPCL--SIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNACGPSIPPTC-DTRLVWQSYLCYYKNFVYWLTMEDEGCFCPEGTILHNSQTDICTTSCGCTGPNGYPKQYGDRWISNCLDCVC 1688          

HSP 4 Score: 85.5001 bits (210), Expect = 1.188e-16
Identity = 91/364 (25.00%), Postives = 144/364 (39.56%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPY--LGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADS-WKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRY-NIKIQWRNY-ENCPIM--CPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTY---LKDDECVSEKPLCTCKDESGKE-YPLGTTVIKNCHKCTCQINGFECEKE 3826
            C  WG++H+ +FDGKFFD    C+Y L    C   +  F ++I      S       S        I   +      + +     P+   G  I +  D V  I       K+ W+++ S+ + +T  Y+N  CGLCG+++ + +     + GI+     A  +  +     C   E    P D +       +    +L +  F  C   +  + Y   C+ D C+C    DC    T + +Y  EC         WRN  E C     C P   Y+ C   CP +C     +  CI +C+ GC+C   T    L D  C+   PL  C     K  Y  G  + ++C  C C    + CE++
Sbjct:    1 CSTWGQNHFKTFDGKFFDLGISCNY-LFASNCKDATPNFNVIIRR----SVNNPQIISSINISIIDINIDLSAEGAAVNKESQDLPFNQYGIQIIALGDDV-KITATNIGFKLFWNKKDSLLLQVTESYRNKTCGLCGDYNGDAEYP-EFKGGILSVAEYALNNKYYDPMVQCDQIEQPPTPDDCSMHESLCEL----VLNTPEFADCKARLDVRPYIGACIVDQCSCT--SDCPDFGT-VEEYSRECRSIGGTPGNWRNTSETCGAAPECLPGTIYQECGIPCPNSCSQPSLSNMCIEECVPGCFCPRGTIWDDLTDKGCI---PLEECSCVFNKHTYNAGDILHQDCQDCVCHGGVWNCEEQ 347          

HSP 5 Score: 72.0182 bits (175), Expect = 1.518e-12
Identity = 71/316 (22.47%), Postives = 121/316 (38.29%), Query Frame = 2
Query: 1352 QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILF-GEGLNQTEIEIKSKTEVIINSKLVTI-PSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVT-GLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGK------IANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR--TPEFCPVICPKNMVYKECGSSCSATCRLR 2266
            +C   C   GDPH+ TFD  +      C Y+ V  ++I   +P   + V N    +     C + I I + G  +     + K  T + +    V + P     G+ ++   +++   +++  ++ +V   +  R  + L  K+    T G CG    + +DD  M +G   K    +A  +++                C+T+             + +C   G   F +C+ ++    FV  C+ D C           +  C +  AYA  C  +GI   WR  T   C   CP   VY  CG S   TC  R
Sbjct: 1327 ECECICSAWGDPHYTTFDGTYYTFTDDCTYVLV--EQIIPVLPDFRVTVNNFRGCSGGGPACPRSITITYNGTNVIMETSQRKKPTRLFVKFNGVGVTPVYSENGMTVASSGIST---RVDIPEIEAVITFEYVRFSITLPYKFFFNNTQGQCGTCTNNRQDDCRMRNGVVDKSCVNMARDWKVPDP------------SCKTNPSSSPPPDVTCPPHPLCNLIGSDLFAECKRVIDPQPFVMGCQFDWC------ATRKDDIPCLSIKAYASQCLDRGICVDWRNFTNNRCSYTCPIGKVYNACGPSIPPTCDTR 1619          

HSP 6 Score: 55.8398 bits (133), Expect = 1.326e-7
Identity = 65/256 (25.39%), Postives = 103/256 (40.23%), Query Frame = 2
Query:  128 SGKKCNEPVCEKGC---------GPGKCIEPNICDCRETNRFGQQCERFGAEVAS---VSQNIELTDQ---AQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDC-EITIKFLFKDSIEATYLSSQGVKVGNI-------SYSF------PYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW 808
            S ++C  P C  GC           G CI+P  C C    +     E    +  +   V++  E T+    + C+      Y+TFD  + +   F G+            TY   VI Q++C N +++    IT + +   +   T   S  V+VGN        SYS       P +   FQI  RG Y+ V+    + + ++K   +F+      K  VCGLCG +DG   +   T    +  +E  L+F   W
Sbjct:  746 SLQECYNPECNSGCVCPKGLVYSDDGTCIQPEACPCEHNGQKTAPGESIEVDCNTCTCVNRKWECTNNTCLSTCSLYGQGHYRTFDGQRFL---FEGSC-----------TY---VIAQDNCQNPNNEGTFNITTENVPCGTTGTTCSRSINVQVGNWVIKLFQKSYSIDFLGSGPETINPFQIKHRGLYLVVETSNRITLTWDKNTGVFISLGPEYKGTVCGLCGNHDGRAANDLTTRTHMV--VEDPLEFGNSW 982          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 333.954 bits (855), Expect = 2.934e-99
Identity = 209/636 (32.86%), Postives = 304/636 (47.80%), Query Frame = 2
Query: 1748 RIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGL---CETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNC-TTKDCSSQS-YCPNGKVWKDC-GGCQRTCRDMN----LICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVL--------------LEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRF-YYKDH-----IIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRN-RAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENC 3556
            R+ +    +    V GLCG F  D  DD +   G    +     AR+++ Q         + L L   C T  +    A E C K     F  C   V  D F   C ++VC  G L  A     EC  ++ YA IC+ +G+    WR    C V CP +MVY++C SSC +TC  L    +C  +C +GC CPD ++++    +CV    CKC Y   +Y      +  C  CTC  G W+C +++ C   S  CP    W  C   C  TC +MN      C   +C+ GC C +G V+D +KC+    CPC+   QSF     IT    +C  +C C    WEC  + C G+C  +G+ HY +FDG+ +DF G+C YVL              L D  +  +  F + +ENV CGS G +CTK+I   Y++ H      I L+RG   +   +PT     G  I  +   +   V     + IQWD    + + L P+Y   V GLCGNF+ + ++D     AG  +   N F DSWK+   C    +  + C  +  R +W+ ++C +L+S  F  C   V    Y D+C+ D+C CD G DC C+CTAI+ Y +EC+   + I+WR+ E C
Sbjct:   17 RLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCTAGALTGA-----ECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSSTNYAPGSILQMGCKNCTCEYGGWSCWSSEGCVDDSGLCPENMQWSPCKSSCPVTCGNMNNPSLSSCITETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQSFQTGQSIT---LDCN-NCVCNGQVWECEHKRCPGVCSVYGDPHYKTFDGRAYDFQGNCQYVLARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPCGSSGVTCTKNIGLKYWRAHNGDIFKIDLVRGKNVV---DPT-----GNFIIRRAG-LYLFVDTPIGVSIQWDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVINDTCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDACGCDSGGDCECLCTAIAAYAYECSANGVPIEWRSDELC 634          

HSP 2 Score: 137.502 bits (345), Expect = 2.836e-33
Identity = 100/367 (27.25%), Postives = 157/367 (42.78%), Query Frame = 2
Query: 1148 SKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIES---------------DMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSK--INKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSEL-AARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFC 2194
            ++ C  GC C     W  ++C +   CPC +        S++ G  +   C NC+C  + +W+C+ H +C   C + GDPH+ TFD +    +G CQY  V+ + I S               D     + VEN  C  S  +TC K I + +    N    +I      ++  K V  P+   I +   + +F  T  G+ I+            +R+ + L  KY   V GLCGNFNGD  DD + P   P ++   +    +++   C   V+       C T       +   CG      F DC+ +V    +V +C +D C C    +     C C+A +AYA  CS  G+  +WR+ E C
Sbjct:  297 TETCDAGCECSTGLVWDGSKCVQPANCPCYHGGQ-----SFQTGQSITLDCNNCVCNGQ-VWECE-HKRCPGVCSVYGDPHYKTFDGRAYDFQGNCQY--VLARTIYSLIDYSSLNLTDMGDVDNDGFVLTVENVPC-GSSGVTCTKNIGLKYWRAHNGDIFKID-----LVRGKNVVDPTGNFIIRRAGLYLFVDTPIGVSIQ--------WDYSTRLYIRLHPKYMGLVEGLCGNFNGDQNDDFVTPAAGPPEEMPNIFGDSWKVHAYCAPAVVIND---TCLTHPHRAAWSQRKCGVLRSSLFADCQGVVAVAPYVDRCLYDACGC---DSGGDCECLCTAIAAYAYECSANGVPIEWRSDELC 634          

HSP 3 Score: 99.7525 bits (247), Expect = 2.871e-21
Identity = 74/257 (28.79%), Postives = 109/257 (42.41%), Query Frame = 2
Query: 3083 VIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK----TSCPYPE--ISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHEC-NRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDD--ECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            V +   ++I WD    + V   PE +  V GLCG F  +  +D   RAG ++ +V AF   WK+      SCP        +PC+      S A + C+ L ++ F  CH  V    +   C  +   C  G      C   + Y + C +R  +   WR   +C + CP D  Y+ C   C  TC      + C  +C EGC C +   L  D   CV ++  C C   S   Y  G+ +   C  CTC+  G+ C
Sbjct:    2 VTLDNGMRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVEIEVWAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYE--VCTAGALTGAECKTFADYAYICASRGVVLANWRLLLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCV-DQSQCKCS-YSSTNYAPGSILQMGCKNCTCEYGGWSC 254          

HSP 4 Score: 59.6918 bits (143), Expect = 7.060e-9
Identity = 63/262 (24.05%), Postives = 108/262 (41.22%), Query Frame = 2
Query:  635 LNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMA--------TCAKVVS---------IFGSKFEEICYAEFCQMKNQKNS-CELMRDIAFL-SSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFF--WYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQC 1357
            + I ++    ++V AP  ++  V GLCG +  +  D F T    +  IE    F   W          P+     +    N  A        TC K+++         +    F++ C  E C       + C+   D A++ +S   ++++WR  LDC    CP  M++  C ++C + C   ++  DC + C  GC C       +    C    +C C Y ++     +Y  G  ++ GC+NC CE  G W C + + C
Sbjct:    8 MRIVWDGVRRLYVTAPPELEGTVAGLCGTFTRDQRDDFMTRAGDVE-IEV-WAFTARWKVAQGATNSCPEANSLALASPCNTYAQLNSAAQETCNKLMNDPFNLCHTRVNPDAFKKDCTYEVCTAGALTGAECKTFADYAYICASRGVVLANWRLLLDCTV-TCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSST-----NYAPGSILQMGCKNCTCEYGG-WSCWSSEGC 260          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008716.1 (pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-1 gene:ENSPMAG00000007851.1 transcript:ENSPMAT00000008716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.755 bits (909), Expect = 1.415e-98
Identity = 341/1249 (27.30%), Postives = 544/1249 (43.55%), Query Frame = 2
Query:  287 TDQAQCTYLNGRSYKTFDRVKTVQTNFTGN--MVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNI-FYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDF----IKIWLSVSREN-RMKPDPAIQMVNCDLNEMATCAKVVS--------IFGSKFEEICYAEFCQMKNQKN-SCELM----RDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWY---KNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIE----LVLSAKYARKV---TGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCH--GEVLRQSYLGLCETSIEWGKIANEVCG--KFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVI-CPKNMVYKECGSSCSATCRLRQRPNCDNDC------IDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCT--TKDCSSQSYCPNGKVWKDCGGCQRT--CRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSC-----TCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYC--NKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTG-IFSKHDY-VSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMC----PPDR---EYKPCEKVCPETCIGTKSCIS----DCMEGCY--CKNNTYLKDDECVSEKPLCTCKDESGKE-YPLGTTVIK--NCHKCTCQINGFEC 3817
            + QA CT   G  +KTFD        F+ N   +  QDC S    + I +         S    E   + LFK   +    ++  V   N   + P+S  +  I   G  V +   + L I  Y    +  V A    ++Q+CGLCG +DG+      TV  S + ++  L F    +  ++  S+ +  +K  PAIQ           C  VV+        +    +  +C  E CQ  +     C  +    R+ +    P   + +WR    C   +CP  + + +CG+ C   C   +    C + C  GC C          +  C   +EC C Y        +Y   DK+   C +C CE+ G W C T   C   C +    HF TFD++     G C Y   + K+    +  L   +E     N  D+    G      +      +E KS  ++I +   V++P  I+  V+I  F+ +S  ++++      +  ++   ++    L+ S  +   V   TGLCGNFNG   DD +   G      +  A  +++   C   G V+R      C+ +    K A   C   +     FKDC  LV    + ++CK D C+C      S  +C    + +YA  C+ KG+ F+ WR      ++ CP   VY    ++C+ TCR     + D  C       +GCQC + +   ++ G CV    C C   G      E+       C C  G   C+   K+     Y P     ++     R   C  +  +     C+PGC C  G + + N     G+C     N   +   ++  G  E Q  C      C SG W C +  C+  CK +G+ HY +FDG+ F F G+C YV+ +D+C  + K GTF+I+ EN+ CGS  T C+KSIRF+ ++  I L  G   I   + + S   G+  +F+ H   +  IV  +  +K+ WDR+ S+ +   P+ +N +CGLCG ++ ++ +D   R   + A    F +SWK   +C       +PC++N +R++W+ ++CSILK++ F+ CH+ V +  +Y+ CV+DSCAC+ G DC C CT+++ Y   C      + WR  + CP+ C     PD     Y+PC  V  +TC G  + I       +EGCY  C   T   D+  ++   +  C  E G +  P   TV+    C  CTC +   EC
Sbjct:    1 SQQAVCTTWGGGFFKTFDEAFF---KFSSNCSYMFFQDCRSSYEEFNIKI---------SHGANEQFSEILFKIDTDVAQFANGKVSFNNRILTLPFSNNKILIQTHGSGVKL-AFRQLEISAYLNDDAFTVVAGDEFRQQLCGLCGNFDGS-----STVTTSYSRLKMLLSFSAYEVLFFVKCSQLHLNLKTLPAIQQYLIQPKSSGKCTAVVTSSCKGSCGLNQEGYAAMCAIEKCQCGSATTCGCAALSAYSRECSLQYKP---LPNWRSSQMCPPQDCPGNLEYQECGSTCPPTCANMDPS-KCQEPCVAGCVCPSGTVLSAINEETCIAPEECRCNYNGI-----TYDASDKITIDCNSCTCEA-GSWTCTTR-LCPKACSLESGAHFNTFDSRSYTFHGVCSYYLAV-KQAHVALRALGQKLECS-AKNPSDL----GSISSLTDKKRIRSLEFKSNGKIISSQMSVSLP-YISDSVKI--FRKSSMFIQVDTSYGMMMLVQNSPTMQVYIGLIDSVMFRETVCTPTGLCGNFNGIASDDFMSSQGLVEGTAAAFANSWKVNPDCEDVGTVIRDP----CQLNTAVAKQAELRCAILRNSTAFFKDCHYLVDPYSYYSRCKQDACSC-----PSGQDCITETFLSYALACASKGLIFENWRKATDSQLVECPNAEVYSYNANACNQTCR--SLSSVDLACQESGLVAEGCQCAEGLFANDE-GMCVPAVSCPCYVNGDILKPGEKVTIADIPCYCREGQLLCSESKKEDHVDPYPPPPVAIQNISTLVRINECVVLYFLQLGRQCQPGCICPEGLINNGN-----GDC---VNNSPCSVCHLVMSGRKE-QCHCGASVYKCYSGSWNCTELQCDSTCKMYGDGHYTTFDGQRFQFDGNCEYVVAQDFCVSDPKVGTFQIITENIPCGSMST-CSKSIRFFLQNKEIKLADGKYEI--HDVSGSASKGSEEVFTVHTVGLYLIVKASNGIKLIWDRRTSLFIIAPPDKQNQLCGLCGKYNFDMSDDFTMRDHSLSASPLHFGNSWKASDACSDVTDEASPCEMNPYRKAWSERKCSILKTDVFDACHSQVDHIPFYEACVRDSCACNIGGDCECFCTSVAAYAEACTSAGQCVAWRTPDLCPVFCDYYNSPDSCTWHYRPCGIVNTKTC-GNPAGIDLGNFPQLEGCYPKCPAKTPYLDEHMMTCVSMDKCSCEMGSQIVPANGTVVNRDTCETCTCVMGNMEC 1186          

HSP 2 Score: 74.7146 bits (182), Expect = 2.995e-13
Identity = 85/382 (22.25%), Postives = 150/382 (39.27%), Query Frame = 2
Query: 2744 WECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKG-TSCTKSIRFYYKDHIIHLIRGAAP---------IIGRNPTWSPYLGTG-IFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGII-DADVNAF-ADSWKLK-TSCPY----PEISKNPC-----DINKFRESWAIKRCSILKS-ETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYEN--CPIMCPPDREYKPCEKVCPETCIGTKSCISDCM--EGCYCKNNTYLKDDE---CVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            W+C   +C+  C+ WG+ HY +FDG+ + F  DC+Y L+E+  NK +  F ++++N     +   S  + I   Y  +  ++   AA          I        P++G G + + H+    + I      + +   +         + NN  G CG  ++   +D   ++G++ DA   A  A  W +   S P+        + PC         +  +     C I+ S   F  C        ++D CV D+CA     +  C    ++    +C      + WR+     C   C    EY+P       +C  + + I   +  EGC+C     + + +   CV E   C C    GK    G +   +C +C C
Sbjct: 1953 WKC---NCQ--CQGWGDPHYRTFDGQKYTFLEDCTYTLVEEKINKYA--FSVLVDNYYFYKQTPASFVRGITVNYNGNSANISLPAAKGRQTVINKVIFNGQAVAFPFVGKGFVITNHETQILVEIPAIGASVSFTGMMFTVDLPYSLFGNNTQGQCGTCNNARGDDCMRQSGVVEDASCCAVTAADWMVPDASKPHCRAKAPTGQKPCPSTTPTTRPYCTADTATICDIITSNRAFAGCAEATDLSEFFDSCVYDTCAVPTALEVGCASLQVA--AEQCAALGFYVDWRSLTRGMCQYNCSSGFEYQPIGPKEQLSCDYSGATIQTSILEEGCFCPKGMKMFNSQAQTCVVE---CGCMGPQGKPVMFGNSWQSDCKECVC 2322          
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005510.1 (pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-1 gene:ENSPMAG00000004964.1 transcript:ENSPMAT00000005510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.485 bits (711), Expect = 1.146e-75
Identity = 281/1168 (24.06%), Postives = 440/1168 (37.67%), Query Frame = 2
Query:  515 TYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLN-----EMATCAKVVSIFGSKFEEI------------CYAEFCQMKNQKNS-CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGCQNCLCESRG-----LWKCDTHDQCS-------------SRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKD-DSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQS-YLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRP-NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENV---ECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL-------------KTSCPYPEISKNPCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS-----CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIK-NC-HKCTCQING 3808
            T    + V V  +  + P+  +   I   G YV ++   +L + ++    + +  P     Q+CG+CG ++G+G D     D S     ++L     W   +  +    D   ++  CD N     E  T   +++     F+E             C  + C       S C+ ++  A   +   ++  WR    C  P C     +  C   C   C   N    C++ C  GC C   F    ++C   D+C C +       I    F  + +   Q C+C + G      W C+  + C                C+ITGDPH++TFD       G+C Y A +P    S +P  ++   N+F   S  ++  K + + ++G         +     V+++   VT P     GV I +    S    +   D   V R D +  +E+V+  +YA ++ G+CGNFNGD  DDN+ PDG+ A   +EL   +R+  +   +    +  +  C+ + +    ++  CG     +G FK+C A++P   F   C  D+C              C A  AYA  C+  G+   WR   FCP  C     Y+ C   C ATC     P  C+  C +GC C D  V+      CV VE C C     D++                              Y P G+ W + G C R C                            C+  G+  C  ++    E  V           C+   G  +C  R+  G C   G+ HY++FD     F G+C+Y      CN+ S      +E       GS   S  K +      +   L +G   ++      +P  G     K     S V++  +  + +++D +  +++     Y N +CGLCGN++ N  +D     G +        DSWK              + SC   E     CD     E    K C ++   S  F  CH  +  + +   C+ D C     +  L  C     Y   C    I I WRN   CP+ CPP+  Y PC   CP TC    +       + C EGC C     L DD CVS +  C C D+    +      +  NC  KC C + G
Sbjct:  189 TLAKGRRVLVDGLRVTPPFFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELG--NSWRVFNSSDDDCQDDTGEIPPCDENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLCATGGDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFP-CEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWF--ESQDCSQRCICVNPGNVNCGAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGH-----RFTLAKGRRVLVDGLRVT-PPVFMSGVYIQL----SGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELGNSWRVFNSSDDDCQDGTGEIPPCDENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLC-----ATDGDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATCSNASLPGGCNQQCAEGCVCDDGFVLSGD--KCVPVELCGC----LDFD----------------------------NQYHPLGESWFESGNCSRRC---------------------------TCLGAGDVHC--EDWECEEHEV-----------CSVEDGILDCYARE-PGDCVITGDPHYITFDKTTHHFMGECTYTAAVP-CNQSSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYGYRFTLAKGRRVLVDDKRVKTPIEGLVPGVKIGISGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKAEGDDDAGSTLWVGEVSCKPDEPHIPGCD--PINEEAYKKMCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMCQFHGMESTL--CDNFQAYAEACRAKGINILWRNETFCPLPCPPNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQGFVLSDDLCVSLE-ACGCWDDENNYHSFEEAWLSDNCKRKCVCSVPG 1255          

HSP 2 Score: 165.236 bits (417), Expect = 7.428e-41
Identity = 175/731 (23.94%), Postives = 289/731 (39.53%), Query Frame = 2
Query:  515 TYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEM------ATCAKVVSIFGS-----------KFEEICYAEFCQMKNQKNS-CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPC-----EYRASAKQIDSYKFGDKMKK----GCQNCLCESRGLWKCDTHDQCS-------------SRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIP-SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSR--IELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQ--------------GQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDND--CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEER--KDRC-NTCTC-INGLWNCTTKDCSSQSYCP--NGK 2506
            T    + V V  +  + P   +   I   G YV ++   +L + ++    + +  P     Q+CG+CG ++G+G D     D S      +L     W   +  +    D   ++  CD N+       + C  ++   G+            F + C  + C       S C+ ++  A   +   ++  WR    C  P C     +  C   C   C   +    C++ C  GC C   F    ++C   + C C     +Y    +    ++ G+  ++    G  +  CE    W+C+ H+ CS               C+ITGDPH++TFD       G+C Y A +P    S +P  ++   N+F   S  ++  K + + ++G         +     V+++ K V  P   +  GV+I +      G  +     F V  K D +  +E+   + Y  K+ GLCGN+N +  DD +MP+G  A   ++L   ++      G+    S L + E S +  +     C    +              G F  C A +  + F+  C +D+C    +   ST+   C  + AYA  C  KGI   WR   FCP+ CP N  Y  C S C ATC  +     C +   C +GC C    V+ +    CV +E C C     +Y++ EE    D C   C C + G  +C    C     C   NGK
Sbjct:  575 TLAKGRRVLVDGLRVTPPVFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELG--NSWRVFNSSDDDCQDGTGEIPPCDENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLCATDGDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFP-CEPGSHYESCAPPCPATCSNASLPGGCNQQCAEGCVCDDGFVLSGDKCVPVELCGCLDFDNQYHPLGESW--FESGNCSRRCTCLGAGDVHCED---WECEEHEVCSVEDGILDCYAREPGDCVITGDPHYITFDKTTHHFMGECTYTAAVPCNQSSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYG-----YRFTLAKGRRVLVDDKRVKTPIEGLVPGVKIGI-----SGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKA----EGDDDAGSTLWVGEVSCKPDEPHIPGCDPINEEAYKKMCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMCQFHGME--STL---CDNFQAYAEACRAKGINILWRNETFCPLPCPPNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQGFVLSDDL--CVSLEACGCWDDENNYHSFEEAWLSDNCKRKCVCSVPGNASCEAHSCVEHESCQLNNGK 1276          

HSP 3 Score: 161.384 bits (407), Expect = 9.462e-40
Identity = 131/481 (27.23%), Postives = 204/481 (42.41%), Query Frame = 2
Query: 1145 CSKVCTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGCQNCLCESRG-----LWKCDTHDQCS-------------SRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMP-QLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKD-DSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQS-YLGLCETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRP-NCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC-EYMGRDYNANE---ERKDRCNTCTCIN-GLWNCTTKDCSSQSYC 2494
            C++ C  GC C   F    ++C   D+C C +       I    F  + +   Q C+C + G      W C+  + C                C+ITGDPH++TFD       G+C Y A +P    S +P   ++   N+F   S  ++  K + + ++G         +     V+++   VT P  ++      V+   S    +   D   V R D +  +E+V+  +YA ++ G+CGNFNGD  DDN+ PDG+ A   SEL   +R+  +   +    +  +  C+ + +    ++  CG     +G FK+C A++P   F   C  D+C  G    +      C A  AYA  C+  G+   WR   FCP  C     Y+ C   C ATC     P  C+  C +GC C D  V+      CV  + C C +  G  +   E   E +D    C C+N G  NC    C     C
Sbjct:   27 CNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWF--ESQDCSQRCICVNPGNVNCEAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPPHFNVETTNEFRGGSTAVSYVKEVHVDVYGH-----RFTLAKGRRVLVDGLRVTPPFFMS-----GVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELGNSWRVFNSSDDDCQDDTGEIPPCDENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLCATGGDHGSL-----CQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGD--KCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETC 488          

HSP 4 Score: 158.303 bits (399), Expect = 8.591e-39
Identity = 130/490 (26.53%), Postives = 199/490 (40.61%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCRDMNLICDPNS-CEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRS------GKWECPKRD--------------CEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENV---ECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS----CPYPEISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTK---SCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIK--NC-HKCTCQING------FECEKELI 3832
            C  G  ++ C   C  TC + N     N  C  GC C+ G V   +KC+P  +C C   N  ++          +C   C C +      G W C   +                G C   G+ HY++FD     F G+C+Y      CN+ S      +E       GS   S  K +      H   L +G   ++       P   +G++ +      ++     L +++D    V++ +  EY   +CG+CGNF+ +  +D     G   A  N   +SW++  S    C        PCD N      +   C I+  +   F+ CH  +  Q+++D CV D CA D   D   +C A+  Y  +C +  + + WRN   CP  C P   Y+ C   CP TC        C   C EGC C +   L  D+CV  + LC C D   + +PLG +  +  NC  +CTC   G      +ECE+  +
Sbjct:  388 CEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCGAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIP-CNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPVFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNELGNSWRVFNSSDDDCQDGTGEIPPCDENDKDVYESDSFCGIIIDDEGAFKECHAVLPPQVFFDNCVFDLCATD--GDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATCSNASLPGGCNQQCAEGCVCDDGFVLSGDKCVPVE-LCGCLDFDNQYHPLGESWFESGNCSRRCTCLGAGDVHCEDWECEEHEV 873          

HSP 5 Score: 153.68 bits (387), Expect = 2.359e-37
Identity = 121/460 (26.30%), Postives = 184/460 (40.00%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCRDMNLICDPNS-CEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTC-RSGKWECPKRDCE-------------------GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIEN-VECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS----CPYPEISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTK---SCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTT 3766
            C  G  ++ C   C  TC + N     N  C  GC C+ G V   +KC+P  +C C   N  ++          +C   C C   G   C    CE                   G C   G+ HY++FD     F G+C+Y      CN+ S     F +   N    GS   S  K +      H   L +G   ++       P+  +G++ +      ++     L +++D    V++ +  EY   +CG+CGNF+ +  +D     G   A  +   +SW++  S    C        PCD N      +   C I+      F+ CH  +  Q+++D CV D CA   G D   +C A+  Y  +C +  + + WRN   CP  C P   Y+ C   CP TC        C   C EGC C +   L  D+CV     C C D +G  +P+G +
Sbjct:    1 CEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTDQCGCLDNNGHYHPIGESWFESQDCSQRCICVNPGNVNCEAWVCEDDETCGVEDGILGCHGSAPGDCVITGDPHYITFDKTTHHFMGECTYTAAIP-CNQSSTLPPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSELGNSWRVFNSSDDDCQDDTGEIPPCDENDKNLYESDTFCGIITDPEGAFKECHAVLPPQIFFDNCVFDLCA--TGGDHGSLCQALQAYADQCAQAGVIVTWRNNTFCPFPCEPGSHYESCAPPCPATCSNANPPAGCNQQCAEGCVCDDGFVLSGDKCVPTD-QCGCLDNNGHYHPIGES 456          

HSP 6 Score: 126.331 bits (316), Expect = 4.887e-29
Identity = 156/643 (24.26%), Postives = 251/643 (39.04%), Query Frame = 2
Query:  587 QISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDD-------KFETVDASMN---PIETDLDF-IKIWLSVSRENRMKPDPAIQMVNCD-LNEMA---TCAKVVSIFGS-----------KFEEICYAEFCQMKNQKNS-CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKV--CTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGC-----QNCLCESRGLWKCDTHDQCS-------------SRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSY---------LGLCETSIEWGKIANE-VCGKFGQ--GQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQ-FQWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVI 2329
            +I   G YV ++    + + ++ K  + +  P T   ++CGLCG Y+ NG D       K  T  A +      E D D    +W+    E   KPD    +  CD +NE A    C  V+S  G+            F + C  + CQ    +++ C+  +  A       I   WR +  C  P CP    ++ C + C   C     +  C     C  GC C + F    + C   + C C +   +    +     D  K+ C      N  CE+     C  H+ C              S C I+GDPH+ TFD +     G+  Y  V      +++  + I+ +NK   ++  ++    + I     +   +I+   + +  +N      PS   +G+EI     TS  + +      +V     S  ++ + + YA +V GLCGN NGD  D+   PDG+    +      + +       +  QS          L L  +  +W ++ N+  CG F    G F  C    P D + T C +D+C      N       CS+   Y   C  +GI    WR    C   C  + +Y E  S+C +TC  L    NC+   ++GCQC    V+
Sbjct:  987 KIGISGSYVLLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSAAQLGDSWKAEGDDDAGSTLWVG---EVSCKPDEP-HIPGCDPINEEAYKKMCEVVISTSGAFAKCHAEIDPEPFLKTCIYDMCQFHGMESTLCDNFQAYAEACRAKGINILWRNETFCPLP-CPPNTHYTPCASPCPATCSDIYAEDGCQSAARCAEGCVCDQGFVLSDDLCVSLEACGCWDDENNYHSFEEAWLSDNCKRKCVCSVPGNASCEAH---SCVEHESCQLNNGKESCQPVSYSTCSISGDPHYQTFDKRLYHFMGRETYTLVQSCGDNNNLLPIRILGKNKRVGHNHRVSFLDAVYIY----VYGFKIKFTDRKDFELNGVRTKPPSNPKEGLEIVH---TSHKMVLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSEDVFGNSWEVND--RRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCGVFHDPAGPFVQCWIPAPVDPYYTNCMYDMC-----ENIGDKELFCSSLEVYTSACQQEGITPNNWRIYTGCAQQCAAHNIYVERMSACPSTCGDLAASSNCELPDVEGCQCMPGFVM 1607          

HSP 7 Score: 77.7962 bits (190), Expect = 2.484e-14
Identity = 106/444 (23.87%), Postives = 163/444 (36.71%), Query Frame = 2
Query: 2525 GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQ----SFNESAVI----------TRGPFECQL-------SCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVI--ENVECG-SKGTSCTKSIRFYY----------KDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISK-------NPCDINKFRESWA----IKRCSILKSET--FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDC----MEGCYCKNNTYLKDDEC 3700
            GCQ   R          C  GC C+ G V  ++ C+    C C W ++    SF E+ +             G   C+        SC   +GK  C        C   G+ HY +FD + + F G  +Y L++  C   +    I I  +N   G +   S   ++  Y           KD  ++ +R   P    NP        G+   H     ++     L + +DR+   DV +   Y   VCGLCGN + +  ++ +   G +    + F +SW++       E SK       N  +++   E WA       C +       F  C        YY  C+ D C  + GD  L  C+++  Y   C +  I    WR Y  C   C     Y      CP TC G  +  S+C    +EGC C     +   +C
Sbjct: 1194 GCQSAAR----------CAEGCVCDQGFVLSDDLCVSLEACGC-WDDENNYHSFEEAWLSDNCKRKCVCSVPGNASCEAHSCVEHESCQLNNGKESCQPVS-YSTCSISGDPHYQTFDKRLYHFMGRETYTLVQS-CGDNNNLLPIRILGKNKRVGHNHRVSFLDAVYIYVYGFKIKFTDRKDFELNGVRTKPP---SNPK------EGLEIVHTSHKMVLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSEDVFGNSWEVNDRRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCGVFHDPAGPFVQCWIPAPVDPYYTNCMYDMCE-NIGDKEL-FCSSLEVYTSACQQEGITPNNWRIYTGCAQQCAAHNIYVERMSACPSTC-GDLAASSNCELPDVEGCQCMPGFVMSGFDC 1612          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO44199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWN6])

HSP 1 Score: 280.411 bits (716), Expect = 5.731e-76
Identity = 290/1104 (26.27%), Postives = 457/1104 (41.39%), Query Frame = 2
Query:  536 VKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKK------QVCGLCGLYDGNGDDKFETVDASMNPIETDLDF-IKIWLSVSRENRMKPDPA--IQMVNCDLNEMATCAKVVSIFGSK-------------FEEICYAEFCQMKNQKNSCELMRDIAFLSSP----DNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVD-CSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELV---------LSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKI--------ANEVCGKFG-------QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WR------TPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDN-----------DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLI-CDPNSCEPGCYCESGEV-YDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGK-WE---CPKRDCEGLCKAWGESHYMSFDGKFFDFHGD-CSYVLLEDYCNKKSGTFKIVIENVECGS--KGTSCTKSIRFYYKDHIIHLIRGAAPIIGRN------------PTWSPYLGTGIFSKHDYVSSIVIITK----------ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSE-TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWR 3541
            VKV  ++ + PY+K+   I   G YV V+   ++ I+++    + +  P + K       ++ GLCG YDGN  + F  +D +    +   DF + +       N  KP      ++     + M    K+ S+  S              F+  C A+ C   +   S  +   ++  S       NI   WR    C    CP+ M  S+C + C   C   N D + C+  C  GC+C +     + +C    +C C +         Y  G   K  C +CLC   G+W C T   CS  C + G+ HF TFD++   + GQC Y+                   ++ C  S D T    I I +  +G  Q  + +   T V +   +   P+ +N     S  K TS  L +E   + +V     + + ++         +   +  +  GLCG FN +  DD    DG    D    A  +++  +       +S          W ++        +NE   K G        G FK C   VP      +C  D C C         +C CS  +AYA+ C+ KGI    WR       P+F   +CP   V K+C      T +LR    CD+            C++GC C  +  +      CV    C C Y    Y   E RKDRCN CTC  G+++CT  DC +      G V+ DCG    TC +++ I      C  GCYC  G + +DN  C+   +C C   N+ ++  A+    P +C  S  CR  + WE     +   E  C A+G+ HY +FDG  ++F  + C Y  +E          K+V++N++C +  +   C +      K+++  ++   +  + RN            P   P+L T + +   +   + +I +          + +I++D+   V V    +YK  V GLCGNFD    ND R   G I   +  FADSW++ ++C     + +PC +   R+ WA K C  +++   F  CH+ V    Y + C  ++C    G DC   C+AI+ YV  CNRY I I WR
Sbjct:  557 VKVDGVTENLPYTKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPV-TCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYHSGIP-----YAHGAIRKSECSSCLCNG-GMWNC-TDTPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYVL------------------SEHCHFSNDTTKQFTIHIKISSDGSRQLIVSLAGATPVTLGG-VEGSPTVLN-----SNGKATSHILSVEHIGVQNVLVHAYAGLTILWTGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRS---------NWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMCK--------DCLCSVAAAYAKACADKGIVIDGWRDTISVCKPKF---VCPAGTVLKQCNRD-PLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPCYYGDTMYKYGEIRKDRCNNCTCKGGVFDCTNVDCEAMCL-TRGLVYSDCG---ITCENLHPINGGERPCVSGCYCPDGLIMHDNGTCVQSMQCQCKHNNKYYDAGAI---SPTDC--SRKCRGDRYWEQLAGIQAQPEYECSAFGKGHYRTFDGMLYNFESEGCGYTFMEHE------DVKVVVKNMKCVNSFELQMCKEVTITLVKENVEVVMMQKSFTLKRNGIDTAYNPGSYPPPCKPFLNTYMNTLEIFQVGLFMIVRIVDRVNPNHIKFEIRFDQGTRVYVMANTDYKGTVQGLCGNFDGKDSNDKRTSTGSIATSIPEFADSWRVGSAC-LDTKTVSPCVLYPDRKPWADKGCEEIRANPNFTICHDAVNPAPYIEACKYETCMSHMGGDCGAFCSAIAAYVRACNRYGISILWR 1591          

HSP 2 Score: 157.918 bits (398), Expect = 1.963e-38
Identity = 140/482 (29.05%), Postives = 209/482 (43.36%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDMNLICDPNSCEP----GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYL-------GTGIFS-KHDYVSSIVIIT-KELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKN-------PCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENC---PIMCPPDREYKPCEK-------VCPETCIG----TKSCISD-CMEGCYCKNNTYLKDDE--CVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            CP+G    +C   C R C +MN   DPN+C      GC+C  G++ D  KC+  G+C C+     +   A+      EC  SC C  G W C    C G C   G SH+ +FD + +  HG C YVL E +C+  + T K    +++  S G+             +I  + GA P+       SP +        + I S +H  V ++++     L I W    +  + + P++K+  CGLCG F+ N  +D   R G  +AD  AFA  W++ +S       ++       PC      E +A   C+ +   +  F+ CH  V  Q  Y KCV+D C C    DCLC   A        ++  +   WR+  +      +CP     K C +        CP TC      T +C S  C+EGCYC+    L ++E  CV +K  C C       Y  G      C+ CTC+   F+C
Sbjct:  759 CPSGMEHSECSSACPRDCSNMN--SDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSCYHSGIPYAHGAIRKS---ECS-SCLCNGGMWNCTDTPCSGTCTMVGNSHFTTFDSRSYSMHGQCDYVLSE-HCHFSNDTTKQFTIHIKISSDGSR-----------QLIVSLAGATPVTLGGVEGSPTVLNSNGKATSHILSVEHIGVQNVLVHAYAGLTILW-TGYNAYITVGPDFKSQTCGLCGTFNQNDADDFHTRDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRYVPPQDMYQKCVKDGCMCK---DCLCSVAAAYAKACA-DKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDPLTRKLRCPSTCDDLANVTDTCPSRRCVEGCYCEKEGELMNNEHKCV-DKTQCPCY-YGDTMYKYGEIRKDRCNNCTCKGGVFDC 1215          

HSP 3 Score: 136.732 bits (343), Expect = 5.837e-32
Identity = 111/402 (27.61%), Postives = 170/402 (42.29%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENK--------FCFNSEDITCAKGIKILFGEGLNQTE--IEIKSKTEVIINSKLVTIPSKINKGV------EISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPED------------DNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSI-KGIQFQWRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPN-CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCS 2479
            C I+G  HF TFD+Q     G C Y A++     S++ Q+  +V N          C  S D+    G K+  G+ +      +++   TE +  +K      +  K V      E+ ++   S+ L I+  D +      D+R++            GLCGN++G+  +            DNI   G    DD       +    C+ EV    +  +        + A ++C       F  C + V    F  QC  DVC C    + S  +C C+  S Y++ C+    I   WR+P  CPV CP  M + EC S+C   C  +   PN C++ C+DGC CP+  +  +  G CV    C C + G  Y     RK  C++C C  G+WNCT   CS
Sbjct:  478 CYISGRGHFTTFDHQEYSFYGTCSYKALID---NSNVKQIFQVVLNNDKNCDINAPCTKSVDVN-VDGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLK------------GLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAM--------QNAEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCAC---NSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKI--QDRGKCVDPGQCSCYHSGIPYAHGAIRKSECSSCLCNGGMWNCTDTPCS 850          

HSP 4 Score: 125.561 bits (314), Expect = 1.385e-28
Identity = 106/375 (28.27%), Postives = 158/375 (42.13%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWS-----PYLGT--GIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKN------NVCGLCGNFDDNVDNDLRNRAGII--DADVNAFADSWKLKTSCPYPEISKNPC------DINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECN-RYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKS----CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            GLC   G  H+ +FD + + F+G CSY  L D  N K   F++V+ N +       CTKS+        +HL +  A   G           PY  +   I     YV  IV  + E+ I +D    + + +   YK        + GLCGN+D N  ND     G      ++N F  S      C  P    + C      D+    ++ A K CS+++S+ F  C + V ++ +  +C+ D CAC+      C+C  +S Y   C   +NI + WR+   CP+ CP   E+  C   CP  C    S    C S C++GC+C         +CV +   C+C   SG  Y  G      C  C C    + C
Sbjct:  476 GLCYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNVKQ-IFQVVLNNDKNCDINAPCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTKSWPNIRQAGKYV--IVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPPKPPSGCYSEVAGDVFSAMQN-AEKMCSVIQSDAFSACRSKVDFRDFKAQCIADVCACNSTSRSDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSNMNSDPNACNSKCVDGCFCPEGKIQDRGKCV-DPGQCSCY-HSGIPYAHGAIRKSECSSCLCNGGMWNC 844          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO41877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S313])

HSP 1 Score: 229.18 bits (583), Expect = 1.180e-66
Identity = 128/345 (37.10%), Postives = 191/345 (55.36%), Query Frame = 2
Query: 2549 MNLICDPNSCEPGCYCESGEVYDN-NKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT---FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRG-AAPIIGRNPTWSPYLGTGIFSKHDYV-SSIVIITKE---LKIQWDRQLSVDVFLTPEYKN--NVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYD--KCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRN 3544
            M++ C    C+ GC C  G V D+  +CI + ECPC    +S+    VI R   +C  +CTC    WEC K+ C   C A+G+ HY +FDG+ + F G C+YV+  D C     T   F+I  EN+ CGS G +CTKS+     D IIH++RG A P + +  + SP     + ++++ V + + +I K    L + WDR   + + L+P+ ++   VCGLCGNFD ++ ND   + GI +     F D+W+ +  C       +PC  NK RES +   C+I+KS TF+PCH +V    YY+  +CV D+C CD   DC C C AI+ Y +EC    + ++WR 
Sbjct:    1 MHIGCGQVFCKSGCVCPVGSVLDDFGRCILETECPCHHNGKSYKTDDVIRR---DCN-TCTCVRNTWECTKKRCRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPCGSAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSP-----VHARYELVYAGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDCECTCEAIAAYAYECLAAGVVVKWRQ 336          

HSP 2 Score: 101.679 bits (252), Expect = 7.403e-23
Identity = 97/357 (27.17%), Postives = 148/357 (41.46%), Query Frame = 2
Query: 1139 VDCSKV-CTPGCYC-----RKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLS--IIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCK--HDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWR 2179
            + C +V C  GC C       DF     +C    ECPC +        SYK  D +++ C  C C  R  W+C T  +C + C   GDPH+ TFD +    +G C Y+    K   S +   S  I  EN  C  S  +TC K + +     L+ T I +     V   +K+ ++ S ++   E+ V+      +K   G      R     IEL   +++  KV GLCGNF+GD  +D +  +G            +R    C         +  C+ +      ++  C     G FK C   V  D +  +C+  +D C C  + +     C C A +AYA  C   G+  +WR
Sbjct:    3 IGCGQVFCKSGCVCPVGSVLDDF----GRCILETECPCHHNGK-----SYKTDDVIRRDCNTCTC-VRNTWEC-TKKRCRATCTAFGDPHYKTFDGRLYSFQGGCNYVMSTDKCPGSKLTLQSFRIDAENIPC-GSAGVTCTKSVTVT----LHDTIIHMVRGKAVPSVTKVSSL-SPVHARYEL-VYAGLYVIIKAPFGLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDC---TKTMEPIHPCKQNKHRESKSHAACAIIKSGTFKPCHISVDPDPYYERCRCVYDTCGCDSVGDC---ECTCEAIAAYAYECLAAGVVVKWR 335          

HSP 3 Score: 49.6766 bits (117), Expect = 7.756e-6
Identity = 23/64 (35.94%), Postives = 35/64 (54.69%), Query Frame = 2
Query: 2291 CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSS 2482
            C  GC CP   V+++  G C+   +C C + G+ Y  ++  +  CNTCTC+   W CT K C +
Sbjct:   10 CKSGCVCPVGSVLDD-FGRCILETECPCHHNGKSYKTDDVIRRDCNTCTCVRNTWECTKKRCRA 72          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO41876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S312])

HSP 1 Score: 170.629 bits (431), Expect = 5.790e-46
Identity = 117/370 (31.62%), Postives = 175/370 (47.30%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVE-CGSKGTSCTKSIRFYYKDH------IIHLIRGAAPI-IGRNPTWSPYLGTGI-FSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDA-DVNAFADSWKL---KTSCPYP-EISKNPCDINKFRESWAIKR-CSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            G C  WG+ HY +FDG+  DF G CSY L +D C   S  F + ++N + CGS G  C +++  Y  +       ++HLI     I +      +PY  T +  SK    + I     EL I++D   S+ V ++ +Y+NN CGLCGN +   D+DL        A  V  FA+SW +      C  P E++++ C         A KR C +L SE F  CH  V    +  +C +D C+C  G+   C C A+++Y   C    I + WR+   CP  C   + Y  C   C +TC       +C   C++GC+C   T   D+ C+     C C+  +G  Y  GTT+   C+ C C+   + C K 
Sbjct:    2 GACSTWGQRHYRTFDGRHIDFIGKCSYTLAQD-CIPGSDQFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTVQTDNRCLPVNQ-CPCQ-HNGITYVTGTTIRVGCNTCKCRGGSWTCSKH 368          

HSP 2 Score: 159.073 bits (401), Expect = 4.850e-42
Identity = 117/386 (30.31%), Postives = 170/386 (44.04%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIE---IKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMP-DGAPAKDDSELAARYRL---TQTCHG--EVLRQSYLGLCETSIEWGK-IANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQ-RPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSY 2491
            C   G  H+ TFD +HI   G+C Y         SD  Q S+ V+N     S  + C + + +  GE   +       I S   + +N   V+ P K +  VE+S  KV S  +    GD   +     S I++ +S KY     GLCGN NG P+DD +M     PA   +E A  + +    + C    EV R     +C  +    +  A  +C       F  C   V    FV +C+ DVC+C    ++    C+C A + Y+R C+ + I   WR+   CP  C +  VY ECG +C  TC     +P C   CIDGC CP+  V  +    C+ V  C C++ G  Y      +  CNTC C  G W C+   C  + +
Sbjct:    4 CSTWGQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSD--QFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYK-DTNVEVS--KVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRD----VCSNASSVIRDAAKRICMVLLSENFSACHTKVDPVPFVKRCEEDVCSCKFGEHS---GCQCQALTEYSRACASREIMLDWRSQHLCPKQCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTV--QTDNRCLPVNQCPCQHNGITYVTGTTIRVGCNTCKCRGGSWTCSKHRCPGKPH 375          

HSP 3 Score: 80.8777 bits (198), Expect = 1.096e-15
Identity = 94/397 (23.68%), Postives = 157/397 (39.55%), Query Frame = 2
Query:  296 AQCTYLNGRSYKTFDRVKTVQTNFTG--NMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYL----SSQG-VKVGNISYSFPYSKAEFQISDRGHYVYVKGIKD-LNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW------------LSVSRENRMKPDPAIQ-------MVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNS---CELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFV 1396
              C+    R Y+TFD       +F G  +  L QDC+     + + V   ++C +   D     + ++ + + +  +L    SS G ++V     S PY     ++S    Y  ++   D L I ++   SI V      +   CGLCG  +G  DD    +  +  P  +  +F + W            L V+R+        I+       MV    N  A   KV  +    F + C  + C  K  ++S   C+ + + +   +   I+ DWR +  C +  C    ++S+CG  C   C  +     C + C  GC+C +      N+C   ++CPC++        +Y  G  ++ GC  C C   G W C  H     RC   G PH  
Sbjct:    2 GACSTWGQRHYRTFD---GRHIDFIGKCSYTLAQDCIPGSDQFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPYKDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDL-LMAVTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSENFSACHTKVDPV---PFVKRCEEDVCSCKFGEHSGCQCQALTEYSRACASREIMLDWRSQHLCPK-QCIQPKVYSECGPACVKTCDADGLQPTCHETCIDGCHCPEGTVQTDNRCLPVNQCPCQHNGI-----TYVTGTTIRVGCNTCKCRG-GSWTCSKH-----RC--PGKPHVT 377          

HSP 4 Score: 53.1434 bits (126), Expect = 8.410e-7
Identity = 38/109 (34.86%), Postives = 50/109 (45.87%), Query Frame = 2
Query: 2471 DCSSQSYCP----NGKVWKDCG-GCQRTCRDMNLICDPN---SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEG 2773
            D  SQ  CP      KV+ +CG  C +TC    L   P    +C  GC+C  G V  +N+C+P  +CPC     ++     I  G   C  +C CR G W C K  C G
Sbjct:  270 DWRSQHLCPKQCIQPKVYSECGPACVKTCDADGL--QPTCHETCIDGCHCPEGTVQTDNRCLPVNQCPCQHNGITYVTGTTIRVG---CN-TCKCRGGSWTCSKHRCPG 372          
BLAST of Hemocytin vs. Ensembl Nematostella
Match: EDO33061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST99])

HSP 1 Score: 125.176 bits (313), Expect = 6.820e-31
Identity = 79/274 (28.83%), Postives = 129/274 (47.08%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPY--LGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPC-----DINKFRES----W-AIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENC 3556
            G+C ++G+ HY +FDG+ F+FHG+C Y L+ D    + G F + + +    ++     KS+  +    +IHL RG    + R     PY  L +    + +++ +++  T  +KI WD +  ++V ++  Y+ N CGLCGNF+    +D   + G        F  SW L      P + + P       I+K R S    W A KRC  +KS+ F  CH  V+   YY  C+ + C C       C C ++  Y   C R  + + W   + C
Sbjct:   55 GICTSYGDPHYQTFDGRMFNFHGNCRYRLVADC---RQGNFSVRLRSERHHNQAVGEAKSLVVHIGSTVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNFMITLLSETG-VKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPIKSQ-FSNCHPVVKPHKYYKACISEVCKCLVKR---CECESLVTYARACRRMGVNVNWGRKKAC 320          

HSP 2 Score: 90.1225 bits (222), Expect = 4.057e-19
Identity = 76/285 (26.67%), Postives = 120/285 (42.11%), Query Frame = 2
Query: 1367 CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISV--FKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQS-------YLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFC 2194
            C   GDPH+ TFD +     G C+Y  V     +      S+ + ++   N + +  AK + +  G     T I ++    V ++ K V +P +    ++I    F +T   L  E G    +    +S IE+ +S +Y     GLCGNFNG P DD +M +G  A+ D E    + L        L+++        +  C  S      A + C    + QF +C  +V   K+   C  +VC C + R      CEC +   YAR C   G+   W   + C
Sbjct:   57 CTSYGDPHYQTFDGRMFNFHGNCRYRLVA----DCRQGNFSVRLRSERHHN-QAVGEAKSLVVHIGS----TVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDRKNFMIT---LLSETG--VKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGGHRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPI-KSQFSNCHPVVKPHKYYKACISEVCKCLVKR------CECESLVTYARACRRMGVNVNWGRKKAC 320          
BLAST of Hemocytin vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 451.055 bits (1159), Expect = 1.485e-127
Identity = 319/1133 (28.16%), Postives = 510/1133 (45.01%), Query Frame = 2
Query:  542 VGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDL-DFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQK---NSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWS------XXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDND---------CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNL--------ICDPNSCEP--GCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKI--QWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEIS--KNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSC------ISDCMEGCYCKNNTYLKDDECVSEKPL-CTCKDESGKEYPLGTTVIKNCHKCTCQINGFECE 3820
            V  I+  FP   +   + D   +V+V+    + + ++   ++++           GLCG+Y+ N ++   T   S   ++ D  D  ++  S      +      + V   L E         +  + + + C   +C +  ++    +C+ +   A   +  +I+  WR    C    CP   ++S             +  G       C + C  GC C    F ++  C +A++CPC +R       +Y+ GD +++ C  C+C S G W+C T ++C+ +C + G     TFD +   ++G                          F F           ++L              K  V +N    T+P   +   +++V + +S  + ++      ++  D     + L    A KV GLCG       DD   P+G      S  A ++ ++Q C   + + +    C T  +    A  VC       F+ C  +V  + +   C  +VC C L R+     C C+  +AYA+ C+ +G+Q  WR   FCPV C    V++ECG +C  +C   Q     ND         C+ GCQCP  +V ++  G CV V  C C    + Y+     ++ CNTC C +G +NCT + C S   CP   V+     C  TC  ++         +  P+  EP  GC C  G  +  ++C+   ECPC    Q +  +  IT+   +C  +C C+  +W C +  C+G+C A G+ HY++FDG+ + F GDC YVL      + SG F I  ENV CGS G +CTKS+ F     IIHL+RG A  +   P   P   +G     + V   V ++  L +   WD  + V V L    +  V GLCGNFD++ +ND     G +++    F +SWK+  SCP  E    ++PC +N  R +WA KRC++L  + F  CH  V +Q YYD CV D+C CD G DC C+CTAI+ Y  ECNR  + ++WR+ E CP+ C     Y+PC   C ++C   +        +  C+EGC+C   T    D C+   PL C C+ E G  +P GT++ + C  C+C    ++CE
Sbjct:  161 VHKITVLFPLWISVHWLGD---FVFVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYNNNPEEASLTETVSW--LQQDCSDAAELGHSCDIVEDLTLRRQAESVCHQLLENPFTHCHFRVDPAAYIDTCLYLYCSLPTRERDGGACDTLATYARECAQQHIIIMWRTPSLCGR-VCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRRL-----TYQPGDSIQQRCNTCVCRS-GQWQC-TGERCAGQCTLVGALQVTTFDKKKYSLQG------------------------GDFLF-----------QLL--------------KCTVTVNGVRQTLPVVSS---DLAVHRASSSFILVQTFGALVLWHLDGPFALIHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKF-ISQPC--TLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDVVEKEPYFRLCLSEVCACALQRS-----CHCTVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCVPGCQCPTGLV-QDHLGQCVPVSLCPCVQDDKIYSPGTILQNNCNTCVCKHGAFNCTQEHCKSVQQCPGSLVYSP-RSCMLTCSSLDHQGQQQSSSVTKPSCREPLSGCVCPQGTFFHGDRCVLPDECPCHHNGQVYYTNETITK---DCN-TCVCQKRRWHCTRLVCDGVCVATGDPHYVTFDGRRYSFLGDCQYVLA----TETSGLFSITAENVPCGSTGVTCTKSVTFSLGSTIIHLLRGKAVTVNGMPVTLPKSYSGSGLTLEKVGLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCPDVENQDLQDPC-LNPHRVTWAKKRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGCDSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTIHHGDGCI--LPLDCPCEWE-GSMFPPGTSITQRCQNCSCVEGLWQCE 1206          

HSP 2 Score: 187.578 bits (475), Expect = 8.667e-47
Identity = 134/449 (29.84%), Postives = 198/449 (44.10%), Query Frame = 2
Query: 1166 GCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDS--RIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLC--ETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDN----DCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQS 2488
            GC C +  F++ ++C   DECPC +         Y   + + K C  C+C+ R  W C T   C   C+ TGDPH+VTFD +     G CQY  V+  E        SI  EN  C  S  +TC K +    G     T I +     V +N   VT+P K   G  +++ KV   GL +       V    D   R+ + L+A    +V GLCGNF+ D E+D     G+           ++++ +C  +V  Q     C     + W K   + C    Q  F  C   VP   +   C  D C C    +     C C+A ++YA  C+ +G+  +WR+ E CP+ C K M+Y+ CG +CS +C   Q+ +        C++GC CP   +       C+   DC CE+ G  +        RC  C+C+ GLW C    C + S
Sbjct:  796 GCVCPQGTFFHGDRCVLPDECPCHHNGQV-----YYTNETITKDCNTCVCQKR-RWHC-TRLVCDGVCVATGDPHYVTFDGRRYSFLGDCQY--VLATETSG---LFSITAENVPC-GSTGVTCTKSVTFSLGS----TIIHLLRGKAVTVNGMPVTLP-KSYSGSGLTLEKV---GLFVSLSSRLGVTLMWDGGMRVYVHLAAHLRGQVGGLCGNFDEDTENDFTTHQGSVESTAEVFGNSWKVSPSCP-DVENQDLQDPCLNPHRVTWAK---KRCAVLTQDLFSVCHTEVPFQHYYDWCVFDTCGC---DSGGDCECLCTAIASYAEECNRRGVYVRWRSQELCPLQCEKGMIYEPCGPACSQSCPSVQQHSYSRCEVLSCVEGCFCPAGTI--HHGDGCILPLDCPCEWEGSMFPPGTSITQRCQNCSCVEGLWQCEGVACPASS 1214          

HSP 3 Score: 128.257 bits (321), Expect = 8.116e-29
Identity = 115/474 (24.26%), Postives = 187/474 (39.45%), Query Frame = 2
Query: 2492 CPNGKVWKDC-GGCQRTCRDMNLICDPNS-------CEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQW--DRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEIS-KNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC---------------IGTKSCISDCMEGCYCKNNTYLKDD---ECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            CP G+V+ DC   C  +C   +      +       C  GC C  G       C+   +CPCF +  ++     I +    C  +C CRSG+W+C    C G C   G     +FD K +   G                                           D +  L++    + G   T  P + + +       S I++ T    + W  D   ++ + L P   + V GLCG    +  +D     G ++  V+AFA+ + +   C  P+ +  +PC     R S+A + CS++ +  F+ CH+ V  + Y+  C+ + CAC     C C  T ++ Y   C +  +++ WRN   CP+ C   + ++ C + C  +C               IG + C+     GC C   T L  D   +CV    LC C  +  K Y  GT +  NC+ C C+   F C +E
Sbjct:  334 CPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAEDCPCFHRRLTYQPGDSIQQ---RCN-TCVCRSGQWQCTGERCAGQCTLVGALQVTTFDKKKYSLQGG------------------------------------------DFLFQLLKCTVTVNGVRQTL-PVVSSDLAVHRASSSFILVQTFGALVLWHLDGPFAL-IHLQPGLAHKVHGLCGTLTWSQHDDFTTPEGDVEMSVSAFAEKF-ISQPCTLPKAAPSDPCSTYTQRISYAERVCSVIHNPVFQKCHDVVEKEPYFRLCLSEVCACALQRSCHC--TVLTAYAQHCAQEGVQVHWRNQTFCPVQCSGGQVFRECGRTCGFSCFDWQHGWLCNDSSGEIGQRVCV----PGCQCP--TGLVQDHLGQCVPVS-LCPCVQDD-KIYSPGTILQNNCNTCVCKHGAFNCTQE 748          

HSP 4 Score: 66.2402 bits (160), Expect = 4.936e-10
Identity = 72/278 (25.90%), Postives = 114/278 (41.01%), Query Frame = 2
Query: 2120 SAYSAYARICSIKGIQFQWRTPEFCPV-----------------ICP------KNMVYKE-CGSSCSATCR-LRQRPNC-DNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMG----RDYNANEERKDRCNTCTCINGLWNCT---------------------------------------------TKDCSSQSY--CPNGKVWKDCGG-CQRTCRDM--NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCF-----WQNQSFNESAVITR 2698
            SA++A A  CS  G++ ++R P   P                  +CP      +  +Y++ C + C  +C  L +   C    C  GC+CP+  ++++  G+CV V +C+C         +++  EE    CN C C+NG   CT                                             T+ C  Q    CP+ +V+ DC G C  TC D+  N  C P  C PGC C SG+V+    C+ + +CPC       + QS+NES+ + +
Sbjct: 3920 SAWTACAEPCS-GGVRHRFRWPLKIPPGPRCRGRQTQSQSCNTGLCPGERCEDRERIYQQSCANQCPRSCTDLWEHVQCLQGACHSGCRCPEGQLLQD--GHCVPVAECRCGIPSGNGTLEFSPMEETTVDCNKCVCVNGTLLCTKHPCPVYDSWSSWSSCSVSCGLGRMTRTRTCEDTEGGPSCGETTQTESCRQQPCPDCPSWQVYSDCSGSCPYTCEDLWPNTQCLPGPCTPGCTCPSGQVFYRGSCLDRADCPCSVLSLPMEFQSWNESSEVLQ 4194          

HSP 5 Score: 66.2402 bits (160), Expect = 5.505e-10
Identity = 62/265 (23.40%), Postives = 105/265 (39.62%), Query Frame = 2
Query: 3068 YVSSIVIITKELKIQWDRQLSVDVFLT--PEYKNNVCGLCGNFDDNVDN-DLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIG---------TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            ++   V +   L ++    L   V+LT   E+     GLCG +++N +   L      +  D    +D+ +L  SC   E      D+   R++ ++  C  L    F  CH  V    Y D C+   C+    +     C  ++ Y  EC + +I I WR    C  +CP  + +  C   CP +C              C  +C+ GC C    +L    C+  +  C C       Y  G ++ + C+ C C+   ++C  E
Sbjct:  176 WLGDFVFVESGLGVRLKFDLINTVYLTVTAEHLAATRGLCGVYNNNPEEASLTETVSWLQQDC---SDAAELGHSCDIVE------DLTLRRQAESV--CHQLLENPFTHCHFRVDPAAYIDTCLYLYCSLPTRERDGGACDTLATYARECAQQHIIIMWRTPSLCGRVCPRGQVFSDCVSSCPPSCASPHPPGPAATMAQCREECVGGCECPPGLFLHQGTCLKAED-CPCFHRR-LTYQPGDSIQQRCNTCVCRSGQWQCTGE 427          
BLAST of Hemocytin vs. Ensembl Medaka
Match: vwf (von Willebrand factor [Source:NCBI gene;Acc:101162365])

HSP 1 Score: 409.068 bits (1050), Expect = 1.343e-114
Identity = 324/1195 (27.11%), Postives = 512/1195 (42.85%), Query Frame = 2
Query:  482 IKFLFKDSIEATYLSSQG-VKVGNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRE-------------NRMKPDPAIQMVNCDLNEMA----TCAKVVSIFGSKFEEICYAEFCQMKNQKNS----CELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSK-----INKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQ--RPNCDND--CIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSS------------------QSYCPNGKVWKDCGG------CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPP-------------DREYKPCEKVCPETCIGTK--SCISDCMEGC--YCKNNTYLKD--DECVSEKPLCTCKDESGKEYPLGTTVIKN------CHKCTCQINGFECE 3820
            +     D+ E  +LS  G +       + PY S A F  S+ G Y          +  +   +I +        + CGLCG ++    D++   +  +   E   DF   W     +             N  K   AI + +C + + +     CA +V      F  +C AE C   NQ++     C ++ + A       I+   W  +  C  P CP  M +S+C  +C+  C   N    C   C  GC C        N+C    EC C +         +  G  + + C  C+C   G W+C T++ C   C++ G  HF +FDN+     G CQY+  + K+  ++  + S+I+EN  C +++D  C + + +      N T +++K    V +N+  +  P       I + V+ SV  V SD L+++             R+ L L+A++  +  GLCGN+NG+  DD +   G            +++   C  E   +     C  + +  + A E C       F  C  LV    F   C++DVC CG         C CSA +AYA  CS KG+   WR+   C + C    VY+ CG+ C  TC         C+ +  C +GC CP    +   +G CV  + C C + G+ Y  N+   D  + C C NG   C++ +  S                   ++CP   V  +CG       C RTC++++L C   SC PGC C    V     CI   +CPC+  N+ +     IT    +C  +C C + KW C ++ C+G+C++ GE HY++FDG  F F G C YVL++D C  + G+F++++EN  CG  G  C K++  +Y+  +I +  G   +  + P         I S   Y    +++ K + + WDR   + V ++  Y+  VCGLCGNFD NV+ND  +    ++ D + F +SWK+  SC        PC  N  +     + C ++    F+ C+  V  + Y + CV+ +C+C    DC C C  ++ Y   C+   I I WR+ + CP+ C                  Y  C   CP TC   +   C   C+E C  YC     L +    CV+      C   +G+    G  VI N      C  C C+ N   CE
Sbjct:   76 VTLFLGDAFE-LHLSVDGFLSQREKRLTLPYASHAVFAGSELGFYKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLT--EDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKGTEAI-LSSCSVLKTSGVFLHCAHLVP--PEAFLLLCQAEACHC-NQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCY-PKCPIGMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCVEVSECSCTHMGR-----HFPPGSTVSQDCNTCVCR-HGSWEC-TNEGCPGECLVVGQSHFKSFDNKFFTFTGDCQYL--LAKDCVNN--EFSVIIENVQCADNQDAVCTRSVTLSLPSLENMT-VKLKHGGVVSVNNMDIQTPMHYGHLHIQRAVQSSVRLVFSDDLRLD--------WDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKPQAFGQAWKINGDC--ESTHKYDPDPCAINPKRVRFAEEACAVIMSDVFSPCHILVNPSPFQRFCRYDVCACG-----DGEKCLCSALAAYAASCSAKGVLVNWRSALLCELECSGGQVYEACGTVCDRTCLSLSGAEAGCEGEKVCEEGCFCPVGKYLS-PSGQCVTADLCPCLHDGQLYQPNDVYADHTSICYCENGSMRCSSSEVPSLLSDLFYDEDLGSTRERRSAHCPPPLVRTECGSGKKGLECARTCQNLDLPCVSLSCIPGCLCPPDTVRHRRDCIAPEQCPCYHNNRPYAAGQTITT---DCN-TCVCENRKWRCTQKLCDGVCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGSFRVLVENEACGIVGRRCAKAVTVFYQGGLIVMQHGE--VTMKKPVPQSSQVEIIRSGQFYT---LLLGKHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKVIPSCADVTQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACSCPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYNTCGPACPITCQHPEPLQCSFTCVEACHAYCPPGQLLDEVAMRCVNPSQCQMCV-HNGQRISHGNKVILNHDNPALCKICHCENNSLSCE 1224          

HSP 2 Score: 133.65 bits (335), Expect = 1.986e-30
Identity = 106/382 (27.75%), Postives = 159/382 (41.62%), Query Frame = 2
Query: 1358 SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIP---SKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGN-CVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQ 2485
            + RC + G  H  TFD       G C Y+      +  D    S  +   F  N +      G+ +  G+     E+ +     +    K +T+P     +  G E+  +K+ S+    E G  F+V   + + I L LS  +A +  GLCGNFN    D+    +G   +D  + A  + +           +    C ++     I +        G F  C  LVP + F+  C+ + C+C         +C C     YAR C   GI    W     C   CP  M Y EC  SCS TC  L  +  C ++C+DGC CP   V++   GN CV+V +C C +MGR +         CNTC C +G W CT + C  +
Sbjct:   24 TGRCSLFGRYHVHTFDGVLYEFPGDCSYL------LAGDCSHRSFTLLGDF-HNGKR----TGVTLFLGDAF---ELHLSVDGFLSQREKRLTLPYASHAVFAGSELGFYKLWSE----EFG--FTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKGTEAILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHC---NQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPIGMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLD---GNRCVEVSECSCTHMGRHFPPGSTVSQDCNTCVCRHGSWECTNEGCPGE 379          

HSP 3 Score: 131.339 bits (329), Expect = 9.330e-30
Identity = 101/362 (27.90%), Postives = 165/362 (45.58%), Query Frame = 2
Query: 2771 GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKEL--KIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK---TSCPYPEISKNPCDINKFRESWAIKRCSILK-SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGT---KSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKE 3826
            G C  +G  H  +FDG  ++F GDCSY+L  D C+ +S T      N     K T  T  +   ++ H+   + G      +  T  PY    +F+  + +    + ++E    +  D   ++ + L+  + N  CGLCGNF+    ++   + G++  D   FA+SW +K    SC         C+  K  E+  +  CS+LK S  F  C + V  + +   C  ++C C++ D   C C  + +Y   C+ + I +  W     C   CP   +Y  C K C  TC      + C  +CM+GC C     L  + CV E   C+C    G+ +P G+TV ++C+ C C+   +EC  E
Sbjct:   25 GRCSLFGRYHVHTFDGVLYEFPGDCSYLLAGD-CSHRSFTLLGDFHN----GKRTGVTLFLGDAFELHLS--VDGFLSQREKRLTL-PYASHAVFAGSE-LGFYKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYDFANSWAVKGADQSCRRVSNPSKSCNSTKGTEA-ILSSCSVLKTSGVFLHCAHLVPPEAFLLLCQAEACHCNQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPIGMQYSECTKSCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCV-EVSECSCT-HMGRHFPPGSTVSQDCNTCVCRHGSWECTNE 374          

HSP 4 Score: 95.5153 bits (236), Expect = 5.860e-19
Identity = 99/377 (26.26%), Postives = 144/377 (38.20%), Query Frame = 2
Query: 2699 GPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGD--CSYVLLEDYCNKKSGTFKIVIENV----ECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGI-FSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNN---VCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRE---SWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD---------CM----EGCYCKNNTYLKDDECVSEKPLCTCKDESGKEY 3751
             P + Q +C+C    WECP      +C     +H + FD       G+  CSY LL    N  SG    V  +     E  S    C K++   +  H + L      +I R     P+   G+   ++  V   +   +   + +  Q S +  +T +   N     GLCG   +   N L  R G    +  AF   W            ++   + K +    S A   C  L SE F PCH  +  Q++  KC +   AC+  D     C  IS Y   C +  + + WR+   CP+ CP   EY  C   C E C   ++  SD         CM    EGC+C   T L    CVS +    C D+ G  Y
Sbjct: 1950 APVKVQDTCSCH---WECP-----CMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLT--VNSDSGEGSEVKLHTGPCQETTSYNQICMKAMEVTHGPHKLILRDDMRAMIDREELALPWRFYGMELMRYGGVMLQLKSNQGYMLTFTPQ-SNEFTITFQGSTNSAQTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDWTAA--------GEDGVCLPKRQSVCLSGAAMGCQALHSEVFLPCHAFIPVQIFLTKCEEQ--ACEESD----ACEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGHTY 2301          

HSP 5 Score: 81.6481 bits (200), Expect = 9.284e-15
Identity = 94/455 (20.66%), Postives = 173/455 (38.02%), Query Frame = 2
Query: 1238 YRASAKQIDSYKFG-DKMKK-GCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFV--EGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGE--VLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-----------LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCK--CEYMGRDYNANEE---RKDRCNTCTCIN-GLWNCTTKDCSSQSYCPNGKVWKDCGGCQ 2533
            + + A  + S+K   DK++   C+N +   +    C  H +C   C+ +   H V FD+  + +  EG C Y  +       +  ++ +         S +  C K +++  G      ++ ++     +I+ + + +P +   G+E+  +      LK   G + +   + +        +  + +  GLCG    +  +   + +G+   +     + +    T  GE  V       +C +    G      C       F  C A +P   F+T+C+   C           +  C   SAYAR+C  +G+   WR+P  CP+ CP +M Y  C + C   C             R   +C +   +GC C    V+    G CV  E C    +  G  Y   +     ++ C  C C++    NCT + C       N     +CG C+
Sbjct: 1923 HPSGAVTVQSHKVSCDKLEPPACRNNMAPVKVQDTCSCHWECPCMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLTVNSDSGEGSEVKLHTGPCQETTSYNQICMKAMEVTHGP----HKLILRDDMRAMIDREELALPWRF-YGMELMRYGGVMLQLKSNQGYMLTFTPQSNEFTITFQGSTNSAQTAGLCGACGEEKVNILSLRNGSSTTNQPAFISDW----TAAGEDGVCLPKRQSVCLSGAAMG------CQALHSEVFLPCHAFIPVQIFLTKCEEQACE---------ESDACEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVEDCDSIQALPSDWSVARSNESCMDTPTEGCFCAGGTVLHH--GRCVSPEACGQCVDQHGHTYTHMQSWVPDENPCLICMCLDQQRINCTARPC-------NDVKAPECGACE 2344          
BLAST of Hemocytin vs. Ensembl Medaka
Match: otog (otogelin [Source:NCBI gene;Acc:101158818])

HSP 1 Score: 325.479 bits (833), Expect = 7.601e-89
Identity = 256/1043 (24.54%), Postives = 430/1043 (41.23%), Query Frame = 2
Query:  602 GHYVYVKGIKDLNIFY-NKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLD-FIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLS-----SPDNIVSDWRYKLD-----------CEE---------PNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKL-VTIPS-----KINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRT--PEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDC-SSQSYCPNGKVWKDCG------------GCQRTCRD--MNLICDPN-SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHL-----IRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENC 3556
              YV V   +   + +  + GS+++          CGLCG ++    D   T   S   +  D++ F   W        M+ DP             TC  V S F S +     +    ++  +  C ++    F S     SP   ++ + +K D           C+          P CP  + + +C + C   C      +D    C  GCYC     +    C  A +CPCE+         Y  G  +++ C NC C   G+W C  H  C   C +TGD  F +FD +       CQY+ V  +       + ++ ++N  C    D  C + + ++  E   +TE+ +    EV +  +  +++P       I +   + +   T+ GL+++       +   + R+ L    ++     GLCG FNG+ +DD + P G            ++++  C   +     +  C++  +    A+ +C    Q  F  C   +    F  QC+ + C CG         C CS  + YAR C    +   +R+  P+ C V CP  M Y  C SSC   C  L     C  +C +GC CP       +T  CV    C C   G DY   +       + T   G   C+       +  CP G+++++C              C+RTC    +N+ C  + SC  GC C  G +   ++C     CPC W+ + +     ++   ++C     C+ G ++C  R C  +C A+G+ HY +FDG  FD+ G C   L++   +     F +  ENV+C   G  C K +       ++ L         + +I RN          +F     + ++V   +E + + WD + +V V + P ++  + GLCGNFD    N++R    +       F +SW        P+I ++PC +N  RE +A  +C++L SE F+ CH  V    +Y+ C+ D+CAC RG DC C C++++ Y   C    + + WR+   C
Sbjct:  256 SQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTT---SYGLLTHDVEMFGNSW--------MEMDP----------HQNTCPPVGSSFPSPYRPFPVS----VQRVEEVCSMLLSPPFQSCHDFVSPLPYMASYYWKKDYYRIFFGTCFFCDASLFLPPRSVPPCPAGLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQDGGCVEASDCPCEHHGVF-----YPAGQMLQEECNNCTCVG-GVWNCTDHS-CPGECSVTGDMFFQSFDGRIFTFPASCQYVLVKSRLSG----KFTVTIQNAPCGPDLDGACIQSVSLVVDED-PRTEMTLSHMGEVFMAGQYRISLPYYDDVFHIQELSSMFLQVRTAFGLQLQ-------YSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSP-IDPCDSHQQAVSYASSMCDVLNQDLFAACHDYLSPAPFHQQCRANTCRCG-------TPCLCSTLAHYARHCRKFSVIVDFRSHIPD-CAVSCPATMEYSSCVSSCQRRCSSLAALQRCGEECEEGCACPQGSFYNHRTHTCVHRSQCPCSLFGADYEPGDLPAQLSWSLT---GFLKCSGFSFFLPERLCPAGQLYQNCSDGDDAFLPGRGVACERTCESHLLNIPCSSHDSCVSGCVCPHGLLKHGDECFEPAACPCLWKGKEYFPGDRVSSPCYQC----ACQDGTFQCAFRPCPSMCTAYGDRHYRTFDGLLFDYVGACKVYLVK---SSADAVFSVTAENVDCFDTGVICKKYLLINVGASLLSLDDHMGKPNPSSVIDRN--------QRLFIWQAGLFTVVHFPEEDITVLWDHKTTVHVQVGPHWQGRLSGLCGNFDLKTVNEMRTPENMDSPTPQEFGNSWTATECVNSPDI-RHPCSLNPLREPYAKHQCAVLLSEVFQTCHPVVDVSWFYENCLADTCACSRGGDCECFCSSVAAYAQRCCHEGVPVDWRSPSLC 1226          

HSP 2 Score: 165.236 bits (417), Expect = 4.545e-40
Identity = 110/420 (26.19%), Postives = 194/420 (46.19%), Query Frame = 2
Query: 2492 CPNGKVWKDCGGC-------QRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSK-GTSCTKSIRFYYKD------HIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLS-VDVFLTPE--YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISK--NPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNY-ENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTY 3682
            CP G  +++C  C       +RTC D  L     +C  GCYC  G ++ +  C+   +CPC      +    ++     EC  +CTC  G W C    C G C   G+  + SFDG+ F F   C YVL++   ++ SG F + I+N  CG     +C +S+     +       + H+  G   + G+     PY    +F   +  S  + +     +Q     +   ++L  E  +K++  GLCG F+ N+ +D  + +G+I++    F +SWK+ ++C         +PCD ++   S+A   C +L  + F  CH+ +    ++ +C  ++C C  G  CLC  + ++ Y   C ++++ + +R++  +C + CP   EY  C   C   C      + C  +C EGC C   ++
Sbjct:  413 CPAGLQYRECISCCPATCSLERTCIDSRL-----ACLDGCYCPDGLIFQDGGCVEASDCPCEHHGVFYPAGQMLQE---ECN-NCTCVGGVWNCTDHSCPGECSVTGDMFFQSFDGRIFTFPASCQYVLVK---SRLSGKFTVTIQNAPCGPDLDGACIQSVSLVVDEDPRTEMTLSHM--GEVFMAGQYRISLPYYD-DVFHIQELSSMFLQVRTAFGLQLQYSWAEFRLYLQAEERWKDDTVGLCGTFNGNIQDDFLSPSGMIESTPQLFGNSWKVSSACSSSLSVSPIDPCDSHQQAVSYASSMCDVLNQDLFAACHDYLSPAPFHQQCRANTCRC--GTPCLC--STLAHYARHCRKFSVIVDFRSHIPDCAVSCPATMEYSSCVSSCQRRCSSLAALQRCGEECEEGCACPQGSF 813          

HSP 3 Score: 117.857 bits (294), Expect = 1.087e-25
Identity = 101/372 (27.15%), Postives = 162/372 (43.55%), Query Frame = 2
Query: 2768 EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYK-DHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE--LKIQWD-RQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSW----KLKTSCPYPEISKNPCDINKFRESWAIKR----CSILKSETFEPCHNTVR--------------YQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISD---CMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTC 3796
            E  C+ WG+ ++ +FDG ++ F G CSY LL+D  +     FK V  + EC S   +C +S+  +   +  I L        GR              + + +S  V++T++    + W+ R  SV + L+P++    CGLCGNF+  V +D+    G++  DV  F +SW      + +CP P  S  P     F  S  ++R    CS+L S  F+ CH+ V               Y++++  C      CD                      ++ +  R+   CP       +Y+ C   CP TC   ++CI     C++GCYC +    +D  CV E   C C +  G  YP G  + + C+ CTC
Sbjct:  158 EMTCRTWGQYNFETFDGLYYYFPGRCSYTLLKD-SHISFFVFK-VHNDPECSSAPYTCQRSVSIFLPWEGEIRLHASNVTFKGRR---LQLPHHLHHLQLEQISQYVLVTQQQGFTLAWEGRTGSVYIKLSPDFVGGTCGLCGNFNAEVQDDMTTSYGLLTHDVEMFGNSWMEMDPHQNTCP-PVGSSFPSPYRPFPVS--VQRVEEVCSMLLSPPFQSCHDFVSPLPYMASYYWKKDYYRIFFGTCF----FCDA---------------------SLFLPPRSVPPCPA----GLQYRECISCCPATCSLERTCIDSRLACLDGCYCPDGLIFQDGGCV-EASDCPC-EHHGVFYPAGQMLQEECNNCTC 490          

HSP 4 Score: 70.8626 bits (172), Expect = 1.834e-11
Identity = 87/364 (23.90%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 2750 CPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTS---------CTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDY----VSSIVIITKE--LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGII---DADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVC-------------PETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPL--CTCKDESG 3742
            CPK DC   C  + + + ++FDG     +    Y++ +      + T  ++++  EC +   S         C  S+   ++ + + + R     + R    +       F K+ +      ++ +I     LK+QW     + V  T + K    GLCG  D +  +DL    G +     D   F DSW++  +  Y   S+   D+N    S      S+L++ TF  CH  V    + +  V+DS   +        C A++ YV  C+++NI I+WR    CP +C     Y+ C   C             PE C G         EGC C   T L         P   C C D +G
Sbjct: 2110 CPKWDCPCRCSMFPDLNVITFDGNSVAIYKAALYIVTQ----LPNETVTVMVQ--ECPADSESLLLWNFTNLCLVSLNITHQSNHVLINR-----LQRRLYVNTRYAKARFKKYGFEIYDTGNMYLIRSPAGLKLQWYHSTGMMVIET-DSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPALFIDSWQVSNTTSYISQSRRR-DLN-CSTSDCSTCLSMLENATFTACHAFVPPSTFCEVWVRDSEYVNNQ------CVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTSQSCPNHDFDADPEQCSGLT-------EGCVCPEGTLLHRQYSALCIPPEKCACTDSAG 2446          

HSP 5 Score: 70.0922 bits (170), Expect = 3.165e-11
Identity = 79/373 (21.18%), Postives = 141/373 (37.80%), Query Frame = 2
Query: 1355 CSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKI-EAGDLFSVFRKDDSRIE-------LVLSAKYARKVTGLCGNFNGDPEDDNIMPDGA---PAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGL-LRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDC--------IDGCQCPDDMVIEEK-TGNCVKVEDCKCEYMGRDYNANEE 2410
            C  RC +  D + +TFD   + +     YI        + +P  ++ V  + C    +         L    LN T         V+IN     +  ++      +  +    G +I + G+++ +      +++       +V+         GLCG  +GDP DD  +P+G+     +D +     ++++ T       +     C TS       +          F  C A VP   F          C + +R++  +N +C A +AY   C    I  +WR P +CP IC   + Y+ C  +C++    +  PN D D          +GC CP+  ++  + +  C+  E C C        AN E
Sbjct: 2115 CPCRCSMFPDLNVITFDGNSVAIYKAALYIV-------TQLPNETVTVMVQECPADSESLLLWNFTNLCLVSLNITH----QSNHVLINR----LQRRLYVNTRYAKARFKKYGFEIYDTGNMYLIRSPAGLKLQWYHSTGMMVIETDSKVPTMGLCGVCDGDPTDDLTLPNGSVLGAGEDPALFIDSWQVSNTTSYISQSRRRDLNCSTSD-----CSTCLSMLENATFTACHAFVPPSTF----------CEVWVRDSEYVNNQCVALAAYVASCHKFNICIEWRRPNYCPFICAATLRYQACLPACTS----QSCPNHDFDADPEQCSGLTEGCVCPEGTLLHRQYSALCIPPEKCACTDSAGVPRANGE 2453          
BLAST of Hemocytin vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 263.077 bits (671), Expect = 7.406e-70
Identity = 305/1273 (23.96%), Postives = 497/1273 (39.04%), Query Frame = 2
Query:  278 IELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGN--MVLVQDCM--SRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFP--YSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIW---------------------LSVSRENRMKPDPAIQMVNCDLN-EMATCAKVVSIFGSKFEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGD-------KMKKGCQNCLCESRGLWKCDTHDQCS-------------SRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFK------VTSD-GLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCG--KFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQ-FQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPG--CYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVL-----LEDYCNKKSGTFKIVIENVEC----GSKGTSCTK--SIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL-------KTSCPYPEISK-NPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGTK---SCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCH-KCTCQ-INGFECEK 3823
            +  +    C  +    Y+TFD  +    +F G    V+ ++C   SR   +++    +    ++ S    +T++ ++  +I A    +  V+V N  +S P   +  + +I   G  V ++    L + Y+   ++ V  P T   + CGLCG ++GN  D F T   S       + F   W                      + S+ N+   D +  ++    N     C  ++      + E C  + C  K  +   C  +   A       + + DWR    C  P CP    +  CG+ C   C   +    C + C   C C++ F    ++C  A +C C Y           + D       K   G +   C+ +G   C    QC              S C  TGDPH+VTFDN+    +G C Y        ++++    ++V+N+           +G  ++    L    ++IK  +  I+N +LV +P  + +G ++SV+K      VT+D GLK+      + F        + L + Y   V GLCGN+NG+ +DD    +G      ++    +R+ +        Q     C+ + +      ++CG  +  +G F+DC A V    F   C +DVC   +      + C+  A +AY   C   G+  + WRT  FC V CP +  Y  C S+C A+C  L   P C   C +GC C +  ++      CV    C C Y    Y  NE                           + PNG+  ++C    +  +D  + C    C P   C  E+G      KC P G+                                          G+C+A G+ HY SFDG+ FDF G C+YVL     +ED        F + +ENV+     G K  S T+  ++  +    I+        + G        L  G    +   ++ +I T   L + +D    V V +   Y++ VCGLCGNF+ +  +D +    I+  D+N F  SWK+       +  C   E +  +P   + F +      C IL +    F  CH+ +  Q Y+D CV D CA +   D   +C +++ Y + C+   + +  WR    CP+ CP +  Y+ C + C  +C G      C   C EGC C          CV E   C C D      P   T  ++C   C+C    G  CE+
Sbjct:   39 VPQSKMGTCWAMGDPHYRTFDGQRF---DFMGTCTYVIAKNCGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQ-VYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTT--PSGTQASGAVAFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDP--KAYLENCKYDLCMGKGLRQFLCNALETYAEACQAAGVQIGDWRGLAKCS-PRCPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGSECVPATKCGCTYDGRYIPAGQTFWADQNCKQLCKCVAGTRQVACQDKG---CGVGQQCKVVDGIRKCQALSYSTCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTELTPFEVLVQNEH----------RGRNVVSYTKL----VQIKVYSLNILNDQLVNLPVSLVEG-KVSVYKSGWFAVVTTDFGLKVSFNWHSAAF--------VTLPSNYMGAVCGLCGNYNGNMQDDLTPKNGNTPVKPTDFGTSWRVAEIPGCIEGCQGVCPSCDITQKVQYEKEDLCGIIRDTKGPFRDCHAKVDPAGFFEDCVYDVC---MYEGRKDVLCQ--AVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASCEGLAPPPGCRAHCEEGCSCDEGYILSGD--QCVPFSQCGCLYNDLYYRINE--------------------------VFYPNGQCEEEC----KCTQDGEVTCKKFKCGPNEKCKIENGI----QKCHPVGK------------------------------------------GVCRASGDPHYTSFDGQKFDFQGTCTYVLSKSCGVED---THLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVLVNGVLNNIPLNLNDGEVQVYQEGTNYLIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDINVFGKSWKVAIPNVVCENGCQGNECADCDPAHKDVFSKP---AYCGILTAPKGPFAVCHSKLDPQSYFDDCVFDVCASN--GDGKVLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYDGQTCVKETE-CGCYDRGKTYKPGEVTYEEDCSLACSCNPATGLICEE 1184          

HSP 2 Score: 155.992 bits (393), Expect = 2.659e-37
Identity = 210/897 (23.41%), Postives = 325/897 (36.23%), Query Frame = 2
Query:   89 CGLIEKKACCLGWSGKKCNEPVCEKG--CGPGKCIEPNICDCRETNRFGQQCERFGAEVA---------------------SVSQNIELTDQ---------AQCTYLNGRSYKTFDRVKTVQTNFTGNMV--LVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQG-VKVGNISYSFPY-SKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDL----DFIKI----------WLSVSRENRMKPDPAIQMVNCDLNEMAT---CAKVVSIFGSKFEEICYAEFCQMKNQKNS-CELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDK--MKKGCQNCLCESRGLWKCDT------------------HDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEI------SVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEV-------CG--KFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDR-CNT-CTC-INGLWNCTTKDCSSQSYC 2494
            C   E+K  C G   + C   VC++G     G CI    C C    R+    ++F A+ A                     SV++   + D          A CT      Y TFD  +    NF G  V  L   C   P      V  +    N+ S     T    F        +S +   K+     + P  S  E  +   G    ++    + I Y+   ++ V  P      +CGLCG Y+G   D     +    P E  L        +          W     +++ K   A Q      +E      C K V    + + E C  + CQ      S C+ +           I +  WR +  C    CP    ++ C + C   C   N    C   C+  C C +      + C    +C C Y     Q     + +   M+K    C+C   G   C                    H +   +C+ +GDPH+ +FD Q    +G C Y  V+ K  + +  QL+              T  +G    +G G    ++ +     V +N++ + +P  ++KG         + F  T  GLK+    ++ V        E+++ + Y  K+ GLCGN+N    D+  +P G   K+ +E    + +        L +   G CE      + AN V       CG  K   G F+ C + +    +V+ C  DVC  G  +        C++  AY   C   G+Q Q WR+  FCP  CP N  Y+ C  +C  TC    Q+  C   C +GC+C    V +     CV +E+C C + GR    N+   D+ C + C C  +GL  C    CSS   C
Sbjct: 1529 CPFPEQKQTCSGACVEAC---VCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRF---NFQGTCVYQLAGLCSQHPGLVPFNVTVENE--NRGSKAVSFTKTVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDP--AAYVEDCVYDVCQFHGHHGSVCKAVEVYLSACQSQGIPIHPWRTQAFCPM-ECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPEDTCMEK----CICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVY--VLAKVCDDNDNQLT------------PFTVTQG-NAKYGNG----KVSVTKSVTVTVNNEELNLPLSLDKGRLTVTREGHNTFVRTDFGLKVLYDTVYYV--------EVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVD-------LPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSKEIL-----CNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFD--GAQCVPLENCGCVHDGRYLTVNQVVVDKDCQSRCVCEASGLVKCQRLSCSSTEVC 2369          

HSP 3 Score: 144.436 bits (363), Expect = 8.025e-34
Identity = 130/478 (27.20%), Postives = 197/478 (41.21%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDMNLICDPN-SCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTC-RSGKWECPKRDC-------------------EGLCKAWGESHYMSFDGKFFDFHGDCSYVLLE--DYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPI-IGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS---CPYPEISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPL--CTCKDESGKEYPLGTTVI-KNCH-KCTCQINGF 3811
            CP    +  C  GC  TC  +N +   +  C   C C+ G +   + C+P  +C C +  Q + +  V       C   C C  +G   C K  C                   EG C A G+ HY SFDG+ FDF G C YVL +  D  + +   F +   N + G+   S TKS+     +  ++L     P+ + +        G   F + D+          LK+ +D    V+V +   Y+  +CGLCGN++    ++ R   G    +VN F  SW +      C   E     C+         +  C I+K+    F+ CH+ +    Y   CV D CA     + L  C ++  YV  C    ++IQ WR+   CP  CPP+  Y+ C   C  TC   I   +C   C EGC C         +CV   PL  C C  + G+   +   V+ K+C  +C C+ +G 
Sbjct: 1899 CPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRDCGCSYNGQYYQKGDVFYPED-TCMEKCICGENGAVSCQKEKCRRGETCKLVNGVKGCHPEEEGKCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYGNGKVSVTKSVTVTVNNEELNL-----PLSLDKGRLTVTREGHNTFVRTDF---------GLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNEFGKSWVVDLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSKEIL--CNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGAQCV---PLENCGCVHD-GRYLTVNQVVVDKDCQSRCVCEASGL 2355          

HSP 4 Score: 142.124 bits (357), Expect = 4.504e-33
Identity = 157/680 (23.09%), Postives = 264/680 (38.82%), Query Frame = 2
Query:  539 KVGNISYSFPYSKAEFQISDRGHYVYVKGIK-------DLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMV-----NCDLNEM----------ATCAKVVSIFG--------SKFEEICYAEFCQMKNQKNS-CELMRDIAFLSSPDNIV-SDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESR-GL-----WKCDTHDQC-------------SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCH-GEVLRQSYLGLCETSIEWGKIANEVCGKFGQ--GQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATC-RLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANE 2407
            +VG ++ +       FQ+ D    V+  G          L + Y+    + +  P +    VCGLCG ++G+  D+ +  + S   + + +++ K W +  ++   K  P           CD +E              AK  S+F           F   C  + C  K  K   C+ +         + I+  DWR + +C   NC     +  C + C   C F      CS  C   C C + +      C  A  C C Y+          + D+     + C+C++  G+       C  +++C              + C  +GDPH+ TFD +    +G C Y           +   ++ VEN+    S+ ++  K +   ++G  L      I  +    +N +L  +P K N   E++VF   S  + IE     ++     S + + + + Y   + GLCGN+NG   DD  M +G    D+++L   +++          +  +   C  S +    A++ CG      G F++C   V    +V  C +DVC      +  ++   C A   Y   C  +GI    WRT  FCP+ CP N  Y  C S C  TC  +     C   C + C+C    ++   T  CV V DC C Y G+ Y   +
Sbjct: 1310 QVGQVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQ--NPSGKAVASVIEWGKSWQTPDQD---KGHPCWDTCEKNCPTCDDDERELYKTQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMCLNKGDKRMLCQALTSYNKQCRDEGIIIKDWRKEFNCPM-NCQRFSHYEHCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACS--RLCVCDTTLGMVTCREASCSVNEKCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGLVPFNVTVENEN-RGSKAVSFTKTVTFSIYGSTLT-----ISKENPYKLNGQLAALPLKSND--ELAVFLSGSQAV-IETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQ--FHGHHGSV---CKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDT--CVPVRDCGCSYNGQYYQKGD 1965          

HSP 5 Score: 131.724 bits (330), Expect = 6.858e-30
Identity = 125/459 (27.23%), Postives = 182/459 (39.65%), Query Frame = 2
Query: 2570 NSCEPGCYCESGEVYDNNKCIPKGECPC------------FWQNQSFNESAV--ITRGPFEC-QLSCTCRSGKWECPKRDCEGLCK--------AWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT--FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNP----CDINKFRESWAIKRCSILKSET--FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCIGTKS---CISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKN---CHKCTCQING-FECEKE 3826
             +C   C C+ G V     CIP   C C            FW +++ +   V   T G   C + SC+      +C  +D E +C+        A G+ HY +FDG+ F+F G C Y  L   C++  G   F + +EN   GSK  S TK++ F      + + +     +       P       +     S  VI T   + I +D   +V V +   Y   +CGLCGN++    +D+  + G    D     +SW++ +        + P    C  ++ +   A + C I+  ET  F  CH  V    Y + CV D C          VC A+  Y+  C    I I  WR    CP+ CP +  Y  C   CP TC    S   C   C E C C     +  D CV  +  C C   +G+ Y  G           KC C  NG   C+KE
Sbjct: 1540 GACVEACVCDEGYVLSAGVCIPAKTCGCSYQGRYYTPGQQFWADEACSRLCVCDTTLGMVTCREASCSVNE---KCIIQDGERVCQPISYATCTASGDPHYHTFDGRRFNFQGTCVY-QLAGLCSQHPGLVPFNVTVENENRGSKAVSFTKTVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGSQAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAKLGESWQVASVPGCSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKFVDPAAYVEDCVYDVCQFHGHHG--SVCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCASINSLTTCHMHCSEACECDQGHLMSGDTCVPVRD-CGCS-YNGQYYQKGDVFYPEDTCMEKCICGENGAVSCQKE 1990          

HSP 6 Score: 126.716 bits (317), Expect = 2.427e-28
Identity = 129/491 (26.27%), Postives = 211/491 (42.97%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDM-NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTC---------------------RSGKWECPKRD--------------CEG-----------LCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT--FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIR---GAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKL----KTSCPYPEISKN--PCDINKFRESWAIKR-CSILKSET---FEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQ-WRNYENCPIMCPPDREYKPCEKVCPETCI---GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLG 3760
            CP    ++ C   C  +C  + +++  P +C  GC C++G +YD   C+ + EC C+ + +++    V      +C L+C+C                     + G  EC  +D               EG            C AWG+ HY +FDG  FDF G C Y++ +  C   +G   F I   N   G+   S  + +  +  D+ I + +   G   + G        LG    S     SS V+ TK  L + +D    + + L   Y ++VCGLCGNF+ +  ++L+N +G   A V  +  SW+     K    +    KN   CD ++ RE +  +  C  L ++T   F+ C++ +  Q + + CV D C  ++GD  + +C A++ Y  +C    I I+ WR   NCP+ C     Y+ C   C  +C      ++C   C+E C C     L    C+  K  C C  + G+ Y  G
Sbjct: 1095 CPANSHYEVCAETCTYSCPGLSDMVQCPEACTEGCVCDAGFLYDGQTCVKETECGCYDRGKTYKPGEVTYEE--DCSLACSCNPATGLICEEYSCPEDTQCMIKKGVKECYNKDPCKDANCRVQETCRVEGGEAVCIPKYTSTCWAWGDPHYHTFDGFDFDFQGTCKYIISKT-CGNLNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQSGSSAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVASVIEWGKSWQTPDQDKGHPCWDTCEKNCPTCDDDE-RELYKTQAFCGGLAAKTNSVFKICNSKLDPQAFMNNCVYDMCL-NKGDKRM-LCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCPFPEQKQTCSGACVEACVCDEGYVLSAGVCIPAK-TCGCSYQ-GRYYTPG 1577          

HSP 7 Score: 121.709 bits (304), Expect = 8.166e-27
Identity = 105/374 (28.07%), Postives = 154/374 (41.18%), Query Frame = 2
Query: 2711 CQLS--CTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKS--GTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRG-AAPIIGRNPTWSP--YLGTGIFSKHDYVSSIVIITK-ELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPC----------DINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCI---GTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTT 3766
            C LS  C  ++G   C  +   G C A G+ HY +FDG+ FDF G C+YV+ ++ C + S    F++  +N   GS   S    +     D  I  +R     +   N  WS    L  G         S+VI     L +++D   ++ V L   Y    CGLCGNF+ N  +D    +G   +   AF  SWK+      P+  +N C           +NK+    +    +  ++  F+ CH  +  + Y + C  D C        L  C A+  Y   C    ++I  WR    C   CP + +Y+ C   CP TC        C   C+E C CK    L   ECV     C C  + G+  P G T
Sbjct:   23 CSLSEVCEMKNGSPLCVPQSKMGTCWAMGDPHYRTFDGQRFDFMGTCTYVIAKN-CGEDSRLTAFEVHAQNENRGSHRVSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADFGLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAVAFGSSWKVPGLVADPQC-RNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNCHAIIDPKAYLENCKYDLCMGKGLRQFL--CNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDPDAPSKCQRPCVETCTCKEGFVLSGSECVPATK-CGCTYD-GRYIPAGQT 390          

HSP 8 Score: 82.4185 bits (202), Expect = 6.418e-15
Identity = 106/492 (21.54%), Postives = 184/492 (37.40%), Query Frame = 2
Query:  527 SQGVKVGNISYSFPYS--KAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENR----MKPDPAIQMVNCDLNE-MATCAKVVSIFG------SKFEEICYAEFCQMK------NQKNSCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQN-CLCESRGLWKC-----DTHDQCSSR------------CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARY 1888
            S  V V N   + P S  K    ++  GH  +V+    L + Y+    + V  P T + ++CGLCG Y+    D+F          +   +F K W+    E+      +  P  +  N  L E + +C  + +  G      SK +   Y   C         +++  C  ++          + +  WR    C   +CP    +  C + C   C      + CS+ C  GC C   F +   QC   + C C +      ++       + K CQ+ C+CE+ GL KC      + + C  R            C I+      +FD     VE Q   + V     E+      ++V+ + C        A  + + F    N+  + + S+  + +N K V+ P+ +   + + V   +   + I+      V       + + +    A KV G CGN+N + EDD    DG    D S +   +
Sbjct: 2074 SVTVTVNNEELNLPLSLDKGRLTVTREGHNTFVRTDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGT--KNVNEFGKSWVVDLPEHICGGCEEDCPVCEKANAVLYEKLDSCGIMKAPDGPFQACHSKIDPAAYVSDCVFDVCAAGGSKEILCNSVQAYVLACQNAGVQIQPWRSSSFCPA-SCPPNSHYEVCADTCRGTCASFIQQLTCSESCFEGCECDAGFVFDGAQCVPLENCGCVHDGRYLTVNQVV----VDKDCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQ-GAVEVASLCDETSENWFRVVVDVRVCHKKSAFAPAT-VHVFF----NEATVTVNSQHGIWVNGKKVSPPNNLTNQLSVQVLDRS---VVIQRKSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSW 2549          

HSP 9 Score: 65.0846 bits (157), Expect = 1.061e-9
Identity = 64/285 (22.46%), Postives = 115/285 (40.35%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDM--NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCR-SGKWECPKRDCEG--LCKAWG--------ESH-YMSFDGKFFDFHGDCSYVLLE------DYCNKKSGT-FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKE-LKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLK 3277
            CP    ++ C   C+ TC      L C   SC  GC C++G V+D  +C+P   C C    +    + V+     +CQ  C C  SG  +C +  C    +C   G        ++H  +S  G+   F G  + V  +        C++ S   F++V++   C  K      ++  ++ +  + +       +       P   T   S      S+VI  K  +++ +     V V +     + VCG CGN++   ++DL+   G +  D++    SW  +
Sbjct: 2271 CPPNSHYEVCADTCRGTCASFIQQLTCS-ESCFEGCECDAGFVFDGAQCVPLENCGCVHDGRYLTVNQVVVDK--DCQSRCVCEASGLVKCQRLSCSSTEVCDVRGGVRSCHIKQAHCTISHAGQLSSFDGMTAAVEAQGAVEVASLCDETSENWFRVVVDVRVCHKKSAFAPATVHVFFNEATVTVNSQHGIWVNGKKVSPPNNLTNQLSVQVLDRSVVIQRKSAVRVTYSVSQEVTVTVDNSLASKVCGACGNYNSESEDDLKTADGKVTTDMSVVIGSWSAE 2552          
BLAST of Hemocytin vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 253.447 bits (646), Expect = 9.275e-67
Identity = 290/1225 (23.67%), Postives = 489/1225 (39.92%), Query Frame = 2
Query:  326 YKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFL-----FKDSIEATYLSSQGVKVGNISYSFPYSKA-EFQISDRGHYVYVKGIKDLNIFYNKKGSIFV-FAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSK---------------FEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQ-NCLCESRGLW----KCDTHDQCSSR------------CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEIS-----VFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGL-CETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQ-WRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSG-KWECPKRDCE------------------GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVE--CGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGR---NPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIG-TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLG 3760
            Y TFD+ K    NF GN   V   +    +     +  ++    +S     TI +L     +   ++ + L    V+V   + + P +   E  +   G +  V     + + Y+  G+ F+    +  + ++CGLCG Y+GN  D F+  D +M       +F   W      +     P   +  C+  E         I   K               + + C  + C+++  K   CE +           + +  WR +  C +  CP+   +  C + C + C        C   C+ GC C   +     +C ++D C C++  +  Q       +   + C+  C C+S  +      C    +C  +            CI++GDPH+ TFD +     G C Y   + +   +D P  S+  +N+        +    +K L+   +N   + +      ++N K V  P   +  + +S     V   T+ GL++         R D +    +    Y  ++ GLCG+++G+  +D   PDG PA + ++    ++ T+    E    +   L C+  +E   I  + CGK     G F +C  +V  + F   C +D+C     +    ++  C    AY   C   G     WR P+FC + CP N  Y  C SSC  TC  +   P C++ C++GC+C    ++ +    CV ++DC C      Y+                               CP    + +CG  C  TC++ +  C   SC  GC+C+ G V+   +C+P  +C C  ++ ++ E   +  G   C   C C      EC    C+                    C A G+ HY +FD   +DF G+CSYV+    CN  S  F  V  + E    S   S  K++  Y     I +++G    +     N   +P     +F    + +  V +T  + +++D    +D+ +  +Y++ +CGLCG+++ N  +D +   G +  D N F  SW        P  +   C+  +  +      C IL  K+  F  CH  V    Y+  C+ D C  +     LC   AI  YV+EC    + I  WRN   C + CPP+  Y+PC   C +TC G   SC   C EGC C     L   +CV ++  C CK  +G+ Y  G
Sbjct: 1423 YTTFDKRKY---NFMGNCSYVMSGICNATSLPFFEVHADNENRYNSP----TISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYTVSMTFGVTVRYD--GNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTM--TNDANEFGHSW----NTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLK--CPSNSHYEPCADPCQDTCSGKPSS--CGGACSEGCVCDPGYVLSAGKCVKSDSCGCKH--TNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQDCIVSGDPHYNTFDKKFYSFMGTCTY--TLARTCRNDSPWFSVEGKNE----ERGASGVSYLKKLYVT-VNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRV---------RWDGNHHAQISVPSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQ-TEEDEDECSPGTTPDLDCDPELEAEVIKPDKCGKIEDPSGPF-ECIGVVDPEPFFQSCVYDMC-----QFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVIGSPGCEDVCVEGCECDPGFILSDD--KCVPLKDCGCVDTSGTYHPP-----------------------------CPPNAEYIECGPACIPTCQEPSTNCS-GSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGD-GCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVM-SGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT--VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGE--QELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILC--EAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPSSCGGACSEGCVCDPGYVLSAGKCV-KRESCGCKHTNGQYYEPG 2559          

HSP 2 Score: 148.673 bits (374), Expect = 5.868e-35
Identity = 127/452 (28.10%), Postives = 197/452 (43.58%), Query Frame = 2
Query: 2492 CPNGKVWKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSG-KWECPKRDCE------------------GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVE--CGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGR---NPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIG-TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLG 3760
            CP    + +CG  C  TC++ +  C   SC  GC+C+ G V+   +C+P  +C C  ++ ++ E   +  G   C   C C      EC    C+                    C A G+ HY +FD   +DF G+CSY L+   CN  S  F  V  + E    S   S  K++  Y     I +++G    +     N   +P     +F    + +  V +T  + +++D    +D+ +  +Y++ +CGLCG+++ N  +D +   G +  D N F  SW        P  +   C+  +  +      C IL  K+  F  CH  V    Y+  C+ D C  +     LC   AI  YV+EC    + I  WRN   C + CPP+  Y+PC   C +TC G   SC   C EGC C     L   +CV ++  C CK  +G+ Y  G
Sbjct:  322 CPPNAEYIECGPACIPTCQEPSTNCS-GSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGD-GCSKLCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSY-LMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT--VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGE--QELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILC--EAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPSSCGGACSEGCVCDPGYVLSAGKCV-KRESCGCKHTNGQYYEPG 761          

HSP 3 Score: 147.517 bits (371), Expect = 1.348e-34
Identity = 126/453 (27.81%), Postives = 185/453 (40.84%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGL------------------CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFS---KHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKT---SCPYPEISKNPCDINKFRESWAIKRCSILK--SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPL 3757
            CP    ++ C   CQ TC      C   +C  GC C+ G V    KC+ +  C C   N  + E         +C+L C C S    C   DC  +                  C   G+ HY +FD K++ F G C+Y L    C   S  F +  +N E G+ G S  K +     D  + L++    ++       P+  + + S      YV  I+  T  L+++WD      + + P Y + +CGLCG++D N  ND     G    +VN F +SW+ +     C         CD     E     +C  ++  S  FE C   V  + ++  CV D   C    +   +C  +  Y   C      +  WR  + C + CP +  Y  C   CPETC   +G+  C   C+EGC C     L DD+CVS K  C C D SG  +P 
Sbjct: 2495 CPPNSHYEPCADPCQDTCSGKPSSCG-GACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVE-DCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVSGDPHYNTFDKKYYSFMGTCTYTLART-CRNDSPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYV--ILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFE-CIGVVDPEPFFQSCVYD--MCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKD-CGCVDTSGTYHPF 2936          

HSP 4 Score: 144.821 bits (364), Expect = 7.485e-34
Identity = 182/781 (23.30%), Postives = 300/781 (38.41%), Query Frame = 2
Query:  131 GKKCNEP-VCEKG--CGPGKCIEPNICDCRETN-RFGQQCERFGAE---------------VAS--------VSQNIEL---TDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQ-ISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKP--------DPAIQMVNCDLNEMATCAKVVSIFGS----------KFEEICYAEFCQMKNQKNSC--ELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDK-MKKGC-QNCLCESRGLWKC---------------DTHDQCSSR---CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAK-------GIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRL------TQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMV 2221
            G  C+E  VC+ G     GKC++   C C+ TN ++ +  E F  E               VAS          Q+ EL        C       Y TFD+ K      T    L + C +  P + +    +E   +  S    +   ++  + I  T + S+   V     +FP++ +    +S  G YV ++    L + ++      +  P +   Q+CGLCG YDGN  + F   D +  P     DF   W +   E+   P        DP ++    ++ +   C K+  + G            F + C  + CQ   + +    +L        S    V  WR    C +  CP    +S C ++C   C        C  VC  GC C   F    ++C    +C C    ++     ++  D+ + +GC Q+C C S G  +C               D   +CS     C ++GDPH+ TFD +     G C Y         SD+P  ++  +N+   ++  ++  +       G+ ++FG+G +           V +N  +V  P     GV+I     +   + +EA     V    +   ++ L + Y+  + G+C NFN +P DDN+ PD  PA + +EL   + +      T     E   +      +     G I +          FK C A+VP + +   C +D+C  G    A      C A  +YA IC+  G+   WR   FC  +C K  V
Sbjct: 2520 GGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVSGDPHYNTFDK-KYYSFMGTCTYTLARTCRNDSPWFSVEGKNEERGASGVS---YLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGT--PAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEA---EVTKPDKCGKIEDLSGPFECIGVVDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCLD--CPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKDCGC--VDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLTKLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMTVVFGKGRS-----------VQVNGTVVVPPVSSISGVKI---YFSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSWAVPDPRPCTNGGGQEECDEKVEEEAQKPTSCGMITDP-------NIFKPCHAVVPPEPYFENCVYDMCATGGQTVAL-----CQALESYADICAAAGVNIPWRNSTFC--VCNKTQV 3257          

HSP 5 Score: 143.28 bits (360), Expect = 2.595e-33
Identity = 124/456 (27.19%), Postives = 185/456 (40.57%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGL------------------CKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFS---KHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKT---SCPYPEISKNPCDINKFRESWAIKRCSILK--SETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETC---IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTT 3766
            CP    ++ C   CQ TC      C   +C  GC C+ G V    KC+ +  C C   N  + E         +C+L C C S    C   DC  +                  C   G+ HY +FD  ++ F G C+Y L    C   S  F +  +N E G  G S  K +     +  + L++    ++       P+  + + S      YV  I+  T  L+++WD      + + P Y + +CGLCG++D N  ND     G    +VN F +SW+ +     C         CD     E     +C  ++  S  FE C   V  + ++  CV D   C    +   +C  +  Y   C    + +  WR  + C + CP +  Y  C   CPETC   +G+  C   C+EGC C     L DD+CV  K  C C D SG  +P  +T
Sbjct:  697 CPPNSHYEPCADPCQDTCSGKPSSCG-GACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVE-DCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQDCIVSGDPHYNTFDKNYYTFMGTCTYTLART-CRNDSPWFSVEGKNEERGVSGVSYLKKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYV--ILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPFE-CIGVVDPEPFFQSCVYD--MCQFNGELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVPLKD-CGCVDTSGTYHPRPST 1141          

HSP 6 Score: 139.813 bits (351), Expect = 2.683e-32
Identity = 122/443 (27.54%), Postives = 192/443 (43.34%), Query Frame = 2
Query: 2510 WKDCG-GCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSG-KWECPKRDCE------------------GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVE--CGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGR---NPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSIL--KSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIG-TKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEY 3751
            + +CG  C  TC++ +  C   SC  GC+C+ G V+   +C+P  +C C  ++ ++ E   +  G   C   C C      EC    C+                    C A G+ HY +FD + ++F G+CSYV+    CN  S  F  V  + E    S   S  K++  Y     I +++G    +     N   +P     +F    + +  V +T  + +++D    +D+ +  +Y++ +CGLCG+++ N  +D +   G +  D N F  SW        P  +   C+  +  +      C IL  K+  F  CH  V    Y+  C+ D C  +     LC   AI  YV+EC    + I  WRN   C + CP +  Y+PC   C +TC G   SC   C EGC C     L   +CV     C CK  +G+ Y
Sbjct: 1308 YIECGPACIPTCQEPSTNCS-GSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGD-GCSKLCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVM-SGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYT--VSMTFGVTVRYDGNHFMDIKVI-KYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPCNKQPNATIPGCEPGE--QELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILC--EAIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTCSGKPSSCGGACSEGCVCDPGYVLSAGKCVKSDS-CGCKHTNGQYY 1738          

HSP 7 Score: 134.806 bits (338), Expect = 9.063e-31
Identity = 136/505 (26.93%), Postives = 206/505 (40.79%), Query Frame = 2
Query: 1139 VDCSKVCTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGCQNCLCESRGLW-------KCDTHDQC------------SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSV-FRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYM-GRDYNANEE--RKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPN 2572
             +CS  C  GC+C+  F +   +C   ++C C +   +  +      GD   K     LC   G +        CD  ++C            +S CI +GDPH+ TFD       G C Y+        S +P   +  +N+  +NS  I+  K + +     ++  +I I     V +N   V +P  +N   E+SVF+    G        F V  R D +    +   KY  K+ GLCG++NG+ +DD   PDG    D +E    +  T  C+ +    + +  CE   +  ++    CG      G F  C   V  + +   C  D+C    L  A  I CE  A  AY   C  +G+    WR   FC + CP N  Y+ C   C  TC  +   +C   C +GC C    V+    G CVK E C C++  G+ Y   EE   +D    C C +    C   DC     C   K+     GC  + +D  +  DP+
Sbjct: 2142 TNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSK-----LCRCAGNYTLECTDNSCDPSEECREVNGIPSCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTS-LPFFEVHADNENRYNSPTISYLKAVHVY----VHMVKISILKGGVVQVNGTNVNLP--LNPAPEVSVFQ---SGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWN-TDPCNKQ--PNATIPGCEPGEQ--ELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCE---LEGAKPILCE--AIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPS-SCGGACSEGCVCDPGYVL--SAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC---KLQDGELGCYPSSQDCIVSGDPH 2614          

HSP 8 Score: 133.265 bits (334), Expect = 2.208e-30
Identity = 136/505 (26.93%), Postives = 206/505 (40.79%), Query Frame = 2
Query: 1139 VDCSKVCTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGCQNCLCESRGLW-------KCDTHDQC------------SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSV-FRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYM-GRDYNANEE--RKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPN 2572
             +CS  C  GC+C+  F +   +C   ++C C +   +  +      GD   K     LC   G +        CD  ++C            +S CI +GDPH+ TFD       G C Y+        S +P   +  +N+  +NS  I+  K + +     ++  +I I     V +N   V +P  +N   E+SVF+    G        F V  R D +    +   KY  K+ GLCG++NG+ +DD   PDG    D +E    +  T  C+ +    + +  CE   +  ++    CG      G F  C   V  + +   C  D+C    L  A  I CE  A  AY   C  +G+    WR   FC + CP N  Y+ C   C  TC  +   +C   C +GC C    V+    G CVK E C C++  G+ Y   EE   +D    C C +    C   DC     C   K+     GC  + +D  +  DP+
Sbjct:  344 TNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSK-----LCRCVGNYTLECTDNSCDPSEECREVNGVPGCYPKTSTCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATS-LPFFEVHADNENRYNSPTISYLKAVHVY----VHMVKISILKGGVVQVNGTNVNLP--LNPAPEVSVFQ---SGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWN-TDPCNKQ--PNATIPGCEPGEQ--ELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCE---LEGAKPILCE--AIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPS-SCGGACSEGCVCDPGYVL--SAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC---KMQDGKLGCYPSFQDCIVSGDPH 816          

HSP 9 Score: 128.257 bits (321), Expect = 7.907e-29
Identity = 132/506 (26.09%), Postives = 203/506 (40.12%), Query Frame = 2
Query: 1139 VDCSKVCTPGCYCRKDFFWYKNQCKRADECPC-EYRASAKQIDSYKFGDKMKKGCQNCLCESRGLW-------KCDTHDQC------------SSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSV-FRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDY---NANEERKDRCNT-CTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPN 2572
             +CS  C  GC+C+  F +   +C   ++C C +   +  +      GD   K     LC   G +        CD  ++C            +S CI +GDPH+ TFD +     G C Y+        S +P   +  +N+  +NS  I+  K + +     ++  +I I     V +N   V +P  +N   E+SVF+    G        F V  R D +    +   KY  K+ GLCG++NG+ +DD   PDG    D +E    +  T  C+ +    + +  CE   +  ++    CG        F  C   V  + +   C  D+C    L  A  I CE  A  AY   C  +G+    WR   FC + CP N  Y+ C   C  TC  +   +C   C +GC C    V+    G CVK + C C++    Y      E   + C   C C +    C   DC     C   K+     GC  + +D  +  DP+
Sbjct: 1324 TNCSGSCISGCFCKPGFVFKGPRCVPIEKCGCLDEDGNYYEPGEVVLGDGCSK-----LCRCAGNYTLECTDNSCDPSEECREVNGIPGCYPKTSTCIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATS-LPFFEVHADNENRYNSPTISYLKAVHVY----VHMVKISILKGGVVQVNGTNVNLP--VNPTPEVSVFQ---SGKHYTVSMTFGVTVRYDGNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWN-TDPCNKQ--PNATIPGCEPGEQ--ELYEGYCGILLDKNSPFAVCHGKVNPNNYFQDCLFDLCE---LEGAKPILCE--AIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTCSGKPS-SCGGACSEGCVCDPGYVL--SAGKCVKSDSCGCKHTNGQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHEC---KLQDGELGCYPSIQDCIVSGDPH 1797          

HSP 10 Score: 127.487 bits (319), Expect = 1.287e-28
Identity = 152/675 (22.52%), Postives = 274/675 (40.59%), Query Frame = 2
Query:  491 LFKDSIEATYLSSQGVKVGNISYSFPYSKA-EFQISDRGHYVYVKGIKDLNIFYNKKGSIFV-FAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSK---------------FEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMK-KGCQ-NCLCESRGLW----KCDTHDQCSSR------------CIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEIS-----VFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGL-CETSIEWGKIANEVCGKF--GQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC 2374
            ++   ++ + L    V+V   + + P + A E  +   G +  V     + + Y+  G+ F+    +  + ++CGLCG Y+GN  D F+  D +M       +F   W      +     P   +  C+  E         I   K               + + C  + C+++  K   CE +           + +  WR +  C +  CP    +  C + C + C        C   C+ GC C   +     +C + + C C++         Y+ G++   + C+  C C+S  +      C    +C  +            CI++GDPH+ TFD  +    G C Y   + +   +D P  S+  +N+       ++    +K L+    N T   +KS+T  ++N K V  P   +  + +S     V   T+ GL++         R D +    +    Y  ++ GLCG+++G+  +D   PDG PA + ++    ++ T+    E    +   L C+  +E      + CGK     G F +C  +V  + F   C +D+C     +    ++  C    AY   C   G+    WR P+FC + CP N  Y  C SSC  TC  +   P C++ C++GC+C    ++ +    CV ++DC C
Sbjct:  496 VYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYD--GNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTM--TNDANEFGHSW----NTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLK--CPPNSHYEPCADPCQDTCSGKPSS--CGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQY----YEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKMQDGKLGCYPSFQDCIVSGDPHYNTFDKNYYTFMGTCTY--TLARTCRNDSPWFSVEGKNE----ERGVSGVSYLKKLYVTVNNITVTLMKSRT-TLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRV---------RWDGNHHAQISVPSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQ-TEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDPSGPF-ECIGVVDPEPFFQSCVYDMC-----QFNGELHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDD--KCVPLKDCGC 1128          

HSP 11 Score: 126.716 bits (317), Expect = 2.222e-28
Identity = 164/744 (22.04%), Postives = 273/744 (36.69%), Query Frame = 2
Query:  467 DCEITIKFLFKDSIEATYLSSQGVKVGN---ISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPD--PAIQMVNCDLNE----MATCAKVV----------SIFGSKFEEICYAEFCQMKN-QKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLC-ESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKI-LFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPN-CD-NDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYD 2617
            D  +  K   +   EA+Y+ S  V + N   +           ++   G Y  +     L + ++    + +  P     ++CG+CG Y  N D   + +     P +  ++    W S    +  +PD  P +   NC   E     A C +V+           +    F   C  + C+    Q   C+ +   A       +   WR    C    CP    +S                 DC+  C P C      F +       + C C           Y   D        C C  S G +    HD    RC ++GDPH+ TFD      +G   Y+      ++  +  L +  +N     ++ ++    + + ++G      ++    K  V++N + VT P    +G+ I++    S  +++   D     R D     ++L   Y+  V GLCGN++G   ++ + PDG   +D +E    +R+++    +         C  S      +   CG     +G F  C A +P  +    C  D+C         +    C++Y AYA IC   G++   WR    C + CP N  Y  C S C ++C     P+ CD   C++GCQC    V+ E  G CV   +C C ++ R Y  NE                N  T+DCS                C  T   +  +C P +C+ G  C    +YD
Sbjct: 3259 DFRVVAKNEERGQPEASYVRSVKVFLLNGRRVRTPLTIDTIGAKVITSGSYSLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNY--NHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHP-NCTAEEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQATLCDNVEAYAQACQSAGVTITWRNSTFCLP--CPPNSHYS-----------------DCTAPCPPTCSDLFPIFCHLPPTACVEGCECNA--------GYVLSDGKCVSLDKCGCVGSDGEY----HD--FDRCTVSGDPHYRTFDGFTHHYQGPYTYVLTQDHNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYG-----VDVRFLQKKTVLVNGERVTPPLSPVRGLTITM---NSKQMQLTT-DFGLTVRFDGKSRGVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPP-QIYQDCVFDLC-----AEDGSEELRCASYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCADLAAPSECDATACVEGCQCAAGFVMSE--GACVPYPECGCTFLDRYYPLNE----------------NFVTEDCSQS--------------CVST--SIGAVCQPKTCQAGYVC---TIYD 3913          

HSP 12 Score: 124.405 bits (311), Expect = 1.275e-27
Identity = 149/675 (22.07%), Postives = 270/675 (40.00%), Query Frame = 2
Query:  491 LFKDSIEATYLSSQGVKVGNISYSFPYSKA-EFQISDRGHYVYVKGIKDLNIFYNKKGSIFV-FAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSK---------------FEEICYAEFCQMKNQKN-SCELMRDIAFLSSPDNI-VSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMK-KGCQ-NCLCESR----------GLWKCDTHD------QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEIS-----VFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGL-CETSIEWGKIANEVCGKFG--QGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQF-QWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKC 2374
            ++   ++ + L    V+V   + + P + A E  +   G +  V     + + Y+  G+ F+    +  + ++CGLCG Y+GN  D F+  D +M       +F   W      +     P   +  C+  E         I   K               + + C  + C+++  K   CE +           + +  WR +  C +  CP    +  C + C + C        C   C+ GC C   +     +C + + C C++         Y+ G++   + C+  C C+S            + +C   D        S  CI++GDPH+ TFD ++    G C Y   + +   +D P  S+  +N+        +    +K L+   +N   + +      ++N K V  P   +  + +S     V   T+ GL++         R D +    +    Y  ++ GLCG+++G+  +D   PDG PA + ++    ++ T+    E    +   L C+  +E      + CGK     G F +C  +V  + F   C +D+C     +    ++  C    AY   C   G     WR P+FC + CP N  Y  C SSC  TC  +   P C++ C++GC+C    ++ +    CV ++DC C
Sbjct: 2294 VYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYD--GNHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGTM--TNDANEFGHSW----NTDPCNKQPNATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCLK--CPPNSHYEPCADPCQDTCSGKPSS--CGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQY----YEPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSQDCIVSGDPHYNTFDKKYYSFMGTCTY--TLARTCRNDSPWFSVEGKNE----ERGASGVSYLKKLY-VTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRV---------RWDGNHHAQISVPSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQ-TEEDEDECSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPF-ECIGVVDPEPFFQSCVYDMC-----QFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDD--KCVSLKDCGC 2926          

HSP 13 Score: 110.153 bits (274), Expect = 2.522e-23
Identity = 112/457 (24.51%), Postives = 179/457 (39.17%), Query Frame = 2
Query: 2492 CPNGKVWKDCGG-CQRTCRDMNLI---CDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFY-------YKDHIIHLIRGAAPIIGR--NPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSV-------DVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC---PYPEISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKI-QWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSC----ISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVI 3772
            CP    + DC   C  TC D+  I     P +C  GC C +G V  + KC+   +C C   +  +++        F+                      C   G+ HY +FDG    + G  +YVL +D+     G+ K ++   +   +G +  K + F        Y   +  L +    + G    P  SP  G           +I + +K++++  D  L+V        V L   Y N+V GLCGN+D    N+     G +  D+N F DSW++       P      + C  ++  +  ++ +C  L      F  CH  +  Q+Y D CV D CA D  ++  C   +   Y   C    +K+  WR    C + CP +  Y  C   CP +C    +      + C+EGC C     + +  CV   P C C     + YPL    +
Sbjct: 3474 CPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEYHD--------FD---------------------RCTVSGDPHYRTFDGFTHHYQGPYTYVLTQDH--NLQGSLKPLMVRGKNLRRGGN--KRVSFLDEMYVNVYGVDVRFLQKKTVLVNGERVTPPLSPVRGL----------TITMNSKQMQLTTDFGLTVRFDGKSRGVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEFGDSWRVSRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPPQIYQD-CVFDLCAEDGSEELRCA--SYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCADLAAPSECDATACVEGCQCAAGFVMSEGACVP-YPECGCTFLD-RYYPLNENFV 3881          

HSP 14 Score: 100.138 bits (248), Expect = 2.425e-20
Identity = 96/397 (24.18%), Postives = 158/397 (39.80%), Query Frame = 2
Query: 2492 CPNGKVWKDC-GGCQRTCRDMNLICDP---NSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFE-CQLSCTCRSG-KWECPKRDCE-------------------GLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT--FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRN-----------PTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCS----ILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENC 3556
            CP    +  C   C  TC  + ++  P   + C  GC C+ G +  ++KC+   +C C   + +++   V      E C+ SC C SG + +C    C                    G+C   G+ HY +FD +   + G CSY L +  CN  S    F +  +N   GS       + +  Y   ++  + G   + G+            P  S   G  I+    +V  ++  +  L++++D     DV L   Y   +CG+C NF+DN  +D         A+ N   DSW +    P P  +    +    +     ++ +    I     F+PCH  V  + Y++ CV D CA   G   + +C A+  Y   C    + I WRN   C
Sbjct: 2871 CPANSSYSLCVSSCPETC--LGVVGSPGCEDVCVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQLQDGLYECSPLNGICSVSGDPHYTTFDKRTHHYMGACSYTLTK-LCNSSSDLPHFTVDTQNEHRGS-------NTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYFSGKFV--VLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMC-NFNDNPTDDNLKPDNTPAANSNELGDSWAVPD--PRPCTNGGGQEECDEKVEEEAQKPTSCGMITDPNIFKPCHAVVPPEPYFENCVYDMCA--TGGQTVALCQALESYADICAAAGVNIPWRNSTFC 3250          

HSP 15 Score: 93.9745 bits (232), Expect = 2.128e-18
Identity = 75/289 (25.95%), Postives = 122/289 (42.21%), Query Frame = 2
Query: 2870 CNKKSGT-FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSC----PYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC-----IGTKSCISDCMEGCYCKNNTYLKDDECVS 3706
            CNK   T F++V +N E G    S  +S++ +       L+ G      R P     +G  + +   Y  S++     L++++D    +++ +  EY N +CG+CGN++ +  +D          DV    +SWK +       P      +P    +  E +  +   ++ S +F PCH+ V    +   C+ D C  +     L  C  +  Y   C    + I WRN   C + CPP+  Y  C   CP TC     I      + C+EGC C     L D +CVS
Sbjct: 3252 CNKTQVTDFRVVAKNEERGQPEASYVRSVKVF-------LLNGRRV---RTPLTIDTIGAKVITSGSY--SLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPCQPDNRPDVHPNCTAEEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQATL--CDNVEAYAQACQSAGVTITWRNSTFC-LPCPPNSHYSDCTAPCPPTCSDLFPIFCHLPPTACVEGCECNAGYVLSDGKCVS 3525          

HSP 16 Score: 57.3806 bits (137), Expect = 2.499e-7
Identity = 98/420 (23.33%), Postives = 151/420 (35.95%), Query Frame = 2
Query:  131 GKKCNEP-VCEKG--CGPGKCIEPNICDCRETNRFGQQCERFGAE-------------------VAS--------VSQNIEL---TDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQ-ISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMA------TCAKVVSIFGS----------KFEEICYAEFCQMKNQKNSC--ELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPC 1234
            G  C+E  VC+ G     GKC++ + C C+ TN  GQ  E+ G E                   VAS          Q+ EL        C       Y TFD+ K      T    L + C +  P + +    +E   +  S    +   ++  + I  T + S+   V     +FP++ +    +S  G YV ++    L + ++      +  P +   Q+CGLCG YDGN  + F   D +  P     DF   W +   E+   P     + +CD    A       C K+    G            F + C  + CQ   + +    +L        S    V  WR    C +  CP    +S C ++C   C        C  VC  GC C   F    ++C    +C C
Sbjct: 1702 GGACSEGCVCDPGYVLSAGKCVKSDSCGCKHTN--GQYYEQPGEEFYVEDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSIQDCIVSGDPHYNTFDK-KFYSFMGTCTYTLARTCRNDSPWFSVEGKNEERGASGVS---YLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGT--PAGNVNDFGNSWQTEEDEDECSPGTTPDL-DCDPELEAEVIKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCLD--CPANSSYSLCVSSCPETCLGVIGSPGCEDVCVEGCECDPGFILSDDKCVPLKDCGC 2109          

HSP 17 Score: 56.9954 bits (136), Expect = 3.296e-7
Identity = 72/324 (22.22%), Postives = 121/324 (37.35%), Query Frame = 2
Query:  326 YKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQ-ISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKP--------DPAIQMVNCDLNEMATCAKVVSIFGS----------KFEEICYAEFCQMKNQKNSC--ELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPC 1234
            Y TFD+        T    L + C +  P + +    +E  V+  S    +   ++  ++I  T + S+   V     +FP++ +    +S  G YV ++    L + ++      +  P +   Q+CGLCG YDGN  + F   D +  P     DF   W +   E+   P        DP ++    ++ +   C K+    G            F + C  + CQ   + +    +L        S    V  WR    C +  CP    +S C ++C   C        C  VC  GC C   F    ++C    +C C
Sbjct:  817 YNTFDKNYYTFMG-TCTYTLARTCRNDSPWFSVEGKNEERGVSGVS---YLKKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVP-SYHDQMCGLCGDYDGNAGNDFTKPDGT--PAGNVNDFGNSWQTEEDEDECSPGTTPDLDCDPELEA---EVTKPDKCGKIEDPSGPFECIGVVDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGVTVHHWRAPDFCLD--CPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFILSDDKCVPLKDCGC 1128          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 2808.09 bits (7278), Expect = 0.000e+0
Identity = 1303/1303 (100.00%), Postives = 1303/1303 (100.00%), Query Frame = 2
Query:   68 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLCEKPLIIS 3976
            GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS
Sbjct:   20 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS 1322          

HSP 2 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 441/449 (98.22%), Postives = 442/449 (98.44%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVQTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVXXXXXXXXXXXXXXXXXXXLNVTTVSEQRSXXXXXXXXXQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 6342
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS      + TTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET
Sbjct: 7830 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS------LSTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 8272          

HSP 3 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 469/475 (98.74%), Postives = 473/475 (99.58%), Query Frame = 1
Query: 3976 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLIST+EYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTV+KVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1323 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLISTKEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVKKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 1797          

HSP 4 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 5 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5065 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5199          

HSP 6 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5354 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5488          

HSP 7 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5643 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5777          

HSP 8 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5907 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6041          

HSP 9 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6166 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6300          

HSP 10 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6968 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7102          

HSP 11 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7257 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7391          

HSP 12 Score: 258.84 bits (660), Expect = 1.666e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7521 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7655          

HSP 13 Score: 257.299 bits (656), Expect = 5.234e-68
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEI+KTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6425 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6559          

HSP 14 Score: 255.758 bits (652), Expect = 1.355e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVP NGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6684 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6818          

HSP 15 Score: 255.373 bits (651), Expect = 1.866e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKE KPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 16 Score: 251.906 bits (642), Expect = 2.311e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 17 Score: 251.906 bits (642), Expect = 2.311e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 18 Score: 251.906 bits (642), Expect = 2.311e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 19 Score: 251.906 bits (642), Expect = 2.311e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 20 Score: 251.906 bits (642), Expect = 2.311e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 21 Score: 250.366 bits (638), Expect = 7.257e-66
Identity = 130/135 (96.30%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTE+YVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          

HSP 22 Score: 136.346 bits (342), Expect = 2.206e-31
Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNV 5208
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETF +
Sbjct: 4851 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFKM 4921          

HSP 23 Score: 108.227 bits (269), Expect = 8.533e-23
Identity = 60/135 (44.44%), Postives = 85/135 (62.96%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKE P LIST EYVKE++ PK+GT   SLI + WN  +I   PKF + FY PV I+KI+ ENI+N+++FN++V   N   Y+   T L+V +  ++ E +   EKV  + I    +  + +VSLKV +EGC E E
Sbjct: 3566 CKETPYLISTNEYVKEVLTPKDGTPGFSLIEDSWNGVLISYNPKFILTFYVPVTISKIKIENILNLKSFNLIVRRHNNISYENLATNLLVPYPTQFVEFKSFTEKVEVLIINVFDNIKRNRVSLKVTVEGCVELE 3700          

HSP 24 Score: 59.6918 bits (143), Expect = 4.041e-8
Identity = 41/135 (30.37%), Postives = 69/135 (51.11%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  ++K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 25 Score: 58.5362 bits (140), Expect = 8.451e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 26 Score: 58.5362 bits (140), Expect = 8.451e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 27 Score: 58.5362 bits (140), Expect = 8.451e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 28 Score: 58.5362 bits (140), Expect = 8.451e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 29 Score: 58.5362 bits (140), Expect = 8.451e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 30 Score: 58.5362 bits (140), Expect = 8.739e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6425 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6559          

HSP 31 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 32 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5065 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5199          

HSP 33 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5354 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5488          

HSP 34 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5643 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5777          

HSP 35 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5907 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6041          

HSP 36 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6166 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6300          

HSP 37 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6968 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7102          

HSP 38 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7257 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7391          

HSP 39 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7521 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7655          

HSP 40 Score: 58.5362 bits (140), Expect = 9.267e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7830 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7964          

HSP 41 Score: 57.3806 bits (137), Expect = 1.752e-7
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6684 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6818          

HSP 42 Score: 56.9954 bits (136), Expect = 2.642e-7
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST++++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 2807.71 bits (7277), Expect = 0.000e+0
Identity = 1303/1303 (100.00%), Postives = 1303/1303 (100.00%), Query Frame = 2
Query:   68 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLCEKPLIIS 3976
            GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS
Sbjct:   20 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS 1322          

HSP 2 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 441/449 (98.22%), Postives = 442/449 (98.44%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVQTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVXXXXXXXXXXXXXXXXXXXLNVTTVSEQRSXXXXXXXXXQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 6342
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS      + TTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET
Sbjct: 7852 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS------LSTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 8294          

HSP 3 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 469/475 (98.74%), Postives = 473/475 (99.58%), Query Frame = 1
Query: 3976 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLIST+EYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTV+KVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1323 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLISTKEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVKKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 1797          

HSP 4 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 5 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5087 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5221          

HSP 6 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5376 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5510          

HSP 7 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5665 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5799          

HSP 8 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5929 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6063          

HSP 9 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6188 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6322          

HSP 10 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6990 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7124          

HSP 11 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7279 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7413          

HSP 12 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7543 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7677          

HSP 13 Score: 257.299 bits (656), Expect = 5.554e-68
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEI+KTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6447 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6581          

HSP 14 Score: 255.758 bits (652), Expect = 1.438e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVP NGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6706 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6840          

HSP 15 Score: 255.373 bits (651), Expect = 1.980e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKE KPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 16 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 17 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 18 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 19 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 20 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 21 Score: 249.98 bits (637), Expect = 7.636e-66
Identity = 130/135 (96.30%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTE+YVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          

HSP 22 Score: 138.272 bits (347), Expect = 5.715e-32
Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFN 5205
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFN
Sbjct: 4851 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFN 4920          

HSP 23 Score: 108.227 bits (269), Expect = 8.322e-23
Identity = 60/135 (44.44%), Postives = 85/135 (62.96%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKE P LIST EYVKE++ PK+GT   SLI + WN  +I   PKF + FY PV I+KI+ ENI+N+++FN++V   N   Y+   T L+V +  ++ E +   EKV  + I    +  + +VSLKV +EGC E E
Sbjct: 3566 CKETPYLISTNEYVKEVLTPKDGTPGFSLIEDSWNGVLISYNPKFILTFYVPVTISKIKIENILNLKSFNLIVRRHNNISYENLATNLLVPYPTQFVEFKSFTEKVEVLIINVFDNIKRNRVSLKVTVEGCVELE 3700          

HSP 24 Score: 59.6918 bits (143), Expect = 4.042e-8
Identity = 41/135 (30.37%), Postives = 69/135 (51.11%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  ++K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 25 Score: 58.5362 bits (140), Expect = 8.452e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 26 Score: 58.5362 bits (140), Expect = 8.452e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 27 Score: 58.5362 bits (140), Expect = 8.452e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 28 Score: 58.5362 bits (140), Expect = 8.452e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 29 Score: 58.5362 bits (140), Expect = 8.452e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 30 Score: 58.5362 bits (140), Expect = 8.667e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6447 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6581          

HSP 31 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 32 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5087 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5221          

HSP 33 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5376 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5510          

HSP 34 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5665 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5799          

HSP 35 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5929 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6063          

HSP 36 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6188 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6322          

HSP 37 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6990 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7124          

HSP 38 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7279 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7413          

HSP 39 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7543 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7677          

HSP 40 Score: 58.5362 bits (140), Expect = 9.268e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7852 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7986          

HSP 41 Score: 57.3806 bits (137), Expect = 1.753e-7
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6706 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6840          

HSP 42 Score: 56.9954 bits (136), Expect = 2.643e-7
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST++++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000041532.1 (SMESG000041532.1)

HSP 1 Score: 2807.71 bits (7277), Expect = 0.000e+0
Identity = 1303/1303 (100.00%), Postives = 1303/1303 (100.00%), Query Frame = 2
Query:   68 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLCEKPLIIS 3976
            GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS
Sbjct:   20 GDAESHYCGLIEKKACCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKVVSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLDCEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITSTLNETTTFSTSRSTTTKLCEKPLIIS 1322          

HSP 2 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 441/449 (98.22%), Postives = 442/449 (98.44%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVQTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVXXXXXXXXXXXXXXXXXXXLNVTTVSEQRSXXXXXXXXXQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 6342
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS      + TTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET
Sbjct: 7854 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKETTTQRSTTISISSPTVSSSSTSSESSSS------LSTTSSLIGCVEVLRLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQIELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAVKIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTTVSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCAGGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISGCQCNSCQQTVIDKCET 8296          

HSP 3 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 469/475 (98.74%), Postives = 473/475 (99.58%), Query Frame = 1
Query: 3976 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLIST+EYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTV+KVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1323 KWDYVKSISATSFSGVNGGVGEFMTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQWNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCGEKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVINLSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSSQSISSTTTGTTTSRITGCKEKPVLISTKEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVKKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 1797          

HSP 4 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 5 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5089 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5223          

HSP 6 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5378 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5512          

HSP 7 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5667 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5801          

HSP 8 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 5931 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6065          

HSP 9 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6190 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6324          

HSP 10 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6992 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7126          

HSP 11 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7281 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7415          

HSP 12 Score: 258.84 bits (660), Expect = 1.768e-68
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 7545 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7679          

HSP 13 Score: 257.299 bits (656), Expect = 5.555e-68
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEI+KTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6449 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6583          

HSP 14 Score: 255.758 bits (652), Expect = 1.438e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVP NGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 6708 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6842          

HSP 15 Score: 255.373 bits (651), Expect = 1.980e-67
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKE KPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 16 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 17 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 18 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 19 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 20 Score: 251.906 bits (642), Expect = 2.431e-66
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 21 Score: 249.98 bits (637), Expect = 7.637e-66
Identity = 130/135 (96.30%), Postives = 133/135 (98.52%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKEKPVLISTE+YVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFE+GL VT+MKEYEEIEKTVEKVSAIKITFTLSS KEKVSLKVIIEGCGEKE
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          

HSP 22 Score: 139.813 bits (351), Expect = 2.070e-32
Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNV 5208
            CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNV
Sbjct: 4851 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNV 4921          

HSP 23 Score: 108.227 bits (269), Expect = 8.392e-23
Identity = 60/135 (44.44%), Postives = 85/135 (62.96%), Query Frame = 1
Query: 4996 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5400
            CKE P LIST EYVKE++ PK+GT   SLI + WN  +I   PKF + FY PV I+KI+ ENI+N+++FN++V   N   Y+   T L+V +  ++ E +   EKV  + I    +  + +VSLKV +EGC E E
Sbjct: 3566 CKETPYLISTNEYVKEVLTPKDGTPGFSLIEDSWNGVLISYNPKFILTFYVPVTISKIKIENILNLKSFNLIVRRHNNISYENLATNLLVPYPTQFVEFKSFTEKVEVLIINVFDNIKRNRVSLKVTVEGCVELE 3700          

HSP 24 Score: 59.6918 bits (143), Expect = 4.076e-8
Identity = 41/135 (30.37%), Postives = 69/135 (51.11%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  ++K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4288 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKESKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4422          

HSP 25 Score: 58.5362 bits (140), Expect = 8.523e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 1932 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2066          

HSP 26 Score: 58.5362 bits (140), Expect = 8.523e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2226 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2360          

HSP 27 Score: 58.5362 bits (140), Expect = 8.523e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2490 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2624          

HSP 28 Score: 58.5362 bits (140), Expect = 8.523e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 2779 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 2913          

HSP 29 Score: 58.5362 bits (140), Expect = 8.523e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3028 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3162          

HSP 30 Score: 58.5362 bits (140), Expect = 8.740e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6449 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIKKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6583          

HSP 31 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 4562 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 4696          

HSP 32 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5089 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5223          

HSP 33 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5378 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5512          

HSP 34 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5667 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 5801          

HSP 35 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 5931 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6065          

HSP 36 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6190 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6324          

HSP 37 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6992 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7126          

HSP 38 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7281 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7415          

HSP 39 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7545 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7679          

HSP 40 Score: 58.151 bits (139), Expect = 9.346e-8
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 7854 CKEKPVLISTEEYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 7988          

HSP 41 Score: 57.3806 bits (137), Expect = 1.782e-7
Identity = 41/135 (30.37%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST+E++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  +      +  E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 6708 CKEKPVLISTEEYVKEIVVPINGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGEKE 6842          

HSP 42 Score: 56.9954 bits (136), Expect = 2.665e-7
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 4471 CKETLTLISTKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEIIIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQXXXXXXXXXXXXLSIMLIKKNKSEEVKLKLLIMGCTERK 4875
            CKE   LIST++++ EI+   N  ++  ++T+ W + V    P   I FYK + IT+I  EN  NI  + +++   N  + K  ++        E  +I     KV  + I     +  E+V LK++I GC E++
Sbjct: 3317 CKEKPVLISTEKYVKEIVVPKNGTSETSLITEIWNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKPFESGLTVTYMKEYEEIEKTVEKVSAIKITFTLSSAKEKVSLKVIIEGCGEKE 3451          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000025547.1 (SMESG000025547.1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 459/1284 (35.75%), Postives = 688/1284 (53.58%), Query Frame = 2
Query:  113 CCLGWSGKKCNEPVCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQ------NIELTDQAQCTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCVNKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDRGHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFETVDASMNPIETDLDFIKIWLSVSRENRMKPDP----AIQMVNCDL-----NEMATCAKVV--SIFGSK-----------FEEICYAEFCQMKNQKNSCELMRDIA--------FLSSPDNIVSDWRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVCTPGCYCRKDFFWYKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDMNLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPK-RDCEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIIT-KELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETCIGT-------KSCISDCMEGCYCKNNTYLK---DDECVSEKPLCTCK-DESGKEYPLGTTVIKNCHKCTCQINGFEC 3817
            C  G+ G++C+   C+ GCG G C+EPN+C C E  R G+ CE F  E  + +       N +  D   C+ + G    TFD + +++    G+ +LV DC+SR P+Y+I      +C  K   +C+ ++  +   S   T+L   G+   + + +  Y  +  Q  + G +  +KGI +L I Y+ K ++F+FAP+TMKK VCGLCG +DGN     E  + +   IE   +F+K W          PDP           DL      ++ T A  +   +FG             ++ IC +E C   N   +  +  +IA        +  + +  + +WR +L C    CP    +S+CG++C+  C     D +C   CT GC+C KD FW    C    +CPC  R +   +  Y  G   K+ C+ C C   G++ C     CS  C+I+GDPH+ TFD +HI+VEG C Y  V  K   +    L I V+N  C  S D  C K + + FG+  N T I++ +   +++N     +P +IN  + +++ +V  D + IE+ +   +     ++IE+ L   Y  +V GLCGN+NG+ EDD     G    +D+ELA  +  T  C    L  SYLG+C  S E+ K A E C +     F  C   V  + F+ QC+HD+C CG        NC C + ++Y R C   G+  +WR+   C   CP  M Y EC + CS +C    + NC  +CIDGCQC  +MV +     CV +  C+C +    Y +   RK++CN C C NG+W+CT  DCS+ ++CP GK WK+CG C +TC + +  C    C+ GC+C  G +  N  C+PK +CPC W ++S+   +VI  GP  C   CTC  GKW C + + C G CK+WG++HY +FDGK+FDF   CSYV+++  C K  G FK+V EN+ECG+KGTSCTKSI FYY++ ++ LIRG  P +  N  +      G  S  D VS ++I T  ++ + WD+ LS+++ L P+Y+N VCGLCGNFD N++ND +++AG  + ++ AF DSWK + +CP  +   + C  N  R++WA K C  +K+  F  C   V  +LYY KC+ D+C+CDRG DC C+CTA+S +   C +Y I   WR+ E CP+MCPP++ +K C   CP+ C  +       ++C  +C+EGC C    Y++    ++CV E   C CK   S K+Y  G    +NC  C C  N F+C
Sbjct:  135 CDSGYEGERCDRAFCQYGCGTGICVEPNVCQCPENFR-GRNCETFFREPNTSNLKISDVINTKYKDYQLCSIMGGSYVTTFDGI-SIENPLRGSNILVIDCLSRKPSYRIFFNSSYNCPTKDFVNCDTSL-MIETASESVTFL---GLSNSSTNSNRNYI-SSIQHKNIGDFNQIKGIGELEILYDGKRNVFIFAPLTMKKSVCGLCGYFDGNSSLSSEFKNINGESIENVTEFMKYW--------KNPDPIDPNTYYTTGRDLCTGLNKDLVTTANNMCQDVFGGDLSQCTILPVIPYQSICRSELCHCLNAGQNISVCANIACSMGSFKSYQCTLNGKLINWRSQL-CAPRECPANKEYSECGSSCSQNCEDLITDENCKSFCTAGCFCPKDRFWNGTYCVPKPQCPC-IRKNGNSMVVYHQGMSFKRDCEICECSKGGVFNCAKIRGCSGTCVISGDPHYTTFDKRHIYVEGSCFYTMVATKPSITGNQVLKIWVQNTHCMKSNDAYCTKSLSLQFGDTDNSTFIQLVTTKNILVNKIPNRLPLQINDPLRLTIQEVAHDTVLIESYNGIRILWHQKTQIEITLPEFYQDQVQGLCGNYNGNSEDDATKSSGELTTNDNELAVSWA-TAECKS-TLSLSYLGVCAKSYEYEKFAKEFCQRLLYEPFNSCHMSVDPNPFIQQCEHDICLCG---GNEKDNCACESMASYGRACMKNGLTLKWRSSSLCDPKCPNGMEYMECKNLCSVSCFSLTQTNCSTECIDGCQCKSNMVYDTAVNQCVNISQCQCSHENAYYPSGSTRKEKCNDCNCTNGVWSCTKNDCSNVTFCPPGKEWKECGHCDQTCENQDGFCLEKGCKSGCFCPDGYLLSNKTCVPKHKCPCLWSDKSYLNQSVIYTGPTNCLSKCTCNEGKWGCEQEQKCVGSCKSWGDAHYKTFDGKYFDFVSKCSYVMVDSDCGKGIGFFKLVTENIECGNKGTSCTKSIFFYYRNQVVQLIRGVRPKVMENENYPKDRVKGRISFRDLVSQLIIYTDSDIILYWDKGLSIEIALPPQYQNQVCGLCGNFDQNLNNDFKSKAGNYENNILAFVDSWKSRVNCPAAKDVPDMCKSNHERQAWADKMCGTMKNVKFADCQKVVDTELYYQKCLSDTCSCDRGGDCECLCTALSAFYSACKKYGIDYSWRSNELCPVMCPPEKTFKTCINDCPKKCFKSNLNNTVLENCAKNCVEGCSCPTE-YIEAEGSNKCVKENE-CFCKLPNSDKKYNPGEIFTENCLICVCNENNFKC 1394          
BLAST of Hemocytin vs. Planmine SMEST
Match: SMESG000042718.1 (SMESG000042718.1)

HSP 1 Score: 290.426 bits (742), Expect = 4.025e-78
Identity = 278/1016 (27.36%), Postives = 430/1016 (42.32%), Query Frame = 2
Query: 1034 WRYKLDCEEPNCPNKMIWSXXXXXXXXXXXXXXXXVDCSKVC---------TPGCYCRKDFFW----------YKNQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHDQCSSRCIITGDPHFVTFDN-QHIFVEGQCQYIAVMPKEIESD-MPQLSIIVENKFCFNSEDITCAKGIKILFGE------GLNQTEIEIK--------SKTEVIIN-----SKL-VTIPSKINKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQG-QFKDCEALVPSDK--FVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQ----FQWRTPEFCPVICPKN-MVYKECGSSCSATCRLRQRPN---CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGR----DYNANEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKD-CGGCQRTCRDMNLICDPNSCEPGCYCESGEVYD-NNKCIPKGECPCFWQNQSFNESAVITRGPFECQLSCTCRSGKWECPKRD---CEGLCKAWGESHYMSFDGKFFDFHGDCSYVLLEDYCNKKSGT--FKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPEYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTS-CPY---------PEISKNPCDINKFRESWAIKRCSILKSE--TFEPCHNTVRYQL--YYDKCVQDSCACDRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC--IGTKS----CISDCMEGCYCKNNTYLKDDECVSEKPLCTCK-DESGKEYPLGTTV-IKNCHKCTCQINGFECEKE 3826
            WR    CE   CP   IWS                 DC+  C         TP  YC+               Y   C + + CPC Y         +  G   +  C  C C S  LW C T   C S C I G   F TFD  +  F +  CQY+AV P    +D    + +I+++    N+E +   +G      E       +N ++I +K        S+T V I+     +KL  TIP K      I V K+T+   +++    F ++      I + +S      + GLCG F+G+ E+D    D +  +    +A  Y +T +C             ++ ++     N++C     G +F  C      DK  + T C+ +        N   ++  CSA    A  C   GIQ    F     + C  +C     V++ C  +C +TCR         CD+DC  GC+CP +   +  TG CV   +C C    R    +  A       C TC CING  NC TKD  +   CP  +V+ D   GC  +C + +   D +S    C C +  V   +  C+   +CPC + N+ +  + VIT    +C     C +  W     +   CE +C A+G+ HY + DG+ F F G C Y L++   +  +      I + N+ CG    +C K ++         L RG    I   P +       +  +  + + +V  +  L++ WDR   V +FL P ++ NV GLCGN+D ++ N+      +   D   FA+S+      CPY         P   ++ C+ N  R+SWA + C ++K     F  C   +   +  YY  C+ D+C C+RG DC C+CT+++ +  +C    I ++WR    CPIMC   + Y  C   CP+TC  IG+ +      + C+EGC C N     + ECV   P  TC    +G+ Y  G  + ++NC KC C    F C ++
Sbjct:  359 WRSDTLCET-QCPGNKIWS-----------------DCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPESCPCLYDGQ-----EHPPGTVRQFDCNTCTCNSS-LWHC-TEKICPSTCGIMGT-QFDTFDGAKFAFNDVGCQYVAVEPSVNNTDDRANVFVIIQS----NTESMLGTEGNSAYINEPKIVTVKVNGSDIILKATSPQLGDSQTNVFIDGEDHTTKLPFTIPDK-----NIHVRKLTNIYTEVKVSSHFKLYFDGSKSIYIKVSDALKNNLIGLCGKFDGNSENDFTEKDNSIRESIVNIAKSY-ITGSCDNT---------PQSIVDPPAGDNDICSTILNGPEFSGCMNSSKVDKEFYATYCRREQS-----SNKDQLSY-CSAILNAAIACRRFGIQYEVPFTSNILQACIPLCQAGGTVFQICSRTCQSTCRELNEATASKCDDDCFPGCECPPNYY-KTGTGQCVSESECTCWNPSRPKDPEIPAGTNITINCQTCVCINGRLNCKTKDNCTNPVCPKNQVYMDSVSGC-NSCTNYDTCTDTSSIANSCGCPNDTVSKIDGTCVQPSDCPCIYMNREYAPNDVIT---IKCA-KYICSNRMWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSLATCAKFVQIIIGGQTYLLSRGNNDTIPLFPKYDI-----VIEQLTFFTQLVSDSIGLRVLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNEYM-HGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGCNRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMIDLNGECV---PPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTED 1308          

HSP 2 Score: 129.798 bits (325), Expect = 2.223e-29
Identity = 122/461 (26.46%), Postives = 199/461 (43.17%), Query Frame = 2
Query: 1208 CKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHD--QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAV-MPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKINKGVEISVF--KVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRL-TQTCHGEVLRQSYLG------LCETSIEWGKIANEVCG--KFGQGQFKDCEALVPSD--KFVTQCKHDVCNCGLLRNASTINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCRL--RQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDY-NANEERKDRCNTCTCINGLWNCTT--KDC-----SSQSYCPNGK 2506
            C +  +CPC Y         Y   D +   C   +C +R +W   + +   C + CI  GDPH+ T D Q    +G C Y  +  P +  +++P ++I V N  C  S   TCAK ++I+ G    QT +  +       N+  + +  K +  +E   F  ++ SD + +       V     +R+ L L   +   V GLCGN++GD +++  M      +D  + A  +      C  E+  ++ +       +C  + +    A ++CG  K   G F  C   +  D  ++ + C +D C C          C C++ + +A  C+  GI  +WRT   CP++C     Y  C S C  TC       P+      C++GC CP+ M+  +  G CV    C C Y G+ Y N    + + C  C C+   +NCT    DC      SQ  C +GK
Sbjct:  895 CVQPSDCPCIYMNR-----EYAPNDVITIKCAKYICSNR-MWNLLSEETANCEAVCIAYGDPHYKTLDGQMFSFQGSCMYTLMDTPGDSSNNIPPITISVANIACGFSL-ATCAKFVQIIIG---GQTYLLSRG------NNDTIPLFPKYDIVIEQLTFFTQLVSDSIGLR------VLWDRSTRVYLFLKPSFQGNVQGLCGNYDGDLQNE-YMHGTMKYEDAIQFAESFIANADICPYEISPENNVAPSKEQDMCNANPDRKSWAEQMCGVMKDTNGVFASCIEAMHQDVNRYYSNCLYDACGC---NRGGDCECLCTSLATFATQCAFLGIPVKWRTQNLCPIMCEGGKHYDACASPCPQTCDTIGSNAPSHCSTTHCVEGCSCPNGMI--DLNGECVPPTTCPCFYNGQSYVNGAIIKMENCKKCQCVQAKFNCTEDYSDCITTCTPSQFRCDDGK 1327          

HSP 3 Score: 115.161 bits (287), Expect = 5.787e-25
Identity = 116/403 (28.78%), Postives = 183/403 (45.41%), Query Frame = 2
Query: 1340 DTHDQCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVENKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVII-----NSKLV------TIPSKINKGVEISVFKVTSDG---LKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLCGNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCETSIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNA-----STINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSATCR-LRQRPN--CDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNANEERKDRCNTCTCINGLWNCTTKDCSS 2482
            D +++  + C   G  ++ TFDNQ    +G+C YI   P ++ +    ++I+ EN  C  + D  C K I I  G      ++ +KS    I+     N+ L       T  + I  G  + V +   D    L +EAG++   +  +++    + ++ Y   VTGLCGN + +P +D           + +  A +  +    G     + L  C+   +   +AN+ C K  + +F  C  LV SD + + C  ++C      N      S  +  C+  SAY+  CS KG   QWR+   C   CP N ++ +C S C  TCR L Q P+  C N  +  C C    V  E    C+K E C C Y G+++     R+  CNTCTC + LW+CT K C S
Sbjct:   86 DVNNENFTTCHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYEN--C--TSDTGCVKVIVIEAG------DVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMYVLR--QDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSND---------FSNFDNVASFGNSFKGFGCPDIANTLSTCKPDDQI--LANQQCSKI-RLKFPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEV--EYGYTCIKPESCPCLYDGQEHPPGTVRQFDCNTCTCNSSLWHCTEKICPS 462          

HSP 4 Score: 83.9593 bits (206), Expect = 1.531e-15
Identity = 89/386 (23.06%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 2777 CKAWGESHYMSFDGKFFDFHGDCSYVL---------------LEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLI------RGAAPIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTPE-YKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEISKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCACDRGDDCL--------CVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEKVCPETC-----IGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEYPLGTTVIKNCHKCTCQINGFECEKEL 3829
            C ++G  +Y +FD + + + G CSY+L               + + C   +G  K+++  +E G      + +   Y  D    L         +A II   P +          + D    + +    +K++WD   ++ + +    Y  +V GLCGN D+N  ND  N       +V +F +S+K    C  P+I+          +  A ++CS ++ + F  C + V    Y+  CVQ+ C   +  +           +CT +S Y   C+     IQWR+   C   CP ++ +  C   CP TC       +  C +  +  C C +        C+  +  C C  + G+E+P GT    +C+ CTC  + + C +++
Sbjct:   95 CHSYGLDYYRTFDNQLYTYQGRCSYILTAPSDVSAVTWSINIVYENCTSDTGCVKVIV--IEAGDVVVKSSGNGILYTTDSNNPLTPLSVTNTDSALIIPGTPMY--------VLRQDNFILLSLEAGNIKLKWDNNNNIFISIHNSIYNGDVTGLCGNADNNPSNDFSNF-----DNVASFGNSFK-GFGC--PDIANTLSTCKPDDQILANQQCSKIRLK-FPGCADLVNSDTYFSMCVQNICTKSQNSNTTLDIPSISDVLCTHLSAYSDSCSDKGSCIQWRSDTLCETQCPGNKIWSDCASECPVTCRNLFQTPSAYCQNSKVGRCICGSGEVEYGYTCIKPES-CPCLYD-GQEHPPGTVRQFDCNTCTCNSSLWHCTEKI 459          
The following BLAST results are available for this feature:
BLAST of Hemocytin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MUC5AC6.047e-12328.78mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC5AC6.047e-12328.78mucin 5AC, oligomeric mucus/gel-forming [Source:HG... [more]
MUC5B4.251e-12228.77mucin 5B, oligomeric mucus/gel-forming [Source:HGN... [more]
VWF4.974e-11226.03von Willebrand factor [Source:HGNC Symbol;Acc:HGNC... [more]
OTOGL1.410e-10627.15otogelin like [Source:HGNC Symbol;Acc:HGNC:26901][more]
back to top
BLAST of Hemocytin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T01D3.61.266e-1322.62pep chromosome:WBcel235:V:13716849:13720402:1 gene... [more]
T01D3.63.221e-1322.39pep chromosome:WBcel235:V:13716824:13720402:1 gene... [more]
back to top
BLAST of Hemocytin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hml6.603e-11527.78gene:FBgn0029167 transcript:FBtr0075753[more]
Hml8.116e-11527.78gene:FBgn0029167 transcript:FBtr0333020[more]
cv-24.258e-2625.81gene:FBgn0000395 transcript:FBtr0071610[more]
back to top
BLAST of Hemocytin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin2.115e-14628.79subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
vwf1.858e-12326.34von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
vwf5.948e-12326.74von Willebrand factor [Source:ZFIN;Acc:ZDB-GENE-07... [more]
otog2.122e-11026.16otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
muc5.35.775e-11028.58mucin 5.3 [Source:ZFIN;Acc:ZDB-GENE-040426-1562][more]
back to top
BLAST of Hemocytin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006505.18.120e-14529.04SCO-spondin [Source:NCBI gene;Acc:100497129][more]
ENSXETT00000033057.17.966e-12829.27mucin-2-like [Source:NCBI gene;Acc:100495470][more]
ENSXETT00000018772.12.755e-12729.27mucin-2-like [Source:NCBI gene;Acc:100495470][more]
ndufs88.261e-12128.09NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
ndufs81.939e-11927.61NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of Hemocytin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Muc5ac7.169e-12629.65mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac1.159e-12429.33mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5ac1.159e-12429.33mucin 5, subtypes A and C, tracheobronchial/gastri... [more]
Muc5b9.270e-12029.64mucin 5, subtype B, tracheobronchial [Source:MGI S... [more]
Vwf1.283e-11725.98Von Willebrand factor [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Hemocytin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98088|MUC5A_HUMAN4.327e-12228.78Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 S... [more]
sp|Q2PC93|SSPO_CHICK4.353e-12229.02SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 ... [more]
sp|Q9HC84|MUC5B_HUMAN2.042e-12128.77Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=... [more]
sp|Q98UI9|MUC5B_CHICK3.834e-11528.11Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV... [more]
sp|Q700K0|SSPO_RAT1.699e-11431.75SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo ... [more]
back to top
BLAST of Hemocytin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DLR60.000e+036.03Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GUZ70.000e+035.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GY380.000e+035.88Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G0U90.000e+035.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L8GSF57.037e-16433.98Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Hemocytin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin2.656e-14828.63subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
vwf2.391e-12427.36von Willebrand factor [Source:NCBI gene;Acc:103041... [more]
otog2.178e-10926.34otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
ENSAMXT00000019204.24.813e-10827.72pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041370.15.997e-10828.17pep primary_assembly:Astyanax_mexicanus-2.0:5:1809... [more]
back to top
BLAST of Hemocytin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010519.16.556e-11127.70pep scaffold:Pmarinus_7.0:GL477612:23664:47127:1 g... [more]
ENSPMAT00000008773.13.801e-10927.55pep scaffold:Pmarinus_7.0:GL476328:703641:749596:1... [more]
ENSPMAT00000008652.12.934e-9932.86pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
ENSPMAT00000008716.11.415e-9827.30pep scaffold:Pmarinus_7.0:GL476328:595486:663084:-... [more]
ENSPMAT00000005510.11.146e-7524.06pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-... [more]
back to top
BLAST of Hemocytin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hemocytin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO441995.731e-7626.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418771.180e-6637.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418765.790e-4631.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330616.820e-3128.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hemocytin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin1.485e-12728.16SCO-spondin [Source:NCBI gene;Acc:101172449][more]
vwf1.343e-11427.11von Willebrand factor [Source:NCBI gene;Acc:101162... [more]
otog7.601e-8924.54otogelin [Source:NCBI gene;Acc:101158818][more]
FCGBP7.406e-7023.96Fc fragment of IgG binding protein [Source:NCBI ge... [more]
zanl9.275e-6723.67zonadhesin [Source:NCBI gene;Acc:101162078][more]
back to top
BLAST of Hemocytin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041532.11.666e-68100.00SMESG000041532.1[more]
SMESG000041532.11.768e-68100.00SMESG000041532.1[more]
SMESG000041532.11.768e-68100.00SMESG000041532.1[more]
SMESG000025547.10.000e+035.75SMESG000025547.1[more]
SMESG000042718.14.025e-7827.36SMESG000042718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002668 ID=SMED30002668|Name=Hemocytin|organism=Schmidtea mediterranea sexual|type=transcript|length=6365bp
AAAATCACTCATGATTCAATTAAAGCTCTTACTTCTACTTTTTCAATTTC
AAATTGTCTTTATAAAAGGTGATGCAGAATCTCATTACTGCGGTCTGATA
GAAAAAAAAGCATGTTGTCTTGGGTGGTCCGGAAAGAAATGCAACGAACC
GGTTTGTGAGAAAGGTTGCGGCCCAGGAAAATGTATAGAACCGAATATAT
GCGATTGTAGAGAAACAAACAGATTTGGACAACAATGTGAACGTTTTGGA
GCAGAAGTGGCATCAGTGTCTCAAAACATTGAATTAACTGATCAAGCACA
ATGCACATATTTGAATGGAAGATCGTACAAAACATTTGATAGAGTTAAAA
CTGTCCAAACAAATTTCACTGGAAATATGGTCCTAGTCCAAGACTGCATG
AGTAGACCACCTACCTACCAAATTATTGTTATTCCTCAAGAAAGCTGCGT
AAATAAATCCAGTGATGATTGTGAAATTACAATCAAATTCCTATTCAAAG
ATAGTATTGAAGCAACTTATCTTTCATCTCAAGGAGTAAAGGTGGGAAAT
ATCAGTTATTCATTTCCATACAGCAAAGCCGAATTTCAAATATCAGATCG
TGGACATTATGTTTATGTCAAAGGAATCAAAGATTTGAATATTTTCTACA
ACAAAAAAGGCTCGATTTTTGTATTTGCTCCAGTGACAATGAAGAAACAA
GTTTGTGGGTTATGTGGTCTCTATGACGGCAACGGCGATGACAAATTTGA
AACAGTTGACGCGTCAATGAACCCGATAGAAACAGATCTGGATTTCATAA
AAATATGGCTATCAGTGTCGAGAGAAAACCGTATGAAGCCTGATCCGGCA
ATTCAAATGGTCAATTGTGATCTGAATGAAATGGCAACGTGTGCGAAAGT
CGTCTCAATTTTCGGAAGTAAATTTGAAGAAATTTGTTACGCAGAATTTT
GTCAAATGAAAAATCAGAAAAATTCGTGTGAGCTAATGAGAGATATCGCC
TTTTTGAGTTCACCGGATAATATTGTCAGTGATTGGAGATATAAATTAGA
TTGCGAAGAACCTAATTGTCCGAATAAAATGATTTGGTCTGACTGTGGGA
ATAACTGCAATAACAGATGTGGATTCAATAACGATGATGTGGACTGTTCA
AAGGTTTGTACTCCTGGATGTTACTGTAGGAAAGATTTCTTTTGGTACAA
AAACCAATGCAAAAGAGCAGATGAATGCCCTTGTGAATACAGAGCTTCAG
CAAAACAAATAGATTCCTATAAATTTGGTGACAAAATGAAAAAAGGCTGC
CAAAACTGTTTGTGTGAGAGTCGAGGTTTATGGAAATGTGACACTCACGA
CCAATGCTCTTCCAGATGTATCATCACCGGAGATCCGCACTTTGTTACGT
TTGACAATCAGCACATATTTGTGGAAGGTCAATGTCAATATATCGCCGTC
ATGCCAAAGGAAATAGAGAGTGATATGCCTCAATTATCAATCATCGTTGA
AAATAAATTTTGTTTCAATTCCGAAGATATAACTTGCGCCAAAGGAATAA
AAATACTTTTCGGAGAGGGCTTAAATCAAACTGAAATCGAAATAAAATCC
AAAACCGAAGTAATAATAAACAGCAAGTTGGTAACGATACCTTCCAAAAT
CAACAAAGGTGTGGAAATTTCTGTGTTTAAAGTGACAAGTGACGGCTTAA
AGATCGAGGCAGGAGATTTGTTCAGCGTTTTTCGGAAAGACGATTCGCGA
ATAGAATTAGTTTTGTCAGCTAAATATGCTAGAAAGGTAACCGGTCTATG
CGGAAACTTTAATGGAGATCCTGAAGATGACAACATTATGCCTGACGGTG
CCCCAGCAAAAGATGACTCTGAATTGGCGGCGAGATACAGATTAACTCAA
ACCTGTCATGGAGAAGTTTTAAGGCAGTCTTATCTTGGGTTATGTGAAAC
AAGCATTGAATGGGGGAAAATAGCTAATGAAGTTTGTGGAAAATTCGGAC
AAGGTCAATTCAAAGATTGTGAAGCGTTAGTCCCATCGGATAAATTTGTC
ACGCAATGTAAGCATGATGTCTGCAACTGCGGCTTATTGAGAAATGCCAG
CACCATAAACTGCGAATGCTCAGCGTATTCGGCGTATGCTAGAATATGTT
CAATTAAAGGAATTCAATTTCAGTGGAGAACTCCAGAATTCTGTCCCGTA
ATTTGTCCAAAAAATATGGTTTACAAGGAATGTGGATCAAGTTGTTCGGC
GACTTGTAGGCTAAGACAAAGACCCAATTGTGATAATGATTGCATAGATG
GTTGCCAATGCCCTGACGATATGGTTATTGAAGAAAAAACCGGAAATTGC
GTTAAAGTTGAAGACTGTAAATGCGAGTATATGGGAAGAGATTATAATGC
TAATGAAGAAAGAAAGGATCGTTGCAATACCTGCACATGCATCAATGGAT
TATGGAACTGTACAACTAAAGATTGTTCATCGCAAAGCTATTGTCCCAAT
GGAAAAGTATGGAAAGATTGTGGAGGCTGTCAAAGAACCTGTAGAGACAT
GAATCTGATATGTGATCCAAATTCCTGTGAACCAGGATGCTATTGCGAAA
GCGGAGAAGTCTATGATAACAACAAATGTATCCCTAAAGGAGAATGTCCA
TGTTTTTGGCAAAATCAAAGCTTCAATGAATCGGCTGTAATAACTCGTGG
CCCATTTGAATGCCAATTGTCATGCACTTGCAGAAGTGGAAAATGGGAAT
GCCCAAAAAGAGACTGCGAGGGTCTATGCAAAGCCTGGGGTGAATCTCAT
TATATGTCTTTTGATGGGAAGTTTTTTGATTTTCATGGAGACTGCAGTTA
TGTTTTATTGGAAGACTATTGCAACAAAAAATCAGGAACATTCAAAATAG
TGATCGAAAATGTAGAATGTGGTTCAAAGGGAACAAGTTGTACTAAATCA
ATACGATTTTATTATAAAGATCACATTATCCATTTGATCCGTGGCGCTGC
ACCAATTATCGGCAGAAATCCAACTTGGTCCCCATATTTGGGAACGGGAA
TATTTTCCAAGCATGATTACGTCAGCAGCATTGTCATTATTACGAAAGAA
CTGAAGATTCAATGGGATAGGCAATTGTCCGTTGATGTATTTTTAACACC
GGAATATAAAAATAATGTTTGTGGATTATGTGGCAATTTTGATGACAATG
TTGACAATGATTTAAGAAATCGAGCTGGAATAATAGATGCAGATGTAAAT
GCTTTTGCAGACAGTTGGAAACTGAAGACATCATGCCCATATCCTGAAAT
ATCTAAAAACCCCTGTGACATTAACAAATTTAGAGAAAGTTGGGCAATTA
AAAGATGTTCAATATTGAAGAGTGAAACTTTTGAACCTTGTCATAACACT
GTCAGATATCAATTATACTATGATAAGTGCGTCCAAGATTCTTGCGCTTG
TGATCGTGGAGATGATTGCCTTTGTGTATGTACAGCCATATCCCAATATG
TCCATGAATGCAATAGGTACAACATTAAAATTCAATGGAGGAACTATGAA
AATTGCCCAATTATGTGCCCACCGGACCGTGAGTATAAACCCTGTGAAAA
GGTCTGTCCAGAAACATGCATTGGAACTAAAAGTTGCATTTCAGATTGTA
TGGAAGGATGCTATTGCAAAAATAACACATATTTAAAAGATGATGAATGT
GTATCTGAAAAACCTCTATGCACTTGCAAAGATGAAAGTGGAAAAGAATA
TCCTTTAGGTACAACAGTAATTAAAAACTGCCATAAATGTACATGTCAAA
TAAATGGTTTTGAATGCGAAAAAGAGTTGATACACAACTGCCTCACAACC
GTGTCTACATCAACAGTAGTGACAACAACCATACCGACAATTACTTCAAC
GTTAAATGAAACAACCACTTTCTCAACAAGCAGATCAACAACAACTAAAT
TATGTGAGAAGCCACTCATCATATCAAATGGGATTATGTGAAATCCATAT
CAGCAACTTCATTTAGTGGTGTCAATGGAGGTGTTGGTGAGTTTATGACA
GAAATTGGGTGGGAACCACATATCATAGATTTGCAACCGCTACTAACGAT
AGAGTTCAATAATAAAGTGTACATTAAAGGGATATCATTATTTTTAGTCA
ATGTAAATCGCTATAATGTTTTCGTAGTTCATACTGGCAATCAATGGAAT
GAGCTGATAGTCAACTATACTAATACCGATGGAGATGCGAGAATTCCTAA
TATAGATATGGAAATCACCAAAATAAGATTTGAATTCGAGAGAGCCATTC
AGAATAAGAATATTTTAGCCAAGGCCACAATTGAAGGTTGCGGTGAAAAG
AAACCAACAACGGCAACAATAACCCCGACTACAACGAAAACTGAAACGAA
TACAACTTCTACAATCTCTACAACTCCAACAACATCGAAAACTCCTCAAA
TAACTACAACAGCATCAGTTTGCAAAGAAACATTAACATTAATTTCAACA
AAAGAATTTATAAGCGAGATAATACCAAGCAGCAACTTCGAAAACAAAGA
AAAGATACTTACGGATTCTTGGACTTCGAATGTGAAGGATATAGCACCAA
ACATAATGATAAACTTTTACAAGGCAATAACCATAACGGAAATAATTATT
GAAAATCATTCAAACATCGGACGATACACAATAATGATCACAGAAGGAAA
TTCATATCAAACCAAAATACTTAAAGCTAACGAAGAAAATAAAAATCAGT
ATGAGCAAATTAAAATATATAATATAAACATCAAAGTTATAAATCTGTCA
ATAATGTTAATCAAAAAGAATAAATCAGAAGAAGTCAAGCTGAAATTATT
GATCATGGGATGCACAGAAAGGAAATCAACAAAAGAAATCACAACAACAA
TATTGACTGAAACTCCTACAGTTACAGGTACTGGATCAAGTTCACAGTCA
ATATCATCAACCACAACTGGAACAACGACTTCGAGAATAACAGGTTGCAA
AGAGAAACCGGTTTTGATTTCAACAGAAGAATATGTGAAAGAAATTGTTG
TACCTAAAAATGGAACATCCGAAACGAGTTTGATAACCGAGATCTGGAAT
ACAACTGTAATTAGAACAGAACCGAAATTCGAAATAAAGTTCTACAAACC
TGTCATCATTACGAAGATCAGATTTGAAAATATAGTTAATATTGAGACAT
TCAATGTGCTTGTTCTTTACGAGAATGAAAAAGAATATAAACCATTCGAA
ACAGGACTTGTTGTAACACACATGAAGGAATACGAGGAAATCGAAAAGAC
TGTTGAGAAAGTGTCAGCTATAAAGATAACATTCACTTTGTCATCGACGA
AAGAGAAAGTGTCATTGAAAGTAATAATCGAAGGATGCGGAGAAAAAGAA
ACGACAACACAAAGATCTACAACGATATCTATTTCCAGTCCAACTGTATC
ATCATCGAGCACAAGTTCAGAATCGAGCAGTTCTCTTGCAACAACTACTG
GTGTTCAAACTACCTCATCTCTTATTGGTTGTGTGGAAGTACTGAGATTG
TCTACTTTTGATTATGTGGAAAAGACGTTTACATCAAGTATGATAAATTT
TGAGATTCCAATTTTGGGTCGATGGGAATCCTGGAAGAACGATTCTAATC
CATCTATCCAGATTATCTTCAAACGAAATTTATTTATTACTCAAATTGAA
CTCGATAAAACAAATAATATTCGGAAATATTCTGTTTTCGTACAATATGG
TGAAAAAGATTCTTGGTATTCTATAGCGGAAACCAATCTGTTAAATCCAA
ATTCTCAGGGTACCGTTAATGTCAGTTTATTGGTGTCAGCAGTGAAAATT
GAAATTGATAAAGAAAATATTGATGAATCCGTCAGAGCTTTTCTGTTAAT
ATTCGGTTGTGAGAAGCAAGTGATTTCTACCGAACCCAGTTCCATATCAA
CGACAACAGAACACACGGAGTCAACACCGTTAAATGTAACCACTGTCTCA
GAACAACGTTCAACAACTGAAACTACTTTAACCACAACTCAACCAATTAA
GAAAGAAAATTGTTCATTTGTTTCGGAATCAAAATCGAAAATAAAACATT
TAAATTGCGTTTCCGTCGAAGAAATTGAAATCGGTCACTGTGCTGGAGGA
TGTCCAAGTCGAAGTTCAATTGATTATTTTACTGGTTTCGTAGATAGTAA
ATGTTTATGCTGTCATCCAGTTAAAATTAAGAAAACCTTAAGATTTTTTT
GTGATCCTGGATACAAATCCGTCGAAGTTTACATTATTTCAGGATGTCAA
TGCAATTCGTGTCAACAAACAGTGATTGATAAATGCGAAACTTAATTGAA
ATTTGATTTTTAATA
back to top

protein sequence of SMED30002668-orf-1

>SMED30002668-orf-1 ID=SMED30002668-orf-1|Name=SMED30002668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=767bp
MTEIGWEPHIIDLQPLLTIEFNNKVYIKGISLFLVNVNRYNVFVVHTGNQ
WNELIVNYTNTDGDARIPNIDMEITKIRFEFERAIQNKNILAKATIEGCG
EKKPTTATITPTTTKTETNTTSTISTTPTTSKTPQITTTASVCKETLTLI
STKEFISEIIPSSNFENKEKILTDSWTSNVKDIAPNIMINFYKAITITEI
IIENHSNIGRYTIMITEGNSYQTKILKANEENKNQYEQIKIYNINIKVIN
LSIMLIKKNKSEEVKLKLLIMGCTERKSTKEITTTILTETPTVTGTGSSS
QSISSTTTGTTTSRITGCKEKPVLISTEEYVKEIVVPKNGTSETSLITEI
WNTTVIRTEPKFEIKFYKPVIITKIRFENIVNIETFNVLVLYENEKEYKP
FETGLVVTHMKEYEEIEKTVEKVSAIKITFTLSSTKEKVSLKVIIEGCGE
KETTTQRSTTISISSPTVSSSSTSSESSSSLATTTGVQTTSSLIGCVEVL
RLSTFDYVEKTFTSSMINFEIPILGRWESWKNDSNPSIQIIFKRNLFITQ
IELDKTNNIRKYSVFVQYGEKDSWYSIAETNLLNPNSQGTVNVSLLVSAV
KIEIDKENIDESVRAFLLIFGCEKQVISTEPSSISTTTEHTESTPLNVTT
VSEQRSTTETTLTTTQPIKKENCSFVSESKSKIKHLNCVSVEEIEIGHCA
GGCPSRSSIDYFTGFVDSKCLCCHPVKIKKTLRFFCDPGYKSVEVYIISG
CQCNSCQQTVIDKCET*
back to top

protein sequence of SMED30002668-orf-2

>SMED30002668-orf-2 ID=SMED30002668-orf-2|Name=SMED30002668-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1330bp
KSLMIQLKLLLLLFQFQIVFIKGDAESHYCGLIEKKACCLGWSGKKCNEP
VCEKGCGPGKCIEPNICDCRETNRFGQQCERFGAEVASVSQNIELTDQAQ
CTYLNGRSYKTFDRVKTVQTNFTGNMVLVQDCMSRPPTYQIIVIPQESCV
NKSSDDCEITIKFLFKDSIEATYLSSQGVKVGNISYSFPYSKAEFQISDR
GHYVYVKGIKDLNIFYNKKGSIFVFAPVTMKKQVCGLCGLYDGNGDDKFE
TVDASMNPIETDLDFIKIWLSVSRENRMKPDPAIQMVNCDLNEMATCAKV
VSIFGSKFEEICYAEFCQMKNQKNSCELMRDIAFLSSPDNIVSDWRYKLD
CEEPNCPNKMIWSDCGNNCNNRCGFNNDDVDCSKVCTPGCYCRKDFFWYK
NQCKRADECPCEYRASAKQIDSYKFGDKMKKGCQNCLCESRGLWKCDTHD
QCSSRCIITGDPHFVTFDNQHIFVEGQCQYIAVMPKEIESDMPQLSIIVE
NKFCFNSEDITCAKGIKILFGEGLNQTEIEIKSKTEVIINSKLVTIPSKI
NKGVEISVFKVTSDGLKIEAGDLFSVFRKDDSRIELVLSAKYARKVTGLC
GNFNGDPEDDNIMPDGAPAKDDSELAARYRLTQTCHGEVLRQSYLGLCET
SIEWGKIANEVCGKFGQGQFKDCEALVPSDKFVTQCKHDVCNCGLLRNAS
TINCECSAYSAYARICSIKGIQFQWRTPEFCPVICPKNMVYKECGSSCSA
TCRLRQRPNCDNDCIDGCQCPDDMVIEEKTGNCVKVEDCKCEYMGRDYNA
NEERKDRCNTCTCINGLWNCTTKDCSSQSYCPNGKVWKDCGGCQRTCRDM
NLICDPNSCEPGCYCESGEVYDNNKCIPKGECPCFWQNQSFNESAVITRG
PFECQLSCTCRSGKWECPKRDCEGLCKAWGESHYMSFDGKFFDFHGDCSY
VLLEDYCNKKSGTFKIVIENVECGSKGTSCTKSIRFYYKDHIIHLIRGAA
PIIGRNPTWSPYLGTGIFSKHDYVSSIVIITKELKIQWDRQLSVDVFLTP
EYKNNVCGLCGNFDDNVDNDLRNRAGIIDADVNAFADSWKLKTSCPYPEI
SKNPCDINKFRESWAIKRCSILKSETFEPCHNTVRYQLYYDKCVQDSCAC
DRGDDCLCVCTAISQYVHECNRYNIKIQWRNYENCPIMCPPDREYKPCEK
VCPETCIGTKSCISDCMEGCYCKNNTYLKDDECVSEKPLCTCKDESGKEY
PLGTTVIKNCHKCTCQINGFECEKELIHNCLTTVSTSTVVTTTIPTITST
LNETTTFSTSRSTTTKLCEKPLIISNGIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008061chitin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036084Ser_inhib-like_sf
IPR001846VWF_type-D
IPR014853Unchr_dom_Cys-rich
IPR002919TIL_dom
IPR006207Cys_knot_C
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007399nervous system development
GO:0030154cell differentiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 445..616
e-value: 1.9E-22
score: 90.6
coord: 90..254
e-value: 2.7E-5
score: 33.6
coord: 915..1076
e-value: 1.9E-37
score: 140.4
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 926..1076
e-value: 3.2E-28
score: 99.0
coord: 101..252
e-value: 4.3E-14
score: 53.1
coord: 456..616
e-value: 1.7E-26
score: 93.4
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 100..315
score: 20.043
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 455..676
score: 30.24
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 925..1133
score: 38.149
IPR014853Uncharacterised domain, cysteine-richSMARTSM00832c8_acoord: 655..732
e-value: 1.9E-8
score: 44.1
coord: 1112..1186
e-value: 6.8E-24
score: 95.4
IPR014853Uncharacterised domain, cysteine-richPFAMPF08742C8coord: 662..731
e-value: 2.5E-13
score: 50.2
coord: 1119..1185
e-value: 4.9E-16
score: 58.9
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 735..789
e-value: 2.5E-10
score: 40.4
coord: 831..882
e-value: 7.3E-8
score: 32.5
coord: 356..409
e-value: 6.3E-6
score: 26.3
coord: 1189..1236
e-value: 5.5E-6
score: 26.5
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 827..923
e-value: 6.6E-17
score: 63.7
coord: 346..453
e-value: 3.8E-11
score: 45.2
coord: 723..826
e-value: 1.7E-19
score: 72.0
coord: 1175..1280
e-value: 9.5E-12
score: 47.2
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 36..865
coord: 831..1292
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.744
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 830..884
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 730..791
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 1185..1236
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 355..411