CREB-binding protein

Overview
NameCREB-binding protein
Smed IDSMED30002665
Length (bp)5118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CREB-binding protein (SMED30002665) t-SNE clustered cells

Violin plots show distribution of expression levels for CREB-binding protein (SMED30002665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CREB-binding protein (SMED30002665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CREB-binding protein (SMED30002665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30002665SMESG000066809.1 dd_Smed_v4_8613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002665SMESG000048249.1 dd_Smed_v4_9154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002665SMESG000048249.1 dd_Smed_v4_9154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002665SMESG000048249.1 dd_Smed_v6_9154_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CREB-binding protein vs. Ensembl Human
Match: EP300 (E1A binding protein p300 [Source:HGNC Symbol;Acc:HGNC:3373])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 387/817 (47.37%), Postives = 516/817 (63.16%), Query Frame = 3
Query: 1041 ATQLSTDVKMSPDSTSTPNKDHTNA-----HKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +T+L T++K   D  ST     + A      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS L+++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  + +     + K   SK +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N + +K LP   L  ++ENRVN +L+ ++ P   EV VRV+ +SDK VEVKPGMK+ + ++ EM ESF YR KA+FAF+EIDG ++CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  +         ++++  ++K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRA++ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  990 STELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREEN--------TSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1781          

HSP 2 Score: 82.4185 bits (202), Expect = 9.289e-15
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
             D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQSGK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  330 ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 418          
BLAST of CREB-binding protein vs. Ensembl Human
Match: EP300 (E1A binding protein p300 [Source:HGNC Symbol;Acc:HGNC:3373])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 387/817 (47.37%), Postives = 516/817 (63.16%), Query Frame = 3
Query: 1041 ATQLSTDVKMSPDSTSTPNKDHTNA-----HKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +T+L T++K   D  ST     + A      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS L+++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  + +     + K   SK +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N + +K LP   L  ++ENRVN +L+ ++ P   EV VRV+ +SDK VEVKPGMK+ + ++ EM ESF YR KA+FAF+EIDG ++CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  +         ++++  ++K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRA++ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1016 STELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREEN--------TSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1807          

HSP 2 Score: 82.4185 bits (202), Expect = 8.272e-15
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
             D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQSGK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  330 ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 418          
BLAST of CREB-binding protein vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 398/832 (47.84%), Postives = 524/832 (62.98%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1045 KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1851          
BLAST of CREB-binding protein vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 398/832 (47.84%), Postives = 524/832 (62.98%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1083 KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1889          

HSP 2 Score: 82.4185 bits (202), Expect = 8.219e-15
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  344 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLK 434          
BLAST of CREB-binding protein vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 565.844 bits (1457), Expect = 3.060e-177
Identity = 263/492 (53.46%), Postives = 333/492 (67.68%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEE 2588
            K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN           L  DRY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E
Sbjct:  618 KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPK-----YGLLADRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQE 1104          
BLAST of CREB-binding protein vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 444/1253 (35.43%), Postives = 638/1253 (50.92%), Query Frame = 3
Query:  114 DSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQ----------HCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR-----PNNNIRKSVSNKPKINGITNYN------DQFNND--KEVNWRNTIL---------------------------SIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININ------------------------DYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGN------MKDNLEFGTIKKELVANEIP-------------------MTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP------NAAAKSTPVKL-------------PATQLSTDVKMSPDSTSTPNKDHTNAHKK----------WSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDR---DPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEI-DEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHS-QSDAANLP-PINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIP-KSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLR 3467
            D +KR LI+QQL  L HA KC++           NQ          HC  M+ V+ H+T C  G+ C F HC SS++II HWKNC+  +C VC PL+     P       ++N   +NG +N +       QF +   +  N  N++                            ++ P  +   T E    +V +D++NH     V   VK+   E  Q+A+N N                        +Y + LAEK   + + L  K+N + N+   AH+    P     +  Q++  E  +  +  +G+       + N  +G      +  +IP                    TP+      ++     KTE   + + DS    L S P        ++ STP  +              + Q    VK + D  +        A ++          +S E+L    + + + +   +D+ PF++PV+ +LL+IPDY  I+K PMDL T+  KL  G Y N     DD WLM +NAWLYN+K SKVYK    L+++F S++D +M S G+CC ++  + P  L C    +C I R+  Y+ F+   +     ++E    RY  C+KC++    +   ++   N       K+  ++ +N+V + E F  C+ C RKWH++CA H   ++ +GF C  C   K  +   N Y +  LPH +LS ++E+RVN ++K +   +     VI+R L   DK  EVK  MK  Y E+ + PE F YR KAVFAF+ IDG EVCFFGLHVQEYGS CP PN+RRVY+AYLDSVHFF PR+ RTDVYHE L+GYL+YAK LG+TMAHIWACPP EGDDYIFH HPPEQK+PKPKRLQ+WY KML+K ++E  V++++DI+  A + ++ +PT+LPYFEGD+WPN +ED  +E  +EE  R++K           +  +             KK  K K   +       K+  GS T N+V+ K+    EK KE FF IRL S Q++ A L  PI+DPD L  SD+MDGRD  L  ARE+H EFSSLRRAK+STLC  Y LH      + Y CN C+      + C+ C+DF+LC  C  T  HPH + K+      +++         +  T    + R   SL HACQCRD NCR   C KMK +++H + C      TC +C+  + +C  HAK C+   C VP C+ +R
Sbjct:  399 DPEKRKLIQQQLVLLLHAHKCSQREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHFAHCASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEGDGLHQFGSPAMRTGNITNSLFEGFNGNPFQNGPNRGGPRPPGGNGEIPNLPPPDMPDCTKEWH-HQVTKDLRNHL----VGKLVKAIFPEPNQEAMNDNRLKDLIAYARKVEKEMFESANDREEYYHLLAEKIYKIQKELQEKKNSRLNQGAAAHDQYAIPPS--NELAQMLGVEGGRSDVHSEGSSMAVAPSQQNQPWGGAPNSNMHQQIPPNGQVPQVNNSSTFPSSGNSTPNIGASSTVSAMLQPKTEPMDDQNTDS----LSSRPPTAIGFGGSSSSTPAPIMNGIVKKEEDPEESSNQAPPSVKDTKDGVAESKPKEQQAKREPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVFEQSSTQYNVTVTE----RYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDD--------DDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDGLMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSS--PAVWHCQSCDDFDLCDGCKPTTQHPHEMEKI-----KSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFCMNIR 1621          
BLAST of CREB-binding protein vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774825:1 gene:WBGene00000366.1 transcript:R10E11.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 444/1253 (35.43%), Postives = 638/1253 (50.92%), Query Frame = 3
Query:  114 DSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQ----------HCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR-----PNNNIRKSVSNKPKINGITNYN------DQFNND--KEVNWRNTIL---------------------------SIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININ------------------------DYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGN------MKDNLEFGTIKKELVANEIP-------------------MTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP------NAAAKSTPVKL-------------PATQLSTDVKMSPDSTSTPNKDHTNAHKK----------WSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDR---DPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEI-DEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHS-QSDAANLP-PINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIP-KSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLR 3467
            D +KR LI+QQL  L HA KC++           NQ          HC  M+ V+ H+T C  G+ C F HC SS++II HWKNC+  +C VC PL+     P       ++N   +NG +N +       QF +   +  N  N++                            ++ P  +   T E    +V +D++NH     V   VK+   E  Q+A+N N                        +Y + LAEK   + + L  K+N + N+   AH+    P     +  Q++  E  +  +  +G+       + N  +G      +  +IP                    TP+      ++     KTE   + + DS    L S P        ++ STP  +              + Q    VK + D  +        A ++          +S E+L    + + + +   +D+ PF++PV+ +LL+IPDY  I+K PMDL T+  KL  G Y N     DD WLM +NAWLYN+K SKVYK    L+++F S++D +M S G+CC ++  + P  L C    +C I R+  Y+ F+   +     ++E    RY  C+KC++    +   ++   N       K+  ++ +N+V + E F  C+ C RKWH++CA H   ++ +GF C  C   K  +   N Y +  LPH +LS ++E+RVN ++K +   +     VI+R L   DK  EVK  MK  Y E+ + PE F YR KAVFAF+ IDG EVCFFGLHVQEYGS CP PN+RRVY+AYLDSVHFF PR+ RTDVYHE L+GYL+YAK LG+TMAHIWACPP EGDDYIFH HPPEQK+PKPKRLQ+WY KML+K ++E  V++++DI+  A + ++ +PT+LPYFEGD+WPN +ED  +E  +EE  R++K           +  +             KK  K K   +       K+  GS T N+V+ K+    EK KE FF IRL S Q++ A L  PI+DPD L  SD+MDGRD  L  ARE+H EFSSLRRAK+STLC  Y LH      + Y CN C+      + C+ C+DF+LC  C  T  HPH + K+      +++         +  T    + R   SL HACQCRD NCR   C KMK +++H + C      TC +C+  + +C  HAK C+   C VP C+ +R
Sbjct:  399 DPEKRKLIQQQLVLLLHAHKCSQREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHFAHCASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEGDGLHQFGSPAMRTGNITNSLFEGFNGNPFQNGPNRGGPRPPGGNGEIPNLPPPDMPDCTKEWH-HQVTKDLRNHL----VGKLVKAIFPEPNQEAMNDNRLKDLIAYARKVEKEMFESANDREEYYHLLAEKIYKIQKELQEKKNSRLNQGAAAHDQYAIPPS--NELAQMLGVEGGRSDVHSEGSSMAVAPSQQNQPWGGAPNSNMHQQIPPNGQVPQVNNSSTFPSSGNSTPNIGASSTVSAMLQPKTEPMDDQNTDS----LSSRPPTAIGFGGSSSSTPAPIMNGIVKKEEDPEESSNQAPPSVKDTKDGVAESKPKEQQAKREPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVFEQSSTQYNVTVTE----RYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDD--------DDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDGLMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSS--PAVWHCQSCDDFDLCDGCKPTTQHPHEMEKI-----KSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFCMNIR 1621          
BLAST of CREB-binding protein vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 444/1253 (35.43%), Postives = 638/1253 (50.92%), Query Frame = 3
Query:  114 DSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQ----------HCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR-----PNNNIRKSVSNKPKINGITNYN------DQFNND--KEVNWRNTIL---------------------------SIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININ------------------------DYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGN------MKDNLEFGTIKKELVANEIP-------------------MTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP------NAAAKSTPVKL-------------PATQLSTDVKMSPDSTSTPNKDHTNAHKK----------WSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDR---DPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEI-DEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHS-QSDAANLP-PINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIP-KSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLR 3467
            D +KR LI+QQL  L HA KC++           NQ          HC  M+ V+ H+T C  G+ C F HC SS++II HWKNC+  +C VC PL+     P       ++N   +NG +N +       QF +   +  N  N++                            ++ P  +   T E    +V +D++NH     V   VK+   E  Q+A+N N                        +Y + LAEK   + + L  K+N + N+   AH+    P     +  Q++  E  +  +  +G+       + N  +G      +  +IP                    TP+      ++     KTE   + + DS    L S P        ++ STP  +              + Q    VK + D  +        A ++          +S E+L    + + + +   +D+ PF++PV+ +LL+IPDY  I+K PMDL T+  KL  G Y N     DD WLM +NAWLYN+K SKVYK    L+++F S++D +M S G+CC ++  + P  L C    +C I R+  Y+ F+   +     ++E    RY  C+KC++    +   ++   N       K+  ++ +N+V + E F  C+ C RKWH++CA H   ++ +GF C  C   K  +   N Y +  LPH +LS ++E+RVN ++K +   +     VI+R L   DK  EVK  MK  Y E+ + PE F YR KAVFAF+ IDG EVCFFGLHVQEYGS CP PN+RRVY+AYLDSVHFF PR+ RTDVYHE L+GYL+YAK LG+TMAHIWACPP EGDDYIFH HPPEQK+PKPKRLQ+WY KML+K ++E  V++++DI+  A + ++ +PT+LPYFEGD+WPN +ED  +E  +EE  R++K           +  +             KK  K K   +       K+  GS T N+V+ K+    EK KE FF IRL S Q++ A L  PI+DPD L  SD+MDGRD  L  ARE+H EFSSLRRAK+STLC  Y LH      + Y CN C+      + C+ C+DF+LC  C  T  HPH + K+      +++         +  T    + R   SL HACQCRD NCR   C KMK +++H + C      TC +C+  + +C  HAK C+   C VP C+ +R
Sbjct:  399 DPEKRKLIQQQLVLLLHAHKCSQREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHFAHCASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEGDGLHQFGSPAMRTGNITNSLFEGFNGNPFQNGPNRGGPRPPGGNGEIPNLPPPDMPDCTKEWH-HQVTKDLRNHL----VGKLVKAIFPEPNQEAMNDNRLKDLIAYARKVEKEMFESANDREEYYHLLAEKIYKIQKELQEKKNSRLNQGAAAHDQYAIPPS--NELAQMLGVEGGRSDVHSEGSSMAVAPSQQNQPWGGAPNSNMHQQIPPNGQVPQVNNSSTFPSSGNSTPNIGASSTVSAMLQPKTEPMDDQNTDS----LSSRPPTAIGFGGSSSSTPAPIMNGIVKKEEDPEESSNQAPPSVKDTKDGVAESKPKEQQAKREPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVFEQSSTQYNVTVTE----RYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDD--------DDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDGLMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSS--PAVWHCQSCDDFDLCDGCKPTTQHPHEMEKI-----KSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFCMNIR 1621          
BLAST of CREB-binding protein vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 444/1264 (35.13%), Postives = 638/1264 (50.47%), Query Frame = 3
Query:  114 DSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQ----------HCIMMRSVVKHITKC-----------QSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR-----PNNNIRKSVSNKPKINGITNYN------DQFNND--KEVNWRNTIL---------------------------SIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININ------------------------DYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGN------MKDNLEFGTIKKELVANEIP-------------------MTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP------NAAAKSTPVKL-------------PATQLSTDVKMSPDSTSTPNKDHTNAHKK----------WSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDR---DPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEI-DEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHS-QSDAANLP-PINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIP-KSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLR 3467
            D +KR LI+QQL  L HA KC++           NQ          HC  M+ V+ H+T C           Q+ K C   HC SS++II HWKNC+  +C VC PL+     P       ++N   +NG +N +       QF +   +  N  N++                            ++ P  +   T E    +V +D++NH     V   VK+   E  Q+A+N N                        +Y + LAEK   + + L  K+N + N+   AH+    P     +  Q++  E  +  +  +G+       + N  +G      +  +IP                    TP+      ++     KTE   + + DS    L S P        ++ STP  +              + Q    VK + D  +        A ++          +S E+L    + + + +   +D+ PF++PV+ +LL+IPDY  I+K PMDL T+  KL  G Y N     DD WLM +NAWLYN+K SKVYK    L+++F S++D +M S G+CC ++  + P  L C    +C I R+  Y+ F+   +     ++E    RY  C+KC++    +   ++   N       K+  ++ +N+V + E F  C+ C RKWH++CA H   ++ +GF C  C   K  +   N Y +  LPH +LS ++E+RVN ++K +   +     VI+R L   DK  EVK  MK  Y E+ + PE F YR KAVFAF+ IDG EVCFFGLHVQEYGS CP PN+RRVY+AYLDSVHFF PR+ RTDVYHE L+GYL+YAK LG+TMAHIWACPP EGDDYIFH HPPEQK+PKPKRLQ+WY KML+K ++E  V++++DI+  A + ++ +PT+LPYFEGD+WPN +ED  +E  +EE  R++K           +  +             KK  K K   +       K+  GS T N+V+ K+    EK KE FF IRL S Q++ A L  PI+DPD L  SD+MDGRD  L  ARE+H EFSSLRRAK+STLC  Y LH      + Y CN C+      + C+ C+DF+LC  C  T  HPH + K+      +++         +  T    + R   SL HACQCRD NCR   C KMK +++H + C      TC +C+  + +C  HAK C+   C VP C+ +R
Sbjct:  399 DPEKRKLIQQQLVLLLHAHKCSQREKENRDFAAKNQPPPHAACTLPHCSTMKEVLTHMTSCNVGRLCHSDTTQTTKKCSVAHCASSRQIIAHWKNCSREDCPVCKPLKRIQDTPLQFSLPDLANLIGVNGNSNGSAEGDGLHQFGSPAMRTGNITNSLFEGFNGNPFQNGPNRGGPRPPGGNGEIPNLPPPDMPDCTKEWH-HQVTKDLRNHL----VGKLVKAIFPEPNQEAMNDNRLKDLIAYARKVEKEMFESANDREEYYHLLAEKIYKIQKELQEKKNSRLNQGAAAHDQYAIPPS--NELAQMLGVEGGRSDVHSEGSSMAVAPSQQNQPWGGAPNSNMHQQIPPNGQVPQVNNSSTFPSSGNSTPNIGASSTVSAMLQPKTEPMDDQNTDS----LSSRPPTAIGFGGSSSSTPAPIMNGIVKKEEDPEESSNQAPPSVKDTKDGVAESKPKEQQAKREPTPPPTEDTVFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAAMCTIAREQQYWVFEQSSTQYNVTVTE----RYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDD--------DDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDGLMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSS--PAVWHCQSCDDFDLCDGCKPTTQHPHEMEKI-----KSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFCMNIR 1632          
BLAST of CREB-binding protein vs. Ensembl Celegans
Match: cbp-2 (CBP/p300 homolog [Source:UniProtKB/TrEMBL;Acc:G5EBG3])

HSP 1 Score: 83.5741 bits (205), Expect = 1.010e-16
Identity = 63/218 (28.90%), Postives = 101/218 (46.33%), Query Frame = 3
Query:  165 ASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGI-TNYNDQFNNDKEVNWRNTILSIRPNFLV-----KLTDELIPVK-------VCEDVKNH-SGYI-----------------DVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENES 725
            A++   L +TT    C   HC  M+ V+ H+T C  G+ C F HC SS++II HWKNC+  +C VC PL+   ++    S     N I T  N   + D EV  +  + ++    +       L    +PV+       V  D++NH  G +                 D++ Y +  E E+F+ AI+  +Y + LAEK   + + L  K+N + N+ 
Sbjct:   38 AARNQPLPHTT----CRLPHCPTMKEVLIHMTNCNVGRLCHFAHCASSRQIIAHWKNCSREDCPVCTPLKRARDVPLIFSLPHLANLIGTKGNSYGSADGEVVHQIGVSTMSAGRITNGNISNLPPPNVPVRTKEWHRQVTNDLRNHIVGKLVKAICPAPEMMNDIRLKDLNAYARKVEKEVFETAIDRKNYYHLLAEKIYEIQKELQEKKNSRLNQG 251          
BLAST of CREB-binding protein vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0071402)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 398/849 (46.88%), Postives = 535/849 (63.02%), Query Frame = 3
Query: 1089 TPNKDHTNAHKKWSSEEL-SDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQND-KSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNS--------QEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKV--DPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHP---ETPCPTSVP 3587
             PN        +++ EEL + L   + +L   + +S PF+ PV+ + L IPDY  IVK PMDL TI+  + NG Y++PW+ VDD WLMF+NAWLYN+KTS+VY+ C+ L+++FE++ID +M + G+CCGR++ + PQVL C    +C I RDA YY++QN  K  G      +  +RY  C+KC+ND   D   +  +   +  +++K    + +N+  E E FV C+ C RK H++C   +D IW  GF C  C+++K+ K K N + +K LP  +L  YIE RVN +LK ++    EV +RV+SSSDK VEVKPGM+  + E  EM   F YR KA+FAF+E+DG +VCFFG+HVQEYGS+CP PN+RRVY+AYLDSVHFF PR+YRT VYHE L+GY++Y K+LG+TMAHIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK + E ++ DY+DI   A+   + S  ELPYFEGD+WPN LE+  KE+D+E   + K       +        +E E S           K  K  K +  +R NS     K+ N   + ND+S K+   MEK KE FFVIRLHS   AA+L PI DPD L   DLMDGRD  L LAR+KH EFSSLRRA+FSTL   YELH + ++  +Y CN C   +E RY C  C+DF+LC  C     H H + K+  D D+ S + + +   Q   ++  +  + R  +SL HACQCRD NCR+  C KMK +++H + C   P   C +C+  + +C  HAK C + KC VP C  ++   KQQ SQQ+ QQ Q+LRRRVALM R   P   + P   S P
Sbjct: 1685 APNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYG------VASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKG--QKKAKKSNKSKAAQRKNS-----KKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHK---QANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGP 2517          

HSP 2 Score: 65.4698 bits (158), Expect = 5.170e-10
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLA-YTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNI 389
            V  D++  I+QQL  L HA KC R       +  C+  +C  M+SV+ H+  C+  KDC  QHC SS++I+ H+K C +  C +C P R N+++
Sbjct:  507 VPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPFRQNHSV 600          
BLAST of CREB-binding protein vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0302723)

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 398/849 (46.88%), Postives = 535/849 (63.02%), Query Frame = 3
Query: 1089 TPNKDHTNAHKKWSSEEL-SDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQND-KSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNS--------QEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKV--DPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHP---ETPCPTSVP 3587
             PN        +++ EEL + L   + +L   + +S PF+ PV+ + L IPDY  IVK PMDL TI+  + NG Y++PW+ VDD WLMF+NAWLYN+KTS+VY+ C+ L+++FE++ID +M + G+CCGR++ + PQVL C    +C I RDA YY++QN  K  G      +  +RY  C+KC+ND   D   +  +   +  +++K    + +N+  E E FV C+ C RK H++C   +D IW  GF C  C+++K+ K K N + +K LP  +L  YIE RVN +LK ++    EV +RV+SSSDK VEVKPGM+  + E  EM   F YR KA+FAF+E+DG +VCFFG+HVQEYGS+CP PN+RRVY+AYLDSVHFF PR+YRT VYHE L+GY++Y K+LG+TMAHIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK + E ++ DY+DI   A+   + S  ELPYFEGD+WPN LE+  KE+D+E   + K       +        +E E S           K  K  K +  +R NS     K+ N   + ND+S K+   MEK KE FFVIRLHS   AA+L PI DPD L   DLMDGRD  L LAR+KH EFSSLRRA+FSTL   YELH + ++  +Y CN C   +E RY C  C+DF+LC  C     H H + K+  D D+ S + + +   Q   ++  +  + R  +SL HACQCRD NCR+  C KMK +++H + C   P   C +C+  + +C  HAK C + KC VP C  ++   KQQ SQQ+ QQ Q+LRRRVALM R   P   + P   S P
Sbjct: 1685 APNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYG------VASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKG--QKKAKKSNKSKAAQRKNS-----KKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHK---QANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGP 2517          

HSP 2 Score: 65.4698 bits (158), Expect = 5.170e-10
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLA-YTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNI 389
            V  D++  I+QQL  L HA KC R       +  C+  +C  M+SV+ H+  C+  KDC  QHC SS++I+ H+K C +  C +C P R N+++
Sbjct:  507 VPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPFRQNHSV 600          
BLAST of CREB-binding protein vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0302722)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 398/849 (46.88%), Postives = 535/849 (63.02%), Query Frame = 3
Query: 1089 TPNKDHTNAHKKWSSEEL-SDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQND-KSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNS--------QEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKV--DPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHP---ETPCPTSVP 3587
             PN        +++ EEL + L   + +L   + +S PF+ PV+ + L IPDY  IVK PMDL TI+  + NG Y++PW+ VDD WLMF+NAWLYN+KTS+VY+ C+ L+++FE++ID +M + G+CCGR++ + PQVL C    +C I RDA YY++QN  K  G      +  +RY  C+KC+ND   D   +  +   +  +++K    + +N+  E E FV C+ C RK H++C   +D IW  GF C  C+++K+ K K N + +K LP  +L  YIE RVN +LK ++    EV +RV+SSSDK VEVKPGM+  + E  EM   F YR KA+FAF+E+DG +VCFFG+HVQEYGS+CP PN+RRVY+AYLDSVHFF PR+YRT VYHE L+GY++Y K+LG+TMAHIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK + E ++ DY+DI   A+   + S  ELPYFEGD+WPN LE+  KE+D+E   + K       +        +E E S           K  K  K +  +R NS     K+ N   + ND+S K+   MEK KE FFVIRLHS   AA+L PI DPD L   DLMDGRD  L LAR+KH EFSSLRRA+FSTL   YELH + ++  +Y CN C   +E RY C  C+DF+LC  C     H H + K+  D D+ S + + +   Q   ++  +  + R  +SL HACQCRD NCR+  C KMK +++H + C   P   C +C+  + +C  HAK C + KC VP C  ++   KQQ SQQ+ QQ Q+LRRRVALM R   P   + P   S P
Sbjct: 1691 APNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYG------VASNRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKG--QKKAKKSNKSKAAQRKNS-----KKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHK---QANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGP 2523          

HSP 2 Score: 65.4698 bits (158), Expect = 5.303e-10
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLA-YTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNI 389
            V  D++  I+QQL  L HA KC R       +  C+  +C  M+SV+ H+  C+  KDC  QHC SS++I+ H+K C +  C +C P R N+++
Sbjct:  513 VPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPFRQNHSV 606          
BLAST of CREB-binding protein vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0333521)

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 396/848 (46.70%), Postives = 531/848 (62.62%), Query Frame = 3
Query: 1089 TPNKDHTNAHKKWSSEEL-SDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNS--------QEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKV--DPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHP---ETPCPTSVP 3587
             PN        +++ EEL + L   + +L   + +S PF+ PV+ + L IPDY  IVK PMDL TI+  + NG Y++PW+ VDD WLMF+NAWLYN+KTS+VY+ C+ L+++FE++ID +M + G+CCGR++ + PQVL C    +C I RDA YY++QN               RY  C+KC+ND   D   +  +   +  +++K    + +N+  E E FV C+ C RK H++C   +D IW  GF C  C+++K+ K K N + +K LP  +L  YIE RVN +LK ++    EV +RV+SSSDK VEVKPGM+  + E  EM   F YR KA+FAF+E+DG +VCFFG+HVQEYGS+CP PN+RRVY+AYLDSVHFF PR+YRT VYHE L+GY++Y K+LG+TMAHIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK + E ++ DY+DI   A+   + S  ELPYFEGD+WPN LE+  KE+D+E   + K       +        +E E S           K  K  K +  +R NS     K+ N   + ND+S K+   MEK KE FFVIRLHS   AA+L PI DPD L   DLMDGRD  L LAR+KH EFSSLRRA+FSTL   YELH + ++  +Y CN C   +E RY C  C+DF+LC  C     H H + K+  D D+ S + + +   Q   ++  +  + R  +SL HACQCRD NCR+  C KMK +++H + C   P   C +C+  + +C  HAK C + KC VP C  ++   KQQ SQQ+ QQ Q+LRRRVALM R   P   + P   S P
Sbjct: 1685 APNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQN---------------RYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKG--QKKAKKSNKSKAAQRKNS-----KKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHK---QANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGP 2507          

HSP 2 Score: 65.4698 bits (158), Expect = 5.256e-10
Identity = 36/94 (38.30%), Postives = 55/94 (58.51%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLA-YTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNI 389
            V  D++  I+QQL  L HA KC R       +  C+  +C  M+SV+ H+  C+  KDC  QHC SS++I+ H+K C +  C +C P R N+++
Sbjct:  507 VPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCQNSGCVICYPFRQNHSV 600          
BLAST of CREB-binding protein vs. Ensembl Fly
Match: fs(1)h (gene:FBgn0004656 transcript:FBtr0071119)

HSP 1 Score: 79.7221 bits (195), Expect = 2.641e-14
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 3
Query: 1128 SSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDI 1445
            ++ +L  L   + ++I     S PF+ PV+ + L++PDY  I+K PMD+ TIK +L N  Y +  + + DF  MFNN ++YNK    V  M  TL K+F  KI+ +
Sbjct:   35 NTNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLEKVFLQKIESM 140          

HSP 2 Score: 60.8474 bits (146), Expect = 1.568e-8
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1128 SSEELSDLFM---EIHQLILSDKDSE---PFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDI 1445
            + E+LSD      EI + + S K S    PF  PV+ E+L + DY  I+K PMDL T+K K+ N  Y +  +   D  L+F N + YN     V  M   L  +FE +  +I
Sbjct:  473 NKEKLSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDYHDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYANI 584          
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Match: crebbpb (CREB binding protein b [Source:ZFIN;Acc:ZDB-GENE-050302-102])

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 406/856 (47.43%), Postives = 536/856 (62.62%), Query Frame = 3
Query: 1068 MSPDSTSTPNKDHTNAHKK-WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYN-----------DSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQ-RGMHPETPCPTS 3581
            +S  ++STP      + KK +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M   G+CCGR++ + PQ L C    +C I RD  YY++QN               RY  CEKC+N           D  +   ++++    +   + K    K +N+  ++E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  YIE+RVNKYLK ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  + T +S+  E +Q +  +    +       K  + R N     +K+    +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R+ C  CEDF+LC +CY ++ H H + K  +  D++SN  N    +  + +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  QQR+QQAQM+RRR+ALMQ RGM P  P PT+
Sbjct:  999 VSSTNSSTPANQSAQSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPNLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTISRDGTYYSYQN---------------RYHFCEKCFNEIQGDSVTLGDDPTQSQTYVSSAAQKSLSMISKEQFEKKKNDTLDSEPFVECKDCGRKMHQICVLHYDVIWPSGFICDNCLKKSGKSRKENKFSAKKLQCTRLGSYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSIHFFKPRLLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRLTSAYELPYFEGDFWPNVLEESIKELEQEEEERKKEEN-TASSETTEGAQADSKNAKKKNNKKTNKNKSSVSRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVVNTLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNSKGHEHQMVKWGLGLDDDSN--NQGGEANKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQQRLQQAQMMRRRMALMQGRGMPPSLPSPTT 1831          

HSP 2 Score: 83.5741 bits (205), Expect = 2.533e-15
Identity = 48/112 (42.86%), Postives = 62/112 (55.36%), Query Frame = 3
Query:   42 NLKMTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            NL       V  V     +  P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  298 NLLQQQVPSVGMVPGQGVSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 409          
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 380/789 (48.16%), Postives = 499/789 (63.24%), Query Frame = 3
Query: 1107 TNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            TN  K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA Y+++QN           L  DRY  CEKC+N+   +   +  + +     + K    K +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  ++E RVN YLK ++ P   EV VRV+  S+K+VEVKPGMKS + ++ EM ESF Y+ KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT+VYHE L+GYL+YAK+ GFT  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA+ E VV DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T N +  ET++ +  +    +       K  L R N     +K+    +  ND+S+K+   MEK KE FFVIRL +  ++  L PI DPD L   DLMDGRD  L +AR+KHLEFSSLRR+K+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN   +     P   D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1046 TNKKKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPK-----YGLLADRYHFCEKCFNEIQGETVSLGDDPSQPQTSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSN-ESVETTKGDSKNAKKKNNKKTSKNKSSLSRGN-----KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDPLMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPG--DSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1821          

HSP 2 Score: 83.1889 bits (204), Expect = 3.424e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  343 PAADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 433          
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Match: crebbpb (CREB binding protein b [Source:ZFIN;Acc:ZDB-GENE-050302-102])

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 405/864 (46.88%), Postives = 535/864 (61.92%), Query Frame = 3
Query: 1068 MSPDSTSTPNKDHTNAHKK-WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYN-----------DSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVR-YTCKQCE-------DFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQ-RGMHPETPCPTS 3581
            +S  ++STP      + KK +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M   G+CCGR++ + PQ L C    +C I RD  YY++QN               RY  CEKC+N           D  +   ++++    +   + K    K +N+  ++E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  YIE+RVNKYLK ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  + T +S+  E +Q +  +    +       K  + R N     +K+    +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R + C  C        DF+LC +CY ++ H H + K  +  D++SN  N    +  + +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  QQR+QQAQM+RRR+ALMQ RGM P  P PT+
Sbjct:  999 VSSTNSSTPANQSAQSRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPNLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTISRDGTYYSYQN---------------RYHFCEKCFNEIQGDSVTLGDDPTQSQTYVSSAAQKSLSMISKEQFEKKKNDTLDSEPFVECKDCGRKMHQICVLHYDVIWPSGFICDNCLKKSGKSRKENKFSAKKLQCTRLGSYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSIHFFKPRLLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRLTSAYELPYFEGDFWPNVLEESIKELEQEEEERKKEEN-TASSETTEGAQADSKNAKKKNNKKTNKNKSSVSRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVVNTLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRCFMCYYCPENCINSFDFDLCINCYNSKGHEHQMVKWGLGLDDDSN--NQGGEANKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQQRLQQAQMMRRRMALMQGRGMPPSLPSPTT 1839          

HSP 2 Score: 83.5741 bits (205), Expect = 2.514e-15
Identity = 48/112 (42.86%), Postives = 62/112 (55.36%), Query Frame = 3
Query:   42 NLKMTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            NL       V  V     +  P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  298 NLLQQQVPSVGMVPGQGVSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 409          
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Match: CR354584.4 (E1A binding protein p300 a [Source:NCBI gene;Acc:559273])

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 382/798 (47.87%), Postives = 499/798 (62.53%), Query Frame = 3
Query: 1107 TNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYND-SCEDVQFINAENNGAAC--------KVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            TN  K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA Y+++QN           L  DRY  CEKC+N+   E V   +  +              + K    K +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  ++E RVN YLK ++ P   EV VRV+  S+K+VEVKPGMKS + ++ EM ESF Y+ KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT+VYHE L+GYL+YAK+ GFT  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA+ E VV DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T N +  ET++ +  +    +       K  L R N     +K+    +  ND+S+K+   MEK KE FFVIRL +  ++  L PI DPD L   DLMDGRD  L +AR+KHLEFSSLRR+K+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN   +     P   D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1041 TNKKKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPK-----YGLLADRYHFCEKCFNEIQGETVSLGDDPSQPQTATIFLNISRSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSN-ESVETTKGDSKNAKKKNNKKTSKNKSSLSRGN-----KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDPLMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPG--DSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1825          

HSP 2 Score: 83.1889 bits (204), Expect = 3.122e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  339 PAADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 429          
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 382/798 (47.87%), Postives = 499/798 (62.53%), Query Frame = 3
Query: 1107 TNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYND-SCEDVQFINAENNGAAC--------KVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            TN  K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA Y+++QN           L  DRY  CEKC+N+   E V   +  +              + K    K +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  ++E RVN YLK ++ P   EV VRV+  S+K+VEVKPGMKS + ++ EM ESF Y+ KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT+VYHE L+GYL+YAK+ GFT  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA+ E VV DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T N +  ET++ +  +    +       K  L R N     +K+    +  ND+S+K+   MEK KE FFVIRL +  ++  L PI DPD L   DLMDGRD  L +AR+KHLEFSSLRR+K+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN   +     P   D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1045 TNKKKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPK-----YGLLADRYHFCEKCFNEIQGETVSLGDDPSQPQTATIFLNISRSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSN-ESVETTKGDSKNAKKKNNKKTSKNKSSLSRGN-----KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDPLMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPG--DSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1829          

HSP 2 Score: 83.1889 bits (204), Expect = 3.313e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  343 PAADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 433          
BLAST of CREB-binding protein vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 383/802 (47.76%), Postives = 510/802 (63.59%), Query Frame = 3
Query: 1071 SPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +P + ++P     +  K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN           L  DRY  CEKC+N+   +   +  +       + K   SK +N+  + E++V C  C RK H++C  H + IW  GF C  C+++     K N + +K LP   L  ++ENRVN +L+ ++ P   EVI+RV+ +SDK VEVKPGMK+ + +T EM ESF YR KA+FAF+E+DG E+CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY K+LG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK++ E V+ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + +  S E        + K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI +PD L   DLMDGRD  L LAR+KHLEFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+TH H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1060 TPAAQTSPAPPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPK-----YGLLADRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIE--------VGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1846          

HSP 2 Score: 83.5741 bits (205), Expect = 3.416e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  328 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 418          
BLAST of CREB-binding protein vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 383/809 (47.34%), Postives = 510/809 (63.04%), Query Frame = 3
Query: 1071 SPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIP-------DYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +P + ++P     +  K +  EEL    M  +  L   D +S PF+ PV+ +LL IP       DY  IVK PMDLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN           L  DRY  CEKC+N+   +   +  +       + K   SK +N+  + E++V C  C RK H++C  H + IW  GF C  C+++     K N + +K LP   L  ++ENRVN +L+ ++ P   EVI+RV+ +SDK VEVKPGMK+ + +T EM ESF YR KA+FAF+E+DG E+CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY K+LG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK++ E V+ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + +  S E        + K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI +PD L   DLMDGRD  L LAR+KHLEFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+TH H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1061 TPAAQTSPAPPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPKNTSVLQDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPK-----YGLLADRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIE--------VGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1854          

HSP 2 Score: 83.5741 bits (205), Expect = 3.656e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  329 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 419          
BLAST of CREB-binding protein vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 378/784 (48.21%), Postives = 500/784 (63.78%), Query Frame = 3
Query: 1125 WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  +       + K   SK +N+  + E++V C  C RK H++C  H + IW  GF C  C+++     K N + +K LP   L  ++ENRVN +L+ ++ P   EVI+RV+ +SDK VEVKPGMK+ + +T EM ESF YR KA+FAF+E+DG E+CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY K+LG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK++ E V+ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + +  S E        + K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI +PD L   DLMDGRD  L LAR+KHLEFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+TH H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  882 FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIE--------VGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1640          

HSP 2 Score: 83.1889 bits (204), Expect = 4.873e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  299 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 389          
BLAST of CREB-binding protein vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 378/784 (48.21%), Postives = 500/784 (63.78%), Query Frame = 3
Query: 1125 WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  +       + K   SK +N+  + E++V C  C RK H++C  H + IW  GF C  C+++     K N + +K LP   L  ++ENRVN +L+ ++ P   EVI+RV+ +SDK VEVKPGMK+ + +T EM ESF YR KA+FAF+E+DG E+CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY K+LG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK++ E V+ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + +  S E        + K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI +PD L   DLMDGRD  L LAR+KHLEFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+TH H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  859 FKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIE--------VGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1617          

HSP 2 Score: 84.3445 bits (207), Expect = 1.943e-15
Identity = 48/111 (43.24%), Postives = 65/111 (58.56%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITN 434
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+ N   +++ S  P   G   
Sbjct:  329 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK-NAGDKRNQSKSPGAVGTVG 438          
BLAST of CREB-binding protein vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 378/781 (48.40%), Postives = 499/781 (63.89%), Query Frame = 3
Query: 1134 EELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  +       + K   SK +N+  + E++V C  C RK H++C  H + IW  GF C  C+++     K N + +K LP   L  ++ENRVN +L+ ++ P   EVI+RV+ +SDK VEVKPGMK+ + +T EM ESF YR KA+FAF+E+DG E+CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY K+LG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDK++ E V+ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + +  S E        + K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI +PD L   DLMDGRD  L LAR+KHLEFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+TH H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  884 EELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIE--------VGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1639          

HSP 2 Score: 83.1889 bits (204), Expect = 3.855e-15
Identity = 48/109 (44.04%), Postives = 65/109 (59.63%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIR---KSVSNKPKI 419
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+   + R   KS+   P +
Sbjct:  287 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQSKSLLGGPPV 395          
BLAST of CREB-binding protein vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 403/854 (47.19%), Postives = 530/854 (62.06%), Query Frame = 3
Query: 1053 STDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            S D      S S P K      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+    +  PPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1030 SNDTASQSTSPSQPRK------KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1852          
BLAST of CREB-binding protein vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 403/854 (47.19%), Postives = 530/854 (62.06%), Query Frame = 3
Query: 1053 STDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            S D      S S P K      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+    +  PPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1068 SNDTASQSTSPSQPRK------KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1890          

HSP 2 Score: 82.4185 bits (202), Expect = 5.275e-15
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  343 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLK 433          
BLAST of CREB-binding protein vs. Ensembl Mouse
Match: Ep300 (E1A binding protein p300 [Source:MGI Symbol;Acc:MGI:1276116])

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 399/874 (45.65%), Postives = 535/874 (61.21%), Query Frame = 3
Query:  897 PDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP--NAAAKSTPVKLPATQ-------LSTDVKM---SPDSTSTPNKDHTNAHKK--WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            P+K+  Q+      +K ES  E D   K E  ++ P     AK   VK+  T+       L TD K     P +++T +       KK  +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  +DD WLMFNNAWLYN+KTS+VYK CS L+++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  + +     + K   SK +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N   +K LP   L  ++ENRVN +L+ ++ P   EV VRV+ +SDK VEVKPGMK+ + ++ EM ESF YR KA+FAF+EIDG ++CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E +V DY+DI   A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  +         ++++  ++K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +     +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRA++ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  967 PEKQPSQE------VKMESKMEVD---KPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREEN--------TSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1806          

HSP 2 Score: 82.4185 bits (202), Expect = 5.631e-15
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
             D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQSGK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  331 ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 419          
BLAST of CREB-binding protein vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 565.459 bits (1456), Expect = 3.145e-177
Identity = 269/514 (52.33%), Postives = 339/514 (65.95%), Query Frame = 3
Query: 1053 STDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEE 2588
            S D      S S P K      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN           L  DRY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E
Sbjct:  604 SNDTASQSTSPSQPRK------KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPK-----YGLLADRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQE 1106          
BLAST of CREB-binding protein vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 197.208 bits (500), Expect = 2.493e-57
Identity = 103/207 (49.76%), Postives = 126/207 (60.87%), Query Frame = 3
Query: 2037 KSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRL----KSYSETPNSQEGET 2645
            KS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+R V                                        HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R      + SETP   +G++
Sbjct:    2 KSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRYV--------------------------------------TGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDS 170          
BLAST of CREB-binding protein vs. UniProt/SwissProt
Match: sp|Q09472|EP300_HUMAN (Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2)

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 387/817 (47.37%), Postives = 516/817 (63.16%), Query Frame = 3
Query: 1041 ATQLSTDVKMSPDSTSTPNKDHTNA-----HKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +T+L T++K   D  ST     + A      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS L+++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  + +     + K   SK +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N + +K LP   L  ++ENRVN +L+ ++ P   EV VRV+ +SDK VEVKPGMK+ + ++ EM ESF YR KA+FAF+EIDG ++CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  +         ++++  ++K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRA++ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1016 STELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREEN--------TSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1807          

HSP 2 Score: 82.4185 bits (202), Expect = 3.972e-14
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
             D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQSGK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  330 ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 418          
BLAST of CREB-binding protein vs. UniProt/SwissProt
Match: sp|Q92793|CBP_HUMAN (CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3)

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 398/832 (47.84%), Postives = 524/832 (62.98%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1083 KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1889          

HSP 2 Score: 82.4185 bits (202), Expect = 3.947e-14
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  344 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLK 434          
BLAST of CREB-binding protein vs. UniProt/SwissProt
Match: sp|Q6JHU9|CBP_RAT (Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 397/832 (47.72%), Postives = 524/832 (62.98%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+    +  PPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1084 KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1890          

HSP 2 Score: 82.4185 bits (202), Expect = 3.947e-14
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  343 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLK 433          
BLAST of CREB-binding protein vs. UniProt/SwissProt
Match: sp|B2RWS6|EP300_MOUSE (Histone acetyltransferase p300 OS=Mus musculus OX=10090 GN=Ep300 PE=1 SV=2)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 399/874 (45.65%), Postives = 535/874 (61.21%), Query Frame = 3
Query:  897 PDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSP--NAAAKSTPVKLPATQ-------LSTDVKM---SPDSTSTPNKDHTNAHKK--WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            P+K+  Q+      +K ES  E D   K E  ++ P     AK   VK+  T+       L TD K     P +++T +       KK  +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  +DD WLMFNNAWLYN+KTS+VYK CS L+++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA YY++QN               RY  CEKC+N+   +   +  + +     + K   SK +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N   +K LP   L  ++ENRVN +L+ ++ P   EV VRV+ +SDK VEVKPGMK+ + ++ EM ESF YR KA+FAF+EIDG ++CFFG+HVQEYGSDCP PN RRVY++YLDSVHFF P+  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E +V DY+DI   A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  +         ++++  ++K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +     +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRA++ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN  N Q  +  +  D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct:  967 PEKQPSQE------VKMESKMEVD---KPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREEN--------TSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESN--NQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1806          

HSP 2 Score: 82.4185 bits (202), Expect = 3.939e-14
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
             D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQSGK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  331 ADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 419          
BLAST of CREB-binding protein vs. UniProt/SwissProt
Match: sp|P45481|CBP_MOUSE (Histone lysine acetyltransferase CREBBP OS=Mus musculus OX=10090 GN=Crebbp PE=1 SV=3)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 394/854 (46.14%), Postives = 520/854 (60.89%), Query Frame = 3
Query: 1053 STDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK----VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPET--PCPTSVP 3587
            S D      S S P K      K +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA YY++QN               RY  CEKC+ +   +   +  + +     + K    K +N+  + E FV C+ C RK H++C  H D IW  GF C  C+++     K N + +K L    L  ++E+RVNK+L+ ++ P   EV VRV++SSDK VEVKPGMKS + ++ EM ESF YR KA+FAF+EIDG +VCFFG+HVQ      P     RVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  S T  S+  E SQ +  +    +       K  + R N     +K+ +  +  ND+S+K+   MEK KE FFVI LH+    +  PPI DPD L   DLMDGRD  L LAR+KH EFSSLRR+K+STLC   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T++H H + K    +D DE S+    Q+ S    +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQ++RRR+A M     P+   P PTS P
Sbjct: 1068 SNDTASQSTSPSQPRK------KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQN---------------RYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEES-TAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRAN-----KKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLD-DEGSSQGEPQSKS---PQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAP 1890          

HSP 2 Score: 82.4185 bits (202), Expect = 3.784e-14
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  343 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLK 433          
BLAST of CREB-binding protein vs. TrEMBL
Match: A0A4S2MD36 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000917 PE=4 SV=1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 501/1189 (42.14%), Postives = 699/1189 (58.79%), Query Frame = 3
Query:  132 LIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCA-----------PLRPNNNIR-------KSVSNKP---KINGITNYNDQF-------------NNDKEVNWRNTILSI---RPNFLVKLTDELIPVKVCEDVKNHSGYIDVS-----NYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTI--KKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLE-------SSPNAAAKST------PVKLPATQ------------LSTDVKMSPDSTS----TPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMN---SLNNKRKRING---SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTS-EDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQC-CSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNC 3455
            L+++QL  L HA +C RL        C+ +HC++MR V+ H+ KC     C   HC SSK I++H+  C+   C VC            P  P    +        S  +KP    +NGI N +  +             N +   N RN+       R + + K  +  + +       N + Y D       +++K  E +IF K+    +Y   L  ++  ++  L  +R  +    +   N  +N           IK+E      A  G   ++ E   +    E+V      TP +E     A  S          D  + +++ +       S+P+   KS+      PV  P T+            +S+DVK S +  S     P ++ +N    W   EL   F+ +   I  +KD+EPF  PV+WE L+I DYP I+  PMDLSTI+ KL N  Y +PW VVDDFWLMFNNAWLYNKKTSKVYK C+ LA+ FE+ ID +M   GFCCGRE+ YLP  L C TP  C I RDAVYY ++ND          L   +Y  CE+CYN++ ++++ +++E++     VQK+L+ KC+N+ KE E FVFC+ C RKWH+VCA H D++W +GF C  C+R+  +K   N Y ++ LP C LS ++E RVN +LK +    ++VI+RVL+S+DK VEVKPGMKS +CET +MPESF YR+KA+FAFQEIDGQEVCFFGLHVQEYGS+CP PN+RRVYLAYLDSV+FF P++YRTDVYHE LVGY+ YAK LG+ +AHIWACPP EGDDYIFHMHP +QK+PKPKRLQEWY KML KA+ E +V+DY+DI  +A  S ++SPTEL YFEGD+WPN LE++FKE+DEE  +R +         E + ++  + ++ N     KK  K++  + N   SL  KRKR+NG   +D  ++V+R+V E+MEK KENFFVIRLH Q+  ++LP I D D L +SDLM+ R   L  AREKHLEFSS+RRAK+STL   YELH E +  ++Y CN CN Q+E  + C+QC +++LCP CY TE HPH + ++    +    NS   S+  + +++ R ++ R  K+L H C CRD NCR+  C  MK  ++HF+   +  ++ C +C+    +C+ H+K C + KC VP C
Sbjct:   28 LMQRQLALLLHAERCRRLENDGLTLTCNIRHCMLMRQVLDHMDKCLHEDGCSVAHCRSSKRILRHFNVCSAWSCDVCTAVKRPLIKADIPSHPGTEYQNGPVCNFASSGSKPDTTTMNGIKNPSPHYEVTPTPCSSSPALNGEIGRNNRNSFPLTDEQRKDAMKKFVNVSLSIF---PAANSTAYNDPRMQQFLDHLKRMEKDIFMKSKTAEEYYAALTARYQSIHSELKEQRRLRGARPLEPSNEESN-----------IKNE------AHSGRSSESTEPDRVCDGSEIVCKREDATPVEESRSSPASSSATSFVKSVPMDTAAAQQVNQDCCEQPTSTPSVEIKSSSIDTTQPVTAPTTRSPRDGGANSDVTMSSDVKPSDEPKSEVGQQPLREASN-RAVWYPNELQRYFLPVVDRISKEKDAEPFLQPVDWESLEIYDYPQIITHPMDLSTIRKKLENREYKDPWSVVDDFWLMFNNAWLYNKKTSKVYKTCTKLAEFFETTIDPVMQQLGFCCGREYYYLPPPLTCLTPKFCTIQRDAVYYVYKNDDQ-----TPGLLEQKYTVCERCYNEAGDEIR-LDSESS-TVVTVQKNLMEKCKNDRKEKEPFVFCKKCGRKWHRVCAIHADEVWPEGFVCNRCMRDYGLKRPENRYTARKLPTCRLSNFLEKRVNDFLKKKGTDASDVIIRVLASADKTVEVKPGMKSRFCETGDMPESFPYRVKAIFAFQEIDGQEVCFFGLHVQEYGSECPPPNTRRVYLAYLDSVYFFRPKQYRTDVYHEILVGYIHYAKLLGYAVAHIWACPPSEGDDYIFHMHPTDQKIPKPKRLQEWYQKMLKKALLERIVVDYKDICQEACESGLVSPTELAYFEGDFWPNTLEELFKEMDEEDAKRKREQEALARDDEDDETKENLQTRENEKNPGKKKAKKRKMKRNASLSLPGKRKRLNGGNSADASSEVARRVYEIMEKHKENFFVIRLHPQNSVSSLPAIKDLDPLINSDLMECRGAFLERAREKHLEFSSVRRAKYSTLVMLYELHTENRQPLMYTCNMCNVQLETPWHCRQCVEYDLCPRCYETEKHPHPMVQIGLGLDDGTKNSDVDSEAAAVQESGRDKLSRLVKALGHGCSCRDANCRVFACKTMKSNVQHFRVHAAAARNQCNVCRSLSFLCYYHSKTCQELKCPVPLC 1188          
BLAST of CREB-binding protein vs. TrEMBL
Match: A0A4Z2D8G5 (CREB-binding protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003439 PE=4 SV=1)

HSP 1 Score: 922.154 bits (2382), Expect = 0.000e+0
Identity = 542/1289 (42.05%), Postives = 741/1289 (57.49%), Query Frame = 3
Query:   42 NLKMTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRP-----------------NNNIRKSVSNKPKINGI-----------TNYNDQFNNDKEVNWRNTILSIRPNFLVKLTD---ELIPVKVCEDVK-------NHSGYIDVS-----NYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTK--------QIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTE--NDIDSK----------RELLESSPNAAAKSTPVK-------LPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRR------LKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRING---SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTT-----RARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQR-----GMHPETPCPTSVPLQ-SQTSITSINTQPPSI 3638
             + M SS+       TD+  Q L    K  L+RQQL  L HA  C RL       +C +++C  +RS++ H+  C   K+C   HC SSK I++H+++C D+EC+VC+ +R                  N       S+   +NGI           T +       +     N  +S  P    ++TD   EL   K   D+        N + Y D       +YVK  E ++F K+ +  +Y   +A  +  ++  L  KR  +E+   L +   ++ T+          E  F+    E D+F         D LE    ++E +  EI          K+A  +   +    E   D D K            +    PN +   T ++        P    S + K  P ++  P +      + W S EL   F+ +   I  +KD+EPF  PV+W+ L+I DYP IV  PMDLSTI+ KL +  Y +PW++VDDFWLM NNAWLYNKKTSKVYK C+ LA+ FES ID +M S GFCCGRE+ Y P  L C TP  C I RDAVYY +   KS+G+     L   +Y  CE+CYN++ + +   +  +N     VQK+L+ KC+N++KE E FVFC+ C RKWH+VCA ++++IW DGF C  CI    +K   N + +K L  C+LS ++E RVN +LK ++    +VI+RVL+++DK VEVK GMK+ +C   EMPESF YR+KA+FAFQEIDGQEVCFFGLHVQEYGS+CP PN+RRVY+AYLDSV+FF P+++RT++YHE LVGY+ YAK LGFTMAHIWACPP EGDDYIFHMHPP+QK+PKPKRLQEWY KML KA+ E +V+DY+DI  DA  S M+SP EL YFEGD+WPN LE+IFKE+DEE  +R      L       + +  E  QT+   +N   K  K+ K ++   + ++  KRKR+ G    D  N+V+R+V E+MEK KENFFVIRLH Q+   +LPPI DPD L +S+LM+ R   L  AREKHLEFSSLRRAK+STL   YELH E +  ++Y CN C+ Q+E  + CKQC +++LCP CY TE HPH + K+        L+  N  Q  S D+      R ++ R+ K+L H+C CRD NCR+  C  MK  ++HF+  S  ++ C +C+    +C  H+K C + KC VP C  L+   KQQ  QQR++Q QMLRRR+A MQR       H  TP P+    Q SQ+S +   + P SI
Sbjct:    3 GVNMQSSTTDQITYTTDR-PQGLSTEAKMILMRQQLALLLHADHCERLERRGMATNCMDRNCGEIRSLLPHLQSCTREKECSVPHCISSKYIMRHYRSCRDMECKVCSAVRKPIVNSTPSSASSVSCSQNGLSSSHKSDLSSLNGIKISDSPLPPLKTPFTAGSCESQSTVVLNGEVSRVPLHASRITDQQRELAMKKFVNDISLSIFPTANPTAYSDPRMKQFLDYVKRMEKDVFIKSKSTEEYFKTMALHYHNIHSELKEKRRLRESCPPLQNGDISDVTQPSDLTNSVSSENKFKTNPYEQDQF--------SDALEIVCKREEQIQREI----------KVAVENSSNSSESAEVLEDKDGKDDSNSPEVKCHSVASIDPNESDTKTGIEKNDLESEAPEASSSDEKKTDPQTSREPIR-----RRIWYSNELLQYFLPVVLKISKEKDAEPFLTPVDWKFLEIYDYPQIVSDPMDLSTIRKKLEDREYKDPWEIVDDFWLMLNNAWLYNKKTSKVYKTCTRLAETFESIIDPVMQSLGFCCGREYYYQPPTLTCLTPKFCTIYRDAVYYVY---KSDGQ--TPGLLEQKYTVCERCYNEAMDQIALDSDSSN--PVNVQKNLMEKCKNDIKEKEPFVFCKHCGRKWHRVCAIYLEEIWPDGFICNHCIVNYGLKRVENRFTAKKLTTCKLSNFLEKRVNDFLKKKEADAGDVIIRVLAAADKTVEVKSGMKARFCGNGEMPESFPYRVKAIFAFQEIDGQEVCFFGLHVQEYGSECPLPNTRRVYVAYLDSVYFFRPKQFRTEIYHELLVGYIHYAKLLGFTMAHIWACPPSEGDDYIFHMHPPDQKIPKPKRLQEWYQKMLKKALIERIVVDYKDICQDANESHMISPAELAYFEGDFWPNTLEEIFKEMDEEDAKRKQEQEALARGGGDDDDEAKENVQTKEADENPGKKKAKRRKLKRSASI-TITGKRKRLGGIGSGDVANEVARRVYEIMEKHKENFFVIRLHPQNSVTSLPPIKDPDPLINSELMECRGAFLEKAREKHLEFSSLRRAKYSTLVMLYELHNENRQPLMYTCNVCSAQLETPWHCKQCIEYDLCPRCYETENHPHPMVKIGIG-----LDDCNKGQEPSNDSAIQESGRDKLSRWVKALGHSCYCRDANCRVYACKTMKYQVQHFRVHSTDRNQCSVCRFIYYLCCYHSKTCHELKCLVPLCPKLKAKMKQQQKQQRLKQTQMLRRRMATMQRCNSMTPNHQPTPPPSQTYQQCSQSSTSDCISSPMSI 1254          
BLAST of CREB-binding protein vs. TrEMBL
Match: A0A419Q0G1 (Histone acetyltransferase OS=Clonorchis sinensis OX=79923 GN=EP300 PE=4 SV=1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 500/1189 (42.05%), Postives = 697/1189 (58.62%), Query Frame = 3
Query:  132 LIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCA-----------PLRPNNNIR-------KSVSNKP---KINGITNYNDQF-------------NNDKEVNWRNTILSI---RPNFLVKLTDELIPVKVCEDVKNHSGYIDVS-----NYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTI--KKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLE-------SSPNAAAKST------PVKLPATQ------------LSTDVKMSPDSTS----TPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMN---SLNNKRKRING---SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTS-EDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQC-CSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNC 3455
            L+++QL  L HA +C RL        C+ +HC++MR V+ H+ KC     C   HC SSK I++H+  C+   C VC            P  P    +        S  +KP    +NGI N +  +             N +   N RN+       R + + K  +  + +       N + Y D       +++K  E +IF K+    +Y   L  ++  ++  L  +R  +    +   N  +N           IK++      A  G   ++ E   +    ELV      TP +E        S          D  + +++ +       S+P+   KS+      P   P T+            LS+DVK S +  S     P ++ +N    W   EL   F+ +   I  +KD+EPF  PV+WE L+I DYP I+  PMDLSTI+ KL N  Y +PW VVDDFWLMFNNAWLYNKKTSKVYK C+ LA+ FE+ ID +M   GFCCGRE+ YLP  L C TP  C I RDAVYY ++ND          L   +Y  CE+CYN++ ++++ +++E++     VQK+L+ KC+N+ KE E FVFC+ C RKWH+VCA H D++W +GF C  C+R+  +K   N Y ++ LP C LS ++E RVN +LK +    ++VI+RVL+S+DK VEVKPGMKS +CET +MPESF YR+KA+FAFQEIDGQEVCFFGLHVQEYGS+CP PN+RRVYLAYLDSV+FF P++YRTDVYHE LVGY+ YAK LG+ +AHIWACPP EGDDYIFHMHP +QK+PKPKRLQEWY KML KA+ E +V+DY+DI  +A  S ++SPTEL YFEGD+WPN LE++FKE+DEE  +R +         E + ++  + ++ N     KK  K++  + N   SL  KRKR+NG   +D  ++V+R+V E+MEK KENFFVIRLH Q+  ++LP I D D L +SDLM+ R   L  AREKHLEFSS+RRAK+STL   YELH E +  ++Y CN CN Q+E  + C+QC +++LCP CY TE HPH + ++    +    NS   S+  + +++ R ++ R  K+L H C CRD NCR+  C  MK  ++HF+   +  ++ C +C+    +C+ H+K C + KC VP C
Sbjct:  116 LMQRQLALLLHAERCRRLENDGLTLTCNIRHCMLMRQVLDHMDKCLHEDGCSVAHCRSSKRILRHFNVCSAWSCDVCTAVKRPLIKADIPSHPGTEYQNGPVCNFASSGSKPDTTTMNGIKNPSPHYEVTPTPCSSSPALNGEIGRNNRNSFPLTDEQRKDAMKKFVNVSLSIF---PAANSTAYNDPRMQQFLDHLKRMEKDIFMKSKTAEEYYAALTARYQSIHSELKEQRRLRGARPLEPSNEESN-----------IKND------AHSGRSSESTEPDRVCDGSELVCKREDATPVEEPRSSPVSSSATSFVKSVPMDTVAAQQVNQDCCEPPTSTPSTEIKSSSIDTTQPATAPITRSPRDGDANSDVALSSDVKPSDEPKSEAGQQPLREASN-RAVWYPNELQRYFLPVVDRISKEKDAEPFLQPVDWESLEIYDYPQIITHPMDLSTIRKKLENREYKDPWSVVDDFWLMFNNAWLYNKKTSKVYKTCTKLAEFFETTIDPVMQQLGFCCGREYYYLPPPLTCLTPKFCTIQRDAVYYVYKNDDQT-----PGLLEQKYTVCERCYNEAGDEIR-LDSESS-TVVTVQKNLMEKCKNDRKEKEPFVFCKKCGRKWHRVCAIHADEVWPEGFVCNRCMRDYGLKRPENRYTARKLPTCRLSNFLEKRVNDFLKKKGTDASDVIIRVLASADKTVEVKPGMKSRFCETGDMPESFPYRVKAIFAFQEIDGQEVCFFGLHVQEYGSECPPPNTRRVYLAYLDSVYFFRPKQYRTDVYHEILVGYIHYAKLLGYAVAHIWACPPSEGDDYIFHMHPTDQKIPKPKRLQEWYQKMLKKALLERIVVDYKDICQEACESGLVSPTELAYFEGDFWPNTLEELFKEMDEEDAKRKREQEALARDDEDDETKENLQTRENEKNPGKKKAKKRKMKRNASLSLPGKRKRLNGGNSADASSEVARRVYEIMEKHKENFFVIRLHPQNSVSSLPAIKDLDPLINSDLMECRGAFLERAREKHLEFSSVRRAKYSTLVMLYELHTENRQPLMYTCNMCNVQLETPWHCRQCVEYDLCPRCYETEKHPHPMVQIGLGLDDGTKNSDVDSEAAAVQESGRDKLSRLVKALGHGCSCRDANCRVFACKTMKSNVQHFRVHAAAARNQCNVCRSLSFLCYYHSKTCQELKCPVPLC 1276          
BLAST of CREB-binding protein vs. TrEMBL
Match: A0A4Z2D8G9 (CREB-binding protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003439 PE=4 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 540/1283 (42.09%), Postives = 737/1283 (57.44%), Query Frame = 3
Query:   60 SSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRP-----------------NNNIRKSVSNKPKINGI-----------TNYNDQFNNDKEVNWRNTILSIRPNFLVKLTD---ELIPVKVCEDVK-------NHSGYIDVS-----NYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTK--------QIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTE--NDIDSK----------RELLESSPNAAAKSTPVK-------LPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRR------LKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRING---SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTT-----RARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQR-----GMHPETPCPTSVPLQ-SQTSITSINTQPPSI 3638
            SS    +  T    Q L    K  L+RQQL  L HA  C RL       +C +++C  +RS++ H+  C   K+C   HC SSK I++H+++C D+EC+VC+ +R                  N       S+   +NGI           T +       +     N  +S  P    ++TD   EL   K   D+        N + Y D       +YVK  E ++F K+ +  +Y   +A  +  ++  L  KR  +E+   L +   ++ T+          E  F+    E D+F         D LE    ++E +  EI          K+A  +   +    E   D D K            +    PN +   T ++        P    S + K  P ++  P +      + W S EL   F+ +   I  +KD+EPF  PV+W+ L+I DYP IV  PMDLSTI+ KL +  Y +PW++VDDFWLM NNAWLYNKKTSKVYK C+ LA+ FES ID +M S GFCCGRE+ Y P  L C TP  C I RDAVYY +   KS+G+     L   +Y  CE+CYN++ + +   +  +N     VQK+L+ KC+N++KE E FVFC+ C RKWH+VCA ++++IW DGF C  CI    +K   N + +K L  C+LS ++E RVN +LK ++    +VI+RVL+++DK VEVK GMK+ +C   EMPESF YR+KA+FAFQEIDGQEVCFFGLHVQEYGS+CP PN+RRVY+AYLDSV+FF P+++RT++YHE LVGY+ YAK LGFTMAHIWACPP EGDDYIFHMHPP+QK+PKPKRLQEWY KML KA+ E +V+DY+DI  DA  S M+SP EL YFEGD+WPN LE+IFKE+DEE  +R      L       + +  E  QT+   +N   K  K+ K ++   + ++  KRKR+ G    D  N+V+R+V E+MEK KENFFVIRLH Q+   +LPPI DPD L +S+LM+ R   L  AREKHLEFSSLRRAK+STL   YELH E +  ++Y CN C+ Q+E  + CKQC +++LCP CY TE HPH + K+        L+  N  Q  S D+      R ++ R+ K+L H+C CRD NCR+  C  MK  ++HF+  S  ++ C +C+    +C  H+K C + KC VP C  L+   KQQ  QQR++Q QMLRRR+A MQR       H  TP P+    Q SQ+S +   + P SI
Sbjct:    3 SSTTDQITYTTDRPQGLSTEAKMILMRQQLALLLHADHCERLERRGMATNCMDRNCGEIRSLLPHLQSCTREKECSVPHCISSKYIMRHYRSCRDMECKVCSAVRKPIVNSTPSSASSVSCSQNGLSSSHKSDLSSLNGIKISDSPLPPLKTPFTAGSCESQSTVVLNGEVSRVPLHASRITDQQRELAMKKFVNDISLSIFPTANPTAYSDPRMKQFLDYVKRMEKDVFIKSKSTEEYFKTMALHYHNIHSELKEKRRLRESCPPLQNGDISDVTQPSDLTNSVSSENKFKTNPYEQDQF--------SDALEIVCKREEQIQREI----------KVAVENSSNSSESAEVLEDKDGKDDSNSPEVKCHSVASIDPNESDTKTGIEKNDLESEAPEASSSDEKKTDPQTSREPIR-----RRIWYSNELLQYFLPVVLKISKEKDAEPFLTPVDWKFLEIYDYPQIVSDPMDLSTIRKKLEDREYKDPWEIVDDFWLMLNNAWLYNKKTSKVYKTCTRLAETFESIIDPVMQSLGFCCGREYYYQPPTLTCLTPKFCTIYRDAVYYVY---KSDGQ--TPGLLEQKYTVCERCYNEAMDQIALDSDSSN--PVNVQKNLMEKCKNDIKEKEPFVFCKHCGRKWHRVCAIYLEEIWPDGFICNHCIVNYGLKRVENRFTAKKLTTCKLSNFLEKRVNDFLKKKEADAGDVIIRVLAAADKTVEVKSGMKARFCGNGEMPESFPYRVKAIFAFQEIDGQEVCFFGLHVQEYGSECPLPNTRRVYVAYLDSVYFFRPKQFRTEIYHELLVGYIHYAKLLGFTMAHIWACPPSEGDDYIFHMHPPDQKIPKPKRLQEWYQKMLKKALIERIVVDYKDICQDANESHMISPAELAYFEGDFWPNTLEEIFKEMDEEDAKRKQEQEALARGGGDDDDEAKENVQTKEADENPGKKKAKRRKLKRSASI-TITGKRKRLGGIGSGDVANEVARRVYEIMEKHKENFFVIRLHPQNSVTSLPPIKDPDPLINSELMECRGAFLEKAREKHLEFSSLRRAKYSTLVMLYELHNENRQPLMYTCNVCSAQLETPWHCKQCIEYDLCPRCYETENHPHPMVKIGIG-----LDDCNKGQEPSNDSAIQESGRDKLSRWVKALGHSCYCRDANCRVYACKTMKYQVQHFRVHSTDRNQCSVCRFIYYLCCYHSKTCHELKCLVPLCPKLKAKMKQQQKQQRLKQTQMLRRRMATMQRCNSMTPNHQPTPPPSQTYQQCSQSSTSDCISSPMSI 1249          
BLAST of CREB-binding protein vs. TrEMBL
Match: A0A074YW50 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12104 PE=4 SV=1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 498/1189 (41.88%), Postives = 700/1189 (58.87%), Query Frame = 3
Query:  132 LIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCA-----------PLRPNNNIRK-------SVSNKP---KINGITNYNDQF-------------NNDKEVNWRNTILSI---RPNFLVKLTDELIPVKVCEDVKNHSGYIDVS-----NYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTI--KKELVANEIPMTPDKEYEQKLAYGSYIK-TESWTENDIDSKR------ELLESSPNAAAKSTPVKLPA------------------TQLSTDVKMS----PDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMN---SLNNKRKRING---SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTS-EDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQC-CSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNC 3455
            L+++QL  L HA +C RL        C+ +HC++MR V+ H+ KC     C   HC SSK I++H+  C+   C VC            P  P    +        S  +KP    +NGI N +  +             N +   N RN+       R + + K  +  + +       N + Y D       +++K  E +IF K+    +Y   L  ++  ++  L  +R  +    +   N  +N           IKSE      A  G   ++ E   +    E+V      TP +E     A  S     +S + + + S++      E   ++P+A  KS+ +                        +S+DVK S     D+   P ++ +N    W   EL   F+ +   I  +KD+EPF  PV+WE L+I DYP I+  PMDLSTI+ KL N  Y +PW VVDDFWLMFNNAWLYNKKTSKVYK C+ LA+ FE+ ID +M   GFCCGRE+ YLP  L C TP  C I RDAVYY ++ND          L   +Y  CE+CYN++ ++++ +++E++     VQK+L+ KC+N+ KE E FVFC+ C RKWH+VCA H D++W +GF C  C+R+  +K   N Y ++ LP C LS ++E RVN +LK +    ++VI+RVL+S+DK VEVKPGMKS +CET +MPESF YR+KA+FAFQEIDGQEVCFFGLHVQEYGS+CP PN+RRVYLAYLDSV+FF P++YRTDVYHE LVGY+ YAK LG+ +AHIWACPP EGDDYIFHMHP +QK+PKPKRLQEWY KML KA+ E +V+DY+DI  +A  S ++SPTEL YFEGD+WPN LE++FKE+DEE  +R +         + + ++  + ++ N     KK  K++  + N   SL+ KRKR+NG   +D  ++V+R+V E+MEK KENFFVIRLH Q+  ++LP I D D L +SDLM+ R   L  AREKHLEFSS+RRAK+STL   YELH E +  ++Y CN CN Q+E  + C+QC +++LCP CY TE HPH + ++    +    +S   S+  + +++ R ++ R  K+L H C CRD NCR+  C  MK  ++HF+   +  ++ C +C+    +C+ H+K C + KC VP C
Sbjct:    5 LMQRQLALLLHAERCRRLENDGLTLTCNIRHCMLMRQVLDHMDKCLHEDGCSVAHCRSSKRILRHFNVCSAWSCDVCTAVKRPLIKADMPSHPGTEYQNGPVCNFVSSGSKPDTTTVNGIKNPSPHYEVTPTPCSSSPALNGEIGRNNRNSFPLTDEQRKDAMKKFVNVSLSIF---PAANSTAYNDPRMQQFLDHLKRMEKDIFMKSKTAEEYYAALTARYQSIHSELKEQRRLRGARPLEPSNEESN-----------IKSE------AHSGRSSESTEPDRVCDGSEVVCKREDATPVEESRSSPASSSATSFVKSVSMDTVASQQVNQDCCEPPTNTPSAEIKSSSIDTTQPATAPTTRSPRDGDVNSDVTMSSDVKPSDELKSDAGQQPLREASN-RAVWYPNELQRYFLPVVDRISKEKDAEPFLQPVDWESLEIYDYPQIITHPMDLSTIRKKLENREYKDPWSVVDDFWLMFNNAWLYNKKTSKVYKTCTKLAEFFETTIDPVMQQLGFCCGREYYYLPPPLTCLTPKFCTIQRDAVYYVYKNDDQT-----PGLLEQKYTVCERCYNEAGDEIR-LDSESS-TVVTVQKNLMEKCKNDRKEKEPFVFCKKCGRKWHRVCAIHADEVWPEGFVCNRCMRDYGLKRPENRYTARKLPTCRLSNFLEKRVNDFLKKKGTDASDVIIRVLASADKTVEVKPGMKSRFCETGDMPESFPYRVKAIFAFQEIDGQEVCFFGLHVQEYGSECPPPNTRRVYLAYLDSVYFFRPKQYRTDVYHEILVGYIHYAKLLGYAVAHIWACPPSEGDDYIFHMHPTDQKIPKPKRLQEWYQKMLKKALLERIVVDYKDICQEACESGLVSPTELAYFEGDFWPNTLEELFKEMDEEDAKRKREQEALARDDDDDETKENLQTRENEKNPGKKKAKKRKMKRNASLSLSGKRKRLNGGNSADASSEVARRVYEIMEKHKENFFVIRLHPQNSVSSLPAIKDLDPLINSDLMECRGAFLERAREKHLEFSSVRRAKYSTLVMLYELHTENRQPLMYTCNVCNVQLETPWHCRQCVEYDLCPRCYETEKHPHPMVQIGLGLDDGTKHSDVDSEAAAVQESGRDKLSRLVKALGHGCSCRDANCRVFACKTMKSNVQHFRVHAAAARNQCNVCRSLSFLCYYHSKTCQELKCPVPLC 1165          
BLAST of CREB-binding protein vs. Ensembl Cavefish
Match: ep300a (histone acetyltransferase p300-like [Source:NCBI gene;Acc:103044365])

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 394/836 (47.13%), Postives = 523/836 (62.56%), Query Frame = 3
Query:  972 DSKRELLESSPNAAAKSTP-VKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCL 3458
            +SK  ++E+S  A     P VK    +       +   + TP+K      K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR+  + PQ L C    +C I RDA Y+++QN           L  DRY  CEKC+N+   +   +  + +     + K    K +N+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  Y+ENRVN Y+K ++ P   EV +RV+  SDKVVEVKPGMK+ + +T EM ESF YR KA+FAF++IDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT VYHE L+GYLEYAKKLGFT  HIWACPP EGDDYIFH HP +Q++PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T       +S++   +K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +  ++  LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRR+++S++C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ESN   + ++  P   D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL
Sbjct: 1016 ESKSTVMETSTAAGEDKKPEVKTEPKEEDAGAGSAGSKSETPSKK-----KIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPK-----YGLLADRYHFCEKCFNEIQGESVSLGDDPSQPQTSITKEQFEKKKNDTLDPELFVECLDCGRKMHQICVLHHETIWPSGFVCNGCLKKANKTRKENKYAAKRLPPTKLGIYLENRVNDYVKRQNHPEAGEVTIRVVHVSDKVVEVKPGMKARFVDTGEMAESFPYRSKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRCMRTTVYHEILIGYLEYAKKLGFTTGHIWACPPSEGDDYIFHCHPTDQRIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENNT-------SSESVDATKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPNSNALPPIIDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSRWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNNQAAASMQSPG--DSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCL 1832          

HSP 2 Score: 83.5741 bits (205), Expect = 2.293e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  336 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 426          
BLAST of CREB-binding protein vs. Ensembl Cavefish
Match: ep300b (E1A binding protein p300 [Source:NCBI gene;Acc:103032522])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 397/837 (47.43%), Postives = 522/837 (62.37%), Query Frame = 3
Query: 1083 TSTPNKDHTNAHKK-WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIP-----------DYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDR-DPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQR 3548
            +STP+   T + KK +  EE+    M  +  L   D +S PF+ PV+ +LL IP           DY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M + G+CCGR+  + PQ L C    +C I RDA Y+++QN           L  +RY  CEKC+N+   +   +  +       + K    K RN+  + E FV C  C RK H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  ++E RVN YLK +  P   EV +RV+  SDK+VEVKPGMKS + ++ EM ESF YR KA+FAF++IDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR+ RT VYHE L+GY+EY KKLGFT  HIWACPP EGDDYIFH HP EQK+PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T +S+  + +  +  +    +       K  L R N     +K+    +  ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRRAK+S++C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K+    +    N    +     D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQMLRRRVA MQR
Sbjct: 1025 SSTPS---TQSKKKIFKPEEVRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPVRIRTSNKTNLDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQTLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPK-----YGLLANRYHFCEKCFNEIQGENVSLGDDPTQPQTSINKDQFQKKRNDTLDPELFVECNDCCRKMHQICVLHNETIWPSGFVCDGCLKKANKTRKENKYAAKRLPQTKLGCFLETRVNDYLKRQAHPESGEVTIRVVHVSDKMVEVKPGMKSRFVDSGEMAESFPYRTKAMFAFEDIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRQLRTGVYHEILIGYIEYVKKLGFTTGHIWACPPSEGDDYIFHCHPLEQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENST-SSESVDATTGDSKNAKKKNNKKTSKNKSSLSRAN-----KKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPIVDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRAKWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMEKLGLGLDDESSNQAAAATQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRVATMQR 1847          

HSP 2 Score: 83.1889 bits (204), Expect = 2.780e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  295 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 385          
BLAST of CREB-binding protein vs. Ensembl Cavefish
Match: crebbpa (CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-050208-439])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 410/913 (44.91%), Postives = 545/913 (59.69%), Query Frame = 3
Query:  867 ELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNA-------HKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYS----ETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQ-RGM 3554
            EL A   P    K+ EQ     S ++ E   E + +SK  L++     A +     +   +  T+VK  P        + T +        K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M   G+CCGR++ + PQ L C    +C I RD  YY++QN               RY  CEKC+N+   D   +  +       + K    + +N+  + E FV C+ C RK H++C  H + IW  GF C  C+++     K N + +K L    L  YIE+RVNKYLK ++ P   EV VRV++SSDK VEVKPGMK+ + +T EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGS+CP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  EL YFEGD+WPN LE+  KE+++E   R K  +    ETP    G++   +  +    +       K  + R N     +K+    +  ND+S+K+   MEK KE FFVI LHS      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R+ C  CEDF+LC +CY T+ H H + K  +  D++S+  + +    P  +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQM+RRR+A MQ RGM
Sbjct:  672 ELTAAAEPKPEPKQEEQDFE-SSTVEPEPKMETEEESKSLLVKKEEPEATEPKQEPMETEEKKTEVKAEPKEEEEGGANSTTSSSPTQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPRDGTYYSYQN---------------RYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPAGFICDNCLKKSVKSRKENKFSAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELSYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNGKKKNNKKTN-----KNKSSVSRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDSSGQSGEASKSP--QESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMMRRRMATMQVRGM 1556          

HSP 2 Score: 82.8037 bits (203), Expect = 3.594e-15
Identity = 46/103 (44.66%), Postives = 60/103 (58.25%), Query Frame = 3
Query:   69 VMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            V  V     +  P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:   69 VGMVGGQGVSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 171          
BLAST of CREB-binding protein vs. Ensembl Cavefish
Match: crebbpa (CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-050208-439])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 410/913 (44.91%), Postives = 545/913 (59.69%), Query Frame = 3
Query:  867 ELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNA-------HKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYS----ETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQ-RGM 3554
            EL A   P    K+ EQ     S ++ E   E + +SK  L++     A +     +   +  T+VK  P        + T +        K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M   G+CCGR++ + PQ L C    +C I RD  YY++QN               RY  CEKC+N+   D   +  +       + K    + +N+  + E FV C+ C RK H++C  H + IW  GF C  C+++     K N + +K L    L  YIE+RVNKYLK ++ P   EV VRV++SSDK VEVKPGMK+ + +T EM ESF YR KA+FAF+EIDG +VCFFG+HVQEYGS+CP PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  EL YFEGD+WPN LE+  KE+++E   R K  +    ETP    G++   +  +    +       K  + R N     +K+    +  ND+S+K+   MEK KE FFVI LHS      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R+ C  CEDF+LC +CY T+ H H + K  +  D++S+  + +    P  +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQM+RRR+A MQ RGM
Sbjct:  651 ELTAAAEPKPEPKQEEQDFE-SSTVEPEPKMETEEESKSLLVKKEEPEATEPKQEPMETEEKKTEVKAEPKEEEEGGANSTTSSSPTQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPRDGTYYSYQN---------------RYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPAGFICDNCLKKSVKSRKENKFSAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELSYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNGKKKNNKKTN-----KNKSSVSRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDSSGQSGEASKSP--QESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMMRRRMATMQVRGM 1535          

HSP 2 Score: 82.4185 bits (202), Expect = 3.969e-15
Identity = 46/103 (44.66%), Postives = 60/103 (58.25%), Query Frame = 3
Query:   69 VMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            V  V     +  P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:   69 VGMVGGQGVSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 171          
BLAST of CREB-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000057848.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:831065:839047:1 gene:ENSAMXG00000012049.2 transcript:ENSAMXT00000057848.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 4.061e-15
Identity = 48/147 (32.65%), Postives = 76/147 (51.70%), Query Frame = 3
Query: 1005 NAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDI 1445
             AA +  P+++  +  +T +  +P    T N  HT  H    + +L  L   + + +   + S PF+ PV+   L +PDY  I+KCPMD+ TIK +L N  Y N  + + DF  MF N ++YNK    +  M   L K+F  KI ++
Sbjct:   10 RAAPRYQPIRMGDSVEATPLSKNPLVPETTN--HT--HPARMTNQLQYLLKVVLKTLWKHQFSWPFQAPVDAVKLRLPDYYKIIKCPMDMGTIKKRLENRYYRNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKMFLQKISEM 152          
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 568.54 bits (1464), Expect = 6.977e-178
Identity = 321/709 (45.28%), Postives = 433/709 (61.07%), Query Frame = 3
Query: 1698 VQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSK----GLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALED-IFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALM-------------QRGMHPETPCPTSVPLQSQTSITSINTQPPSI----------DAPTATILPEKISEPNESDTCKRNNIVMQ 3725
            + K    K +N+  + E FV C+ C RK H++CA H + IW  GF C TC+++     K N + SK    GLP  +L  ++ENRVN +L+ ++ P   EV VRV+  SDK VEVKPGMK+ + +  EM +SF YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT VYHE L+GYLEY KK+G+T  HIWACPP EGDDYIFH HPP+Q++PKPKRLQEWY KMLDKA+ E +V DY+DI   A +  + S  ELPYFEGD+WPN LE+ I +   EE  R+ +  S +  S EG+        K +     KK  K+  K  +S +   K+  G  ++ ND+S+K+   MEK KE FFVIRLH  + A ++PPI DPD L   DLMDGRD  L +AR+KH EFSSLRRAK+ST+C   ELH + ++  +Y CN C   +E RY C  CED++LC +CY T+ H H + K  +  D++SN    QN      +++ R  + R  +SL HACQC + NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQMLRRR+A M                 H   P PT     S +S+ +  T P ++            P + ++P  +S+P  + T   N +  Q
Sbjct:    2 INKDQFEKKKNDTLDPEPFVECKECGRKLHQICALHNETIWPAGFVCDTCLKKTGRTRKENKFCSKSLNAGLPTSKLGTHLENRVNNFLRRQNCPEAGEVTVRVVHVSDKTVEVKPGMKARFVDNGEMADSFPYRAKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPRHLRTAVYHEILIGYLEYVKKIGYTQGHIWACPPSEGDDYIFHCHPPDQRIPKPKRLQEWYKKMLDKAVAERIVHDYKDILKQATDDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREETSASCESTEGK--------KGDSKNAKKKNNKKTSKSKSSSSRTSKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLHPPAAANSVPPIQDPDPLVTCDLMDGRDAFLTMARDKHYEFSSLRRAKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRYHCTVCEDYDLCVACYKTKGHEHKMEKWGLGLDDDSNNQPMQN-----PQESRRLSIQRCIQSLVHACQCLNANCSLPSCLKMKRVVQHTRVCKRKTNGGCPICKQLIALCCFHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMAAMTQVTQQQPPPPPRVTPPHAGLPSPTGT---SGSSVPTTPTGPQAVPQTPPGPTVGQPPQSALVPPGLSQPPNNVTLANNGMARQ 694          
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006336.1 (pep scaffold:Pmarinus_7.0:GL479543:3524:30791:1 gene:ENSPMAG00000005717.1 transcript:ENSPMAT00000006336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.792 bits (447), Expect = 4.678e-45
Identity = 82/160 (51.25%), Postives = 103/160 (64.38%), Query Frame = 3
Query: 1089 TPNKDHTNAHKKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQN 1565
            +P        K +  EEL    M  +  L   D +S PF+ PV+ + L IPDY  IVK PMDLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RDA Y+++QN
Sbjct:  781 SPATPQPRPKKVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQALGIPDYFDIVKTPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDASYFSYQN 940          

HSP 2 Score: 79.337 bits (194), Expect = 5.215e-15
Identity = 44/92 (47.83%), Postives = 58/92 (63.04%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCK-FQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+   HC SS++II HWKNC   +C VC PL+
Sbjct:   69 PAADPEKRKLIQQQLVLLLHAHKCQRREQGNGEVRPCNLPHCRTMKNVLNHMTHCQAGKSCQAVAHCASSRQIISHWKNCTRPDCPVCLPLK 160          
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006283.1 (pep scaffold:Pmarinus_7.0:GL487345:511:5582:1 gene:ENSPMAG00000005678.1 transcript:ENSPMAT00000006283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 1.104e-14
Identity = 43/122 (35.25%), Postives = 68/122 (55.74%), Query Frame = 3
Query: 1095 NKDHTNAHKKWSSEELSDLFMEIHQL---ILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNK-KTSKVYKMCSTLAKLFESKIDDIM 1448
             K  T  +++ S+  ++    +  QL   IL  +DSEPF+ PV+   +  PDY +I+  PMDL T++++L    Y++P D   D  L+F+NA  Y   K S++Y M   L+ LFE  I  I+
Sbjct:  128 QKRRTQRYRRESAYNIAAWKQQCRQLVSVILEREDSEPFRQPVD--PIAYPDYRTIIPTPMDLGTVRERLREDTYHDPVDFCKDVRLIFSNAKAYTPNKKSRIYGMTLRLSALFEEHIRGIV 247          
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002730.1 (pep scaffold:Pmarinus_7.0:GL482934:3:7765:-1 gene:ENSPMAG00000002495.1 transcript:ENSPMAT00000002730.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 5.438e-13
Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 1197 PFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKI 1436
            PF +PV+   L +PDY  I+K PMD+ TI+ +L N  Y +  + + DF  MF N +LYNK T  +  M  TL +LF  K+
Sbjct:   85 PFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDIVLMAQTLERLFLQKV 164          

HSP 2 Score: 60.8474 bits (146), Expect = 1.485e-9
Identity = 48/150 (32.00%), Postives = 70/150 (46.67%), Query Frame = 3
Query: 1011 AAKSTPVKLPATQLSTDVKMSPDSTSTPN--KDHTNAHKKWSSEELS-------DLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESK 1433
            AA S   K+PA + S    + P     P+  + H  + K   SE+L        +LF + H        + PF  PV+   L + DY  I+K PMDLSTIK+K+ N  Y +  +   D  +MF+N + YN     V  M   L  +FE +
Sbjct:  289 AADSKAAKIPARRESGR-PIKPPRKDLPDSQQQHQTSKKVKLSEQLKHCNGILKELFAKKHAAY-----AWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMARKLQDVFEMR 432          
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002732.1 (pep scaffold:Pmarinus_7.0:GL482934:3:7597:-1 gene:ENSPMAG00000002495.1 transcript:ENSPMAT00000002732.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.393e-12
Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query: 1197 PFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKI 1436
            PF +PV+   L +PDY  I+K PMD+ TI+ +L N  Y +  + + DF  MF N +LYNK T  +  M  TL +LF  K+
Sbjct:   54 PFNVPVDANALHLPDYHKIIKQPMDMGTIRRRLENNYYWSGGECIQDFNTMFTNCYLYNKPTDDIVLMAQTLERLFLQKV 133          

HSP 2 Score: 56.9954 bits (136), Expect = 2.481e-8
Identity = 47/151 (31.13%), Postives = 66/151 (43.71%), Query Frame = 3
Query: 1002 PNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELS-------DLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESK 1433
            P       P+K P   L       PDS     + H  + K   SE+L        +LF + H        + PF  PV+   L + DY  I+K PMDLSTIK+K+ N  Y +  +   D  +MF+N + YN     V  M   L  +FE +
Sbjct:  280 PARRESGRPIKPPRKDL-------PDS----QQQHQTSKKVKLSEQLKHCNGILKELFAKKHAAY-----AWPFYKPVDASTLGLHDYHDIIKHPMDLSTIKNKMDNRDYRDAQEFAADVRVMFSNCYKYNPPDHDVVSMARKLQDVFEMR 414          
BLAST of CREB-binding protein vs. Ensembl Yeast
Match: BDF1 (Protein involved in transcription initiation; functions at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p; BDF1 has a paralog, BDF2, that arose from the whole genome duplication [Source:SGD;Acc:S000004391])

HSP 1 Score: 65.855 bits (159), Expect = 4.765e-11
Identity = 34/81 (41.98%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1185 KDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFE 1427
            KD+ PF  PV+   LDIP Y + +K PMDLSTI+ KL  G Y  P  + +DF LM NN+  +N   + + +M   +   FE
Sbjct:  168 KDARPFLQPVDPVKLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMARNIQASFE 248          
BLAST of CREB-binding protein vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 62.7734 bits (151), Expect = 2.245e-10
Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 3
Query: 1197 PFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDI 1445
            PF  PVN E  ++PDY   +K PMDLST++ KL +  Y    D + D  L+FNN  +YN + +  YK  + L K F +K+ +I
Sbjct:  351 PFLQPVNKE--EVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEI 431          
BLAST of CREB-binding protein vs. Ensembl Yeast
Match: BDF2 (Protein involved in transcription initiation; acts at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p; protein abundance increases in response to DNA replication stress; BDF2 has a paralog, BDF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002228])

HSP 1 Score: 59.6918 bits (143), Expect = 3.407e-9
Identity = 34/93 (36.56%), Postives = 57/93 (61.29%), Query Frame = 3
Query: 1155 MEIHQLILSDKDSE---PFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLF 1424
            ++I ++++S K+S+   PF  PV+   L++P+Y  +VK PMDL TI + L+N  Y      VDD  L+F N + +N + ++V+ M   L +LF
Sbjct:  327 LKILKVLMSKKNSDINFPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLKELF 419          

HSP 2 Score: 58.9214 bits (141), Expect = 5.131e-9
Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 3
Query: 1185 KDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKI 1436
            KD+ PF  PV+   L+IP Y + V+ PMDLS I+ KL   +Y++   V  DF  M +N   +N   S +  M   + K FE K+
Sbjct:  153 KDARPFLKPVDPIALNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSISSMAKRIQKYFEKKL 236          
BLAST of CREB-binding protein vs. Ensembl Yeast
Match: RSC4 (Component of the RSC chromatin remodeling complex; found in close proximity to nucleosomal DNA; displaced from the surface of nucleosomal DNA after chromatin remodeling; acetylated (K25) by Gcn5p, altering replication stress tolerance; contains tandem bromodomains that recognize histone H3 acetylated on K14 (H3K14ac) by Gcn5p [Source:SGD;Acc:S000001716])

HSP 1 Score: 54.6842 bits (130), Expect = 1.093e-7
Identity = 32/83 (38.55%), Postives = 46/83 (55.42%), Query Frame = 3
Query: 1185 KDSEPFKLPVNWELLD---IPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLF 1424
            K SEPF      EL+D   +P+Y  IV  PM LS +K  L  G Y+  +D + D  L+F NA ++N  ++ +YK  +TL   F
Sbjct:  208 KLSEPF-----MELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYF 285          
BLAST of CREB-binding protein vs. Ensembl Nematostella
Match: EDO40753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S640])

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 353/782 (45.14%), Postives = 487/782 (62.28%), Query Frame = 3
Query: 1134 EELSDLFM-EIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNS-QEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRING-SDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSL----FKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKS-TCKMCQLFLRICFVHAKFCSDSKCQVPNC 3455
            EEL    M  + +L   + +S PF+ PV+ +LL   DY  IV+ PMDLSTIK KL NG Y NPW+  DD WLMF+NAWLYN+KTS+VYK C+ L+++FES+ID +M   G+CCGR++V+ PQVL C    +C I RD  YY +QN +               +   KC+N+   D+  +  +       + K    K +N+  + E FV C  C RK H++C  H D IW  G+ C  C+ ++ +K K N Y ++ L H  L   IE RVN +L+ +     EV +RV+SS  K  E+KPGMK+ Y  + ++PE F Y+ KA+FAF+EIDG +VCFFG+HVQEYGSDC  PN+RRVY++YLDSVHFF PR+ RT VYHE L+GYLE+  ++GF MAHIWACPP EGDDYIFH HPPEQK+PK KRL +WY KMLDKAI + VVI+Y+DI   A +  + +P ELPYF+GD+WPNALED  +E+D+E   R  + +    S +EG    ++V   +  S   K  K +   R  S     K+ING S  + D+S+++   MEK +E FFVIRL+ +      P  +DPD +   DLMDGRD  L LAR+KH EFSS RRA+FST+    ELH +  +  +Y CN C + +E RY C +CED++LC  CY  + H H +    F +D +++S         +  +++  R ++ R  +SL HA  CRD+NC +  CAKMK +++H + C    S  C++CQ  + +C  HAK C + +C VP C
Sbjct:  668 EELRLALMPTLEKLYKQEPESLPFRSPVDPKLLGCLDYFEIVRNPMDLSTIKRKLDNGQYKNPWEYCDDVWLMFDNAWLYNRKTSRVYKYCTKLSEVFESEIDPVMKLLGYCCGRKYVFHPQVLCCFGKQLCTITRDTAYYTYQNRQE-------------IVTFPKCFNEIQGDMVNLGEDPTLQQSLIPKDQFVKLKNDHLDVEPFVECIDCGRKVHQICVLHHDLIWPTGYQCDACLNKRGVKKKENKYTARRLQHTRLGEKIETRVNTFLQKQG-CPAEVTIRVVSSVQKQAEIKPGMKTRYEGSGQLPEYFPYQAKALFAFEEIDGTDVCFFGMHVQEYGSDCQQPNTRRVYVSYLDSVHFFQPRQLRTAVYHEILIGYLEHVGQIGFQMAHIWACPPSEGDDYIFHCHPPEQKIPKHKRLVDWYKKMLDKAIMDKVVIEYKDILKQASDDGLTNPKELPYFDGDFWPNALEDSIRELDQEEEERKANAAAAEASGKEG----SKVKGNSKRSNSKKGTKSKAGSRKLS-----KKINGPSMELCDLSQRLYSTMEKHREVFFVIRLNGR----KTPDTSDPDPMMTCDLMDGRDAFLTLARDKHYEFSSNRRAQFSTMAMLVELHNQGNDRFVYTCNLCKRPVETRYHCNECEDYDLCVPCYDEKGHEHKMERLGFDLDVEQQSQPSKDGQPQKMNAQEERRLKIQRCIQSLVHATHCRDINCTMLSCAKMKRVVEHTKSCRKKTSGGCRICQELIHLCCYHAKHCMERECVVPFC 1422          

HSP 2 Score: 80.4925 bits (197), Expect = 4.952e-15
Identity = 46/105 (43.81%), Postives = 62/105 (59.05%), Query Frame = 3
Query:  111 VDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGD---CHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPK 416
             D +KR LI+QQL  L HA KC R       G+   C+  HC  M++V+ H+T C +GK C+  HC SS++II HWKNC   +C VC PL+  ++ R S    PK
Sbjct:    1 ADPEKRRLIQQQLVLLLHAHKCQRREQQAANGEMKSCNLPHCRTMKNVLNHMTTCTAGKTCQVAHCASSRQIISHWKNCMRQDCPVCLPLKHASDRRISQGRAPK 105          
BLAST of CREB-binding protein vs. Ensembl Nematostella
Match: EDO31845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWS2])

HSP 1 Score: 74.7146 bits (182), Expect = 1.288e-13
Identity = 41/108 (37.96%), Postives = 61/108 (56.48%), Query Frame = 3
Query: 1113 AHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKI 1436
            A K  ++ +L  L   + + +     + PF+ PV+   L++PDY +I+K PMDL TIK KL N  Y    + ++DF LM NN + YNK    +  MC ++ KLF  KI
Sbjct:   10 APKTRTTNQLQFLLKTVLKGLWRHHHAWPFREPVDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFRLMINNCYTYNKPGDDIVLMCQSMDKLFHQKI 117          

HSP 2 Score: 71.633 bits (174), Expect = 1.206e-12
Identity = 51/145 (35.17%), Postives = 70/145 (48.28%), Query Frame = 3
Query: 1020 STPVKLPATQLSTDVKMSPD-------STSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESK 1433
            S P K+PA + ST     P+       S S   K       K+ S  L D+F + H        + PF  PV+ E L + DY  I+K PMD++ IK+KL N  Y++P +   D  LMF+N + YN     V KM   L  +FE K
Sbjct:  247 SKPAKVPARRESTRTVKKPNRDLPEGPSLSRGKKKPLTEQLKYCSTILKDMFSKKHYAY-----AWPFYKPVDAEALGLHDYHDIIKQPMDMTEIKNKLENRAYDSPSEFAADIRLMFSNCYRYNPPDHDVVKMARQLQDVFEMK 386          
BLAST of CREB-binding protein vs. Ensembl Nematostella
Match: EDO38859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV1])

HSP 1 Score: 75.485 bits (184), Expect = 1.798e-13
Identity = 39/94 (41.49%), Postives = 57/94 (60.64%), Query Frame = 3
Query: 1170 LILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKT-SKVYKMCSTLAKLFESKIDDIM 1448
             ++S +D+EPF  PVN  L D PDY   V+ PMD ST+  K V   Y++P  +V D  L+F+N+  YN +  S++Y M   LA +FE ++D I 
Sbjct: 1301 FLMSREDAEPFLAPVN--LADFPDYTDYVEQPMDFSTVWRKFVENQYSDPEQLVSDIRLVFSNSRAYNTQPRSRIYSMTIRLAAMFEDRVDSIF 1392          
BLAST of CREB-binding protein vs. Ensembl Nematostella
Match: EDO44814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU7])

HSP 1 Score: 56.9954 bits (136), Expect = 2.718e-8
Identity = 39/132 (29.55%), Postives = 68/132 (51.52%), Query Frame = 3
Query: 1059 DVKMSPDSTSTPNKDHTNAH---KKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDI 1445
            D +MS D       +    H   +K  S++++     + ++   D D+ PF +PVN +    P+Y  I++ PMD  T+K KL +  Y++P +   D  L+F N   +N+  S+V +    L+K FES+  D+
Sbjct:  185 DFEMSQDGEDEEGDNQETRHHINRKQQSKDMAPCRTILAEMEKHD-DAWPFLIPVNAK--QFPEYYKIIRKPMDFHTMKIKLRDYQYSSPQEFAQDSRLVFANCEEFNEDDSEVGQAGKRLSKFFESRWSDL 313          
BLAST of CREB-binding protein vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.169e-7
Identity = 30/88 (34.09%), Postives = 47/88 (53.41%), Query Frame = 3
Query: 1173 ILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKI 1436
            + S K + PF  PV+   LD+P Y  ++K PMDLST++DK+ +  Y      V D   +F+N   +N K +  Y+    L  +F  K+
Sbjct:   63 LQSHKMAWPFLEPVSG--LDVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDTPYYRCAEVLEAVFVQKL 148          
BLAST of CREB-binding protein vs. Ensembl Medaka
Match: ep300b (histone acetyltransferase p300 [Source:NCBI gene;Acc:101168870])

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 402/857 (46.91%), Postives = 539/857 (62.89%), Query Frame = 3
Query: 1077 DSTSTPNKDHTNAHKK--WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDP-TINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPETPCPTS--VPLQSQTSITSINT 3623
             ST+T +   T   KK  +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  ++D WLMFNNAWLYN+KTS+VYK CS LA++FE++ID +M   G+CCGR+F + PQ L C    +C I RDA Y+++QN           L  DRY  CEKC+N+   +   +  + +     + K    + +N+  + E  V C  C RK H++C  H + IW  GF C  C++  +   K N Y +K LP  +L  ++E RVN YLK ++     EV +RV+  SDKVVEVKPGMKS + ++ EM ESF YR+KA+FAF++IDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT VYHE L+GYLEY K+ GFT  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T       +S++  +S+ +     KK  K+  K  +SL+   K+  G  ++ ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRR+K+S++C   ELH + ++  +Y CN C + +E R+ C  CED++LC +CY  + H H + K+    + +  N    +     D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQMLRRR+A MQR   P    P    V L S  ++T+ NT
Sbjct: 1018 GSTTTNSSPATAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRKFEFSPQTLCCYGKQLCTIQRDAAYFSYQNSSPK-----YGLLADRYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELLVECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRMKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEYVKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENST-------SSESTDVSRGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQDRFVYTCNECKRHVETRFHCTVCEDYDLCITCYNIKGHEHKMDKLGLGLDDDGNNQAAAAAQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQHLQHRLQQAQMLRRRMATMQRAGQPAGAMPGGPVVGLPSPGNVTAPNT 1862          

HSP 2 Score: 83.1889 bits (204), Expect = 2.794e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  311 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 401          
BLAST of CREB-binding protein vs. Ensembl Medaka
Match: ep300a (histone acetyltransferase p300 [Source:NCBI gene;Acc:101160197])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 426/931 (45.76%), Postives = 563/931 (60.47%), Query Frame = 3
Query:  939 IKTESWTENDIDSKRELLESSPNAAAKSTPVKL----PATQLSTDVKMSPDSTSTPNKDHTNAHKK-WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHP-----------ETPCPTSVPLQSQTSITSINTQPPSIDAPTATILP 3665
            IK+E   E   D   E  + +P  A+ ++ VK+    PA ++    +       TP    T A KK +  EEL    M  +  L   D +S PF++PV+ +LL IPDY  IVK PMDLSTIK KL  G Y +PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FE +ID +M S  +CCGR+  + PQ L C    +C I RD VY+++QN               RY  CEKC+N+   D   +  +       + K    K +N+  + E FV C  C R+ H++C  H + IW  GF C  C+++ +   K N Y +K LP  +L  Y+E RVN +LK +  P   EV +RV+  SDKVVEVKPGMKS + ++ EM ESF YR KA+FAF++IDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT VYHE L+GYLEY KKLG+T  HIWACPP EGDDYIFH HP +QK+PKPKRLQEWY KMLDKA+ E +V DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T N    +T       K +     KK  K+  K  +SL+   K+  G   + ND+S+K+   MEK KE FFVIRL +   A +LPPI+DPD L   DLMDGRD  L LAR+KHLEFSSLRRAK+S++C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D+ES+   +     P  E + R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQMLRRR+A MQR   P            +P  ++ P     + TS  TQPP+   P    +P
Sbjct: 1047 IKSEFKKE---DCSGEGGKGAPPDASATSAVKMEDRKPAVKVEVKEEEESSDGVTP---QTPAKKKIFKPEELRQSLMPTLESLYRQDPESLPFRMPVDPQLLCIPDYFDIVKNPMDLSTIKRKLDTGQYQDPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLSYCCGRKLEFSPQTLCCYGKQLCTIPRDGVYFSYQN---------------RYHFCEKCFNEIQGDSVSLGDDPTQPQASINKDQFEKKKNDTLDPELFVECLDCGRRMHQICVLHNETIWPSGFVCDACLKKSNKSRKENKYSAKRLPQTKLGCYLETRVNDFLKRQSHPESGEVFIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEDIDGADVCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPRSLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPMDQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESIDDT-------KGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAAPMANSLPPISDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRAKWSSMCMLVELHNQSQDRFVYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMEKLGLGLDDESSSQAAAATQSP--EYSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRVGQPPPGAVPGGNGLPSPGGSNGPPTGPATPTSAGTQPPTPQTPGQNNMP 1947          

HSP 2 Score: 80.4925 bits (197), Expect = 1.683e-14
Identity = 43/88 (48.86%), Postives = 57/88 (64.77%), Query Frame = 3
Query:  114 DSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  372 DPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 459          
BLAST of CREB-binding protein vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 417/901 (46.28%), Postives = 556/901 (61.71%), Query Frame = 3
Query:  960 ENDIDSKRELLE-SSPNAA-AKSTPVKL-PATQLSTDVKMSPDSTSTPNKDHTNA---HKK-WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQ-RGMHPETPCPTSVPLQSQTSITSINT 3623
            E D ++K  +++   P+AA  K  P++  PA  + T+VK  P        + T+    HKK +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  V+D WLMFNNAWLYN+KTS+VYK C+ LA++FE +ID +M S G+CCGR++ + PQ L C    +C I RD  YY++QN           L  DRY  CEKC+N+   +   +  +       + K    K +N+  + E FV C+ C RK H++C  H + IW  GF C  C+++     K N + ++ L    L  YIE+RVNKYLK ++ P   EV VRV++SSDK V+VKPGMKS + ++ EM E+F YR KA+FAF+EIDG +VCFFG+HVQEYGSDCP PN+RRVY++YLDSVHFF PR  RT VYHE L+GYLEY KKLG+ M HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  + T +S+  E +Q +  +    +       K  L R N     +K+    +  ND+S+K+   MEK KE FFVI LH+      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R+ C  CED++LC +CY T+ H H + K  +  D++SN    +    P  ++  R  + R  +SL HACQCR+ NC ++ C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++    QQ  Q R+ QAQM+RRR+A M  RGM   +P PTS  L +  S+   NT
Sbjct:  967 EQDDETKPSVVKKEEPDAAKPKQEPMEAEPA--IKTEVKTEPKEEEEGGANSTSTSQNHKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVEDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEVEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTISRDGTYYSYQNSSPK-----YGLIADRYHFCEKCFNEIQGNSVTLGDDPAQPQTVISKEQFEKKKNDTLDPEPFVECKDCERKMHQICVLHYEVIWPSGFICDNCLKKSGKTKKENKFSARRLQTTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKSVDVKPGMKSRFVDSGEMMENFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSVHFFKPRLLRTAVYHEILIGYLEYVKKLGYVMGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEEN-TASSETTEGAQADSKNAKKKNNKKTNKNKSSLSRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIMDPDPLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYKTKGHEHQMVKWGLGLDDDSNGQGGEASKSP--QENRRLSIQRCIQSLVHACQCRNANCSLSSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKQKLHQQQLQHRLHQAQMMRRRMATMAGRGMPMPSP-PTSTALDTPNSLQQPNT 1851          

HSP 2 Score: 82.8037 bits (203), Expect = 3.716e-15
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  304 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRSCALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 394          
BLAST of CREB-binding protein vs. Ensembl Medaka
Match: ep300b (histone acetyltransferase p300 [Source:NCBI gene;Acc:101168870])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 401/857 (46.79%), Postives = 536/857 (62.54%), Query Frame = 3
Query: 1077 DSTSTPNKDHTNAHKK--WSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDP-TINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTI-NDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPETPCPTS--VPLQSQTSITSINT 3623
             ST+T +   T   KK  +  EEL    M  +  L   D +S PF+ PV+ +LL IPDY  IVK PMDLSTIK KL  G Y  PW  ++D WLMFNNAWLYN+KTS+VYK CS LA++FE++ID +M   G+CCGR+F + PQ L C    +C I RDA Y+++QN               RY  CEKC+N+   +   +  + +     + K    + +N+  + E  V C  C RK H++C  H + IW  GF C  C++  +   K N Y +K LP  +L  ++E RVN YLK ++     EV +RV+  SDKVVEVKPGMKS + ++ EM ESF YR+KA+FAF++IDG +VCFFG+HVQEYGSDCP PN RRVY++YLDSVHFF PR  RT VYHE L+GYLEY K+ GFT  HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA+ E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R +  + T       +S++   SK +     KK  K+  K  +SL+   K+  G  ++ ND+S+K+   MEK KE FFVIRL +   A +LPPI DPD L   DLMDGRD  L LAR+KHLEFSSLRR+K+S++C   ELH + ++  +Y CN C + +E R+ C  CED++LC +CY  + H H + K+    + +  N    +     D+ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +QQ  Q R+QQAQMLRRR+A MQR   P    P    V L S  ++T+ NT
Sbjct: 1086 GSTTTNSSPATAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRKFEFSPQTLCCYGKQLCTIQRDAAYFSYQN---------------RYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELLVECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRMKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEYVKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENST-------SSESTDPSKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQDRFVYTCNECKRHVETRFHCTVCEDYDLCITCYNIKGHEHKMDKLGLGLDDDGNNQAAAAAQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQHLQHRLQQAQMLRRRMATMQRAGQPAGAMPGGPVVGLPSPGNVTAPNT 1920          

HSP 2 Score: 83.1889 bits (204), Expect = 2.779e-15
Identity = 44/91 (48.35%), Postives = 58/91 (63.74%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C+  HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  335 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 425          
BLAST of CREB-binding protein vs. Ensembl Medaka
Match: crebbpa (CREB-binding protein [Source:NCBI gene;Acc:101163392])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 374/792 (47.22%), Postives = 495/792 (62.50%), Query Frame = 3
Query: 1119 KKWSSEELSDLFME-IHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRD-PTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFK--VDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWK 3479
            K +  EEL    M  +  L   D +S PF+ PV+  LL IPDY  IVK P+DLSTIK KL  G Y  PW  VDD WLMFNNAWLYN+KTS+VYK CS LA++FES+ID +M S G+CCGR++ + PQ L C    +C I     YY++QN               RY  CEKC+ND   D   +  +       + K    + +N+V + E FV C+ C RK H++C  H + IW  GF C  C+++     K N + +K L    L  +IE+RVNKYLK ++ P   EV VRV++SSDK VEVKPGMK+ + +T EMPE+F YR KA+FAF+EIDG +VCFFG+HVQEYGS+C  PN+RRVY++YLDS+HFF PR  RT VYHE L+GYLEY KKLG+   HIWACPP EGDDYIFH HPP+QK+PKPKRLQEWY KMLDKA  E ++ DY+DIF  A    + S  ELPYFEGD+WPN LE+  KE+++E   R K  + T  S+  E + ++  +    +       K  + R N     +K+    +  ND+S+K+   MEK KE FFVI LHS      LPPI DPD L   DLMDGRD  L LAR+KH EFSSLRR K+ST+C   ELH + ++  +Y CN C   +E R+ C  CEDF+LC +CY T+ H H + K  +  D+++N  + +    P  +++ R  + R  +SL HACQCR+ NC +  C KMK +++H + C       C +C+  + +C  HAK C ++KC VP CL ++   +
Sbjct: 1044 KIFKPEELRQTLMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQN---------------RYHFCEKCFNDIQGDSVTLGDDPAQPQTMISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICENCLKKSGKTKKENKFTAKRLQSTRLGMHIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMPETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECSFPNNRRVYISYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEEN-TAASEMPEGTPSDSKNAKKKNNKKTNKNKSSISRAN-----KKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPDPLISCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDNNGQSGEASKSP--QESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLR 1812          

HSP 2 Score: 82.4185 bits (202), Expect = 4.506e-15
Identity = 44/91 (48.35%), Postives = 57/91 (62.64%), Query Frame = 3
Query:  105 PLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGK-GDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLR 374
            P  D +KR LI+QQL  L HA KC R     G+   C   HC  M++V+ H+T CQ+GK C+  HC SS++II HWKNC   +C VC PL+
Sbjct:  346 PTADPEKRKLIQQQLVLLLHAHKCQRREQANGEMRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLK 436          
BLAST of CREB-binding protein vs. Planmine SMEST
Match: SMESG000066809.1 (SMESG000066809.1)

HSP 1 Score: 2654.4 bits (6879), Expect = 0.000e+0
Identity = 1322/1325 (99.77%), Postives = 1323/1325 (99.85%), Query Frame = 3
Query:   51 MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPETPCPTSVPLQSQTSITSINTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSXXXXXXXXXXXXXXXXMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM 4025
            MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTEN+IDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLF EIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKQQGSQQRMQQAQMLRRRVALMQRGMHPETPCPTSVPLQSQTSIT INTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSANANAVYNNNNNVNYAMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM
Sbjct:    1 MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENEIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFTEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKQQGSQQRMQQAQMLRRRVALMQRGMHPETPCPTSVPLQSQTSITPINTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSANANAVYNNNNNVNYAMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM 1325          
BLAST of CREB-binding protein vs. Planmine SMEST
Match: SMESG000066809.1 (SMESG000066809.1)

HSP 1 Score: 1513.43 bits (3917), Expect = 0.000e+0
Identity = 777/779 (99.74%), Postives = 777/779 (99.74%), Query Frame = 3
Query: 1689 ACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKXXXXXXXXXXXXXXXXXVALMQRGMHPETPCPTSVPLQSQTSITSINTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSXXXXXXXXXXXXXXXXMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM 4025
             CKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKQQGSQQRMQQAQMLRRRVALMQRGMHPETPCPTSVPLQSQTSIT INTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSANANAVYNNNNNVNYAMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM
Sbjct:   23 VCKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKQQGSQQRMQQAQMLRRRVALMQRGMHPETPCPTSVPLQSQTSITPINTQPPSIDAPTATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSANANAVYNNNNNVNYAMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTWLNNNPKYRLAFDMLCKRSKRQNDGM 801          
BLAST of CREB-binding protein vs. Planmine SMEST
Match: SMESG000066809.1 (SMESG000066809.1)

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 545/547 (99.63%), Postives = 546/547 (99.82%), Query Frame = 3
Query:   51 MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAA 1691
            MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTEN+IDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLF EIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAA
Sbjct:    1 MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTGKGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENEIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFTEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAA 547          
BLAST of CREB-binding protein vs. Planmine SMEST
Match: SMESG000018938.1 (SMESG000018938.1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 477/1155 (41.30%), Postives = 702/1155 (60.78%), Query Frame = 3
Query:   48 KMTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRL-AYTTGKG-DCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVK-LTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQL--STDVKMSP--DSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKRINGS-DTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPD-ALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSL----FKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCS-IPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRF 3470
            ++ +S   M   N    K    D +KR LI+QQL  L HA +C R  +   G+   C+  HC  MR+V+ H++ C  GK+C   HC SS++II HWKNC++  C VC PL+ N+N  + +   P  +   N           +WR  +   + N L++ +   + P +    +K+     ++  Y +  E E++  A +  +Y + LAEK   +++ L  KR  K+  S  A  + N    QIE                    +++N EF    +    +++ +     +EQ L    Y   +S ++  I  K+EL+       A     K P T+L  S +    P  D+ +  ++   +  K+W+++EL   F+ +   I ++K++E F+  V++  L IPDYP ++K PMD+++I+ KL  G Y +PWDVVDDFWLMF NAWLYNKKTS+VYK CS LA++FESKI+++M   G+CCG  + Y PQVL C + + C I +DA+Y+ ++N   +G+  I  L  ++Y+ CEKCYN++   ++ +N +    +  V K +  + RNNVK  E+FV C +C RKWH VCA ++++IW  G+ C +C+++ + + KPN + ++ LP   LS Y+E RVN +LK ++   NEV++R+L+SSDK VEVKP M+  Y ET EM ESF YRLKA++AFQEIDG EVCFFGL+VQEYGSDCP PN+RRVY+AYLDSV++F PR+YRTDVYHE L+GYL +AKK  F+MAHIW+CPPGEGDDYIFHMHPP+QK+PK KRL EWY+ ML KA+ E +V DY+DI  D++ +++LSP E+PYF+GD+WPN LEDI KE +EE  +R    +      E  T  T  +  +   K   K +K K       N ++K +NG  D   ++ RKV ++MEK K   FVIRL    +A  LP   DPD A+ +SDLM+ RD  L L REK+LEFSSLRR K+ST+   YE+H E++++ +Y C+ C +Q+E RY C +CE++++C  C  T+ HPH L    F +D DE+ N        +  +  + R  +    K+L HACQCRD NCRIN C +MK +++H + C+   + TC+ C+  + +CF HAK C +SKC +P C  +++
Sbjct:  144 RLHNSQTQMQSINCFSEKSNSTDPEKRKLIQQQLLLLLHAHRCQRQESEVNGQSTSCNTPHCKTMRTVLSHMSNCSQGKNCSTPHCASSRQIISHWKNCSNPRCPVCEPLKQNHNRPRGIIPPPAQDFDPN-----------DWRRNVSKDQRNHLIRRIVQTIFPSRDPSAIKD-PRMSNLIEYARRTENEMYNMAKDREEYFHLLAEKCFKIHKELEQKR--KDRLSTGAGKLPNG--SQIEL----------AGVSTIHTCIENNDEFQKKPESTHNSDVQV----RFEQVLR-DKYTNNQS-SQPSIPVKKELV-------AAEIDQKPPETELIKSENTTEEPIIDNVTVKHEQEVSTIKQWTTDELKTNFLPMWNEIYNEKNAEWFREKVDYVALQIPDYPLVIKHPMDMTSIRMKLEAGKYKDPWDVVDDFWLMFKNAWLYNKKTSRVYKACSKLAEVFESKINNLMKKLGYCCGMHYSYEPQVLFCNSVHACTIPKDAIYFEYEN---SGKSQI--LAGEKYLICEKCYNEADLTIK-LNDDPQQDSEIVDKDMFRQLRNNVKVEEKFVNCILCMRKWHCVCALYMEEIWSSGYLCPSCLQKTNQRRKPNKFTARKLPTSCLSNYLERRVNDFLKKKEANANEVVIRILASSDKTVEVKPLMRGRYAETNEMSESFPYRLKAIYAFQEIDGVEVCFFGLYVQEYGSDCPQPNTRRVYIAYLDSVYYFQPRQYRTDVYHEILLGYLMFAKKNHFSMAHIWSCPPGEGDDYIFHMHPPDQKIPKEKRLIEWYVNMLRKALIELIVADYKDILKDSIENNLLSPAEIPYFDGDFWPNTLEDILKEYEEEVEKRRMEENSIGGDDEITTDYT-TVDYDKRGKKKAKKRKEKRGNCTIPNKRKKMVNGGFDGGTELCRKVYDVMEKVKHLLFVIRLIPSQEAHLLPDTKDPDGAVINSDLMESRDAFLQLCREKNLEFSSLRRGKYSTMVMLYEIHNERRHNFMYNCSECGEQMETRYHCNECEEYDICVKCKETKQHPHKLHMIGFCLDEDEKDN--------EQEAVKSKRVGIDNCIKALLHACQCRDANCRINNCLRMKRIVQHTKTCNKKAQGTCETCKQLIALCFYHAKICKESKCHIPFCHSIKY 1244          
BLAST of CREB-binding protein vs. Planmine SMEST
Match: SMESG000060474.1 (SMESG000060474.1)

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 462/1132 (40.81%), Postives = 663/1132 (58.57%), Query Frame = 3
Query:  210 CHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVECQVCAPL--RPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRPNFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYLYKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEFDKFFIAFKGNMKDNLE--FGTIKK---ELVANEIPMTP---DKEYEQKLAYGSYIKTESWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNKDHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVYYAFQN--DKSNGEKIISELTCDRYICCEKCYNDSCED-VQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEI-DGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSXXXXXXXXXXXXRMNSLNNKRKR---INGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPI---NDPDAL-FHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYACNACNKQIE-VRYTCKQCEDFELCPSCYTTETHPHSLFKV-----DPDEE-----------------SNILNSQNLSQPTSEDTT-RARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKH-FQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLR 3467
            C++ +C    S++ HI  C   +DC  + C S+   +KH+ NC   +C VC     +  NNI           G+ +       ++ + WR  I   RP+ L ++++EL         K+ +        +  F+   F+ +  I  YL   A+             N   N+    H    NP    + + + I             N KDN++  F  +K+   +++ N + + P     E ++++   + IK+E     D+  + E  +S  N+++ + P  +      + +K SP   S   K +  + K W + EL  LF  +H  I  +KD+  F  PV+WE  DIPDYP I+  PMDLSTIK KL +G Y +PW V+ D+WL+FNNAW YNKK+S+VYKMCS LA++FE + D  M S G CCGR+FVYLPQ+L CCTP +C++ RDA+Y+   N  D+SNG+K++ EL  D+++CC+KC+ND+ +D +Q +  ++  A   V+KSL +K +NNVKE EEF+ C+IC +KWHKVCA H+D+IW  GFYC  C   +    + NV  S  LP C LSR+IE RV+ + +    +I +V +RVLS S K  E+K  MK  + E  EMPES  Y+ KA+FAFQE+ DG E+C FG+H QEYGSDCP PN+RRVYLAYLDSV+FF P   RTD YH  L+ YLEY ++LGF  AHIWACPPGEGDDYIFHMHPP QKLPKPKRLQ+WYI MLDKAI E +V++Y DIF+ + NS ++S +E+PYFEGDYWPN LED+ KE          S ++    +E     + +  +N  S    K +K K   +NS N+KR+R   ++  +  ND+ +++ + +E+RKENFFV+RLHSQSDA+ LP +   +D D + F+SDLMDGRDK L L+R+KHLEFSS+RRAKF+TL  CYELH+E ++ V+Y+CN+C+  ++ +RYTC+ CE+FELC  C     HPH L +      DP E                   N +     + P  E    R + + + K  +HA +CRD +C+I  CA+ + +  H   C    + +CK C+    I   H + C +  C++  C+  R
Sbjct:   34 CNHTNCPKFMSILDHIKSCDKAEDCNTRCCISNISYMKHYLNCLQSKC-VCFRFGDKSENNIL--------FAGVKHI---LLRNQYIIWRRKIDPFRPHLLWRISEELSSF-----TKDKTSRDIFFRCISEFDKNNFENSKGIIIYLNNFAKN-----------ANDILNKIQWKHIRCQNPNLSYQDYVEQI-------------NEKDNIQKIFNYLKRYSTDVLHNRMRLEPVPVSNEIKEEITIKNEIKSEMSVNTDVKIEPETQDSPTNSSSLTPPKSI------SSLKTSPSVASIDEKPN-QSEKVWVARELEYLFEPLHSKICHEKDATIFLAPVDWEAEDIPDYPKIISHPMDLSTIKRKLADGDYQDPWHVIADYWLIFNNAWTYNKKSSRVYKMCSNLARIFELEADKTMQSIGLCCGRDFVYLPQILTCCTPQMCMVGRDALYHVLNNEEDESNGDKLVPELASDKFLCCDKCFNDATDDSIQLMLNDSTTALVAVKKSLFTKMKNNVKEREEFIKCKICLKKWHKVCAEHMDEIWGSGFYCPDCESNRRFPKQKNVLISAELPQCNLSRHIEARVDAWRQKESQSIAKVNIRVLSISTKSAEIKSEMKRIFVENGEMPESLPYKSKAIFAFQELSDGSEICLFGMHTQEYGSDCPSPNTRRVYLAYLDSVNFFQPSNLRTDFYHRLLISYLEYCQQLGFIFAHIWACPPGEGDDYIFHMHPPSQKLPKPKRLQDWYIAMLDKAILEGIVVEYSDIFAYSYNSQLMSLSEMPYFEGDYWPNVLEDLLKE------DSALSAADLMLEEELRAPDSMIEQQNGFSNSYSKKRKLKKMSINS-NSKRRRQSDLSDGNNNNDIMKRLFDNLERRKENFFVVRLHSQSDASKLPAVIIDSDCDGIKFNSDLMDGRDKFLALSRDKHLEFSSIRRAKFATLSLCYELHLELRHGVIYSCNSCDLMLDSIRYTCQVCEEFELCDRCVRELGHPHKLHRTPSCQDDPSESVDSSSGNEDRHQSIAAIGNPVTVPAFAPPQDEGAIKRQKTIVFIKMYEHADKCRDASCKIANCARFRRIPDHTIDCAKKNERSCKFCKQIFNIIREHQRDCRNIDCRLEVCIRKR 1110          
The following BLAST results are available for this feature:
BLAST of CREB-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EP3009.289e-1547.37E1A binding protein p300 [Source:HGNC Symbol;Acc:H... [more]
EP3008.272e-1547.37E1A binding protein p300 [Source:HGNC Symbol;Acc:H... [more]
CREBBP0.000e+047.84CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
CREBBP8.219e-1547.84CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
CREBBP3.060e-17753.46CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbp-10.000e+035.43pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-10.000e+035.43pep chromosome:WBcel235:III:9766516:9774825:1 gene... [more]
cbp-10.000e+035.43pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-10.000e+035.13pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-21.010e-1628.90CBP/p300 homolog [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nej5.170e-1046.88gene:FBgn0261617 transcript:FBtr0071402[more]
nej5.170e-1046.88gene:FBgn0261617 transcript:FBtr0302723[more]
nej5.303e-1046.88gene:FBgn0261617 transcript:FBtr0302722[more]
nej5.256e-1046.70gene:FBgn0261617 transcript:FBtr0333521[more]
fs(1)h2.641e-1437.74gene:FBgn0004656 transcript:FBtr0071119[more]
back to top
BLAST of CREB-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crebbpb2.533e-1547.43CREB binding protein b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ep300a3.424e-1548.16E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
crebbpb2.514e-1546.88CREB binding protein b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
CR354584.43.122e-1547.87E1A binding protein p300 a [Source:NCBI gene;Acc:5... [more]
ep300a3.313e-1547.87E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
supv3l13.416e-1547.76Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l13.656e-1547.34Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l14.873e-1548.21Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l11.943e-1548.21Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l13.855e-1548.40Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crebbp0.000e+047.19CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Crebbp5.275e-1547.19CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Ep3005.631e-1545.65E1A binding protein p300 [Source:MGI Symbol;Acc:MG... [more]
Crebbp3.145e-17752.33CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Crebbp2.493e-5749.76CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of CREB-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09472|EP300_HUMAN3.972e-1447.37Histone acetyltransferase p300 OS=Homo sapiens OX=... [more]
sp|Q92793|CBP_HUMAN3.947e-1447.84CREB-binding protein OS=Homo sapiens OX=9606 GN=CR... [more]
sp|Q6JHU9|CBP_RAT3.947e-1447.72Histone lysine acetyltransferase CREBBP OS=Rattus ... [more]
sp|B2RWS6|EP300_MOUSE3.939e-1445.65Histone acetyltransferase p300 OS=Mus musculus OX=... [more]
sp|P45481|CBP_MOUSE3.784e-1446.14Histone lysine acetyltransferase CREBBP OS=Mus mus... [more]
back to top
BLAST of CREB-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MD360.000e+042.14Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2D8G50.000e+042.05CREB-binding protein isoform 2 OS=Schistosoma japo... [more]
A0A419Q0G10.000e+042.05Histone acetyltransferase OS=Clonorchis sinensis O... [more]
A0A4Z2D8G90.000e+042.09CREB-binding protein isoform 1 OS=Schistosoma japo... [more]
A0A074YW500.000e+041.88Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ep300a2.293e-1547.13histone acetyltransferase p300-like [Source:NCBI g... [more]
ep300b2.780e-1547.43E1A binding protein p300 [Source:NCBI gene;Acc:103... [more]
crebbpa3.594e-1544.91CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
crebbpa3.969e-1544.91CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSAMXT00000057848.14.061e-1532.65pep primary_assembly:Astyanax_mexicanus-2.0:12:831... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ep300a6.977e-17845.28E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000006336.14.678e-4551.25pep scaffold:Pmarinus_7.0:GL479543:3524:30791:1 ge... [more]
ENSPMAT00000006283.11.104e-1435.25pep scaffold:Pmarinus_7.0:GL487345:511:5582:1 gene... [more]
ENSPMAT00000002730.15.438e-1342.50pep scaffold:Pmarinus_7.0:GL482934:3:7765:-1 gene:... [more]
ENSPMAT00000002732.11.393e-1242.50pep scaffold:Pmarinus_7.0:GL482934:3:7597:-1 gene:... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
BDF14.765e-1141.98Protein involved in transcription initiation; func... [more]
GCN52.245e-1040.96Catalytic subunit of ADA and SAGA histone acetyltr... [more]
BDF23.407e-936.56Protein involved in transcription initiation; acts... [more]
RSC41.093e-738.55Component of the RSC chromatin remodeling complex;... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407534.952e-1545.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318451.288e-1337.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388591.798e-1341.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448142.718e-829.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449021.169e-734.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CREB-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ep300b2.794e-1546.91histone acetyltransferase p300 [Source:NCBI gene;A... [more]
ep300a1.683e-1445.76histone acetyltransferase p300 [Source:NCBI gene;A... [more]
crebbpb3.716e-1546.28adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
ep300b2.779e-1546.79histone acetyltransferase p300 [Source:NCBI gene;A... [more]
crebbpa4.506e-1547.22CREB-binding protein [Source:NCBI gene;Acc:1011633... [more]
back to top
BLAST of CREB-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066809.10.000e+099.77SMESG000066809.1[more]
SMESG000066809.10.000e+099.74SMESG000066809.1[more]
SMESG000066809.10.000e+099.63SMESG000066809.1[more]
SMESG000018938.10.000e+041.30SMESG000018938.1[more]
SMESG000060474.10.000e+040.81SMESG000060474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002665 ID=SMED30002665|Name=CREB-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5118bp
CTATATAAATCTTATATGATTTAGTAATTTGATTACAATAAAACTTGAAG
ATGACATCATCTTCTGAAGTTATGTCTGTGGAAAATACAGATAAAAATAA
ACAACCTTTGGTTGATAGTGATAAACGATTTTTGATTCGACAACAATTAT
ATTATTTGTTTCATGCATCGAAATGTACTCGTTTAGCTTACACGACTGGT
AAAGGTGATTGTCATAATCAACATTGTATAATGATGCGAAGTGTTGTGAA
GCATATTACGAAATGTCAATCAGGAAAAGATTGCAAATTTCAACATTGTC
CGTCATCTAAAGAGATAATAAAACATTGGAAAAACTGCAATGATGTTGAA
TGCCAAGTTTGTGCTCCATTACGACCAAATAATAATATAAGAAAATCTGT
TAGTAATAAACCTAAAATTAATGGAATAACAAATTATAACGATCAATTTA
ATAACGATAAGGAAGTAAATTGGCGTAATACCATACTTTCAATTCGTCCG
AATTTTTTGGTGAAATTAACAGATGAACTTATACCTGTTAAAGTTTGTGA
AGATGTTAAAAACCATTCTGGATATATTGACGTATCTAATTATGTTAAAA
GTTTTGAATTTGAAATTTTTCAAAAAGCAATTAATATCAATGATTATTTG
TATAAATTAGCTGAAAAATTTGCAATGGTCTATCAACTGCTTTTATCAAA
ACGAAATCCTAAGGAGAATGAAAGTATATTGGCACATAATATCACTAATA
ACCCAACTAAGCAAATTGAGAAATTCTTTCAATTGATTAAATCAGAATTT
GATAAATTCTTTATAGCTTTCAAAGGTAATATGAAAGATAATTTAGAATT
CGGTACAATAAAAAAAGAATTAGTAGCAAATGAAATTCCTATGACACCCG
ATAAAGAATATGAGCAAAAACTGGCATATGGATCATATATAAAAACAGAA
TCCTGGACAGAAAATGACATCGATTCAAAACGGGAATTATTAGAATCTTC
ACCAAATGCCGCAGCTAAATCCACTCCTGTCAAGTTGCCCGCAACTCAGT
TATCTACGGACGTGAAGATGTCACCCGATTCCACATCCACCCCGAATAAA
GACCATACAAATGCCCACAAAAAATGGTCCAGCGAAGAATTATCGGATTT
ATTTATGGAAATCCACCAGCTCATTCTCAGTGACAAAGACAGTGAACCAT
TCAAACTGCCAGTGAATTGGGAACTGCTCGATATTCCAGATTATCCTAGC
ATTGTCAAATGCCCGATGGATCTGTCTACAATCAAAGATAAGCTTGTAAA
TGGGCTGTATAACAATCCGTGGGATGTTGTTGATGATTTCTGGCTGATGT
TCAACAATGCATGGCTCTACAACAAGAAAACTTCCAAGGTTTATAAAATG
TGTAGCACATTGGCAAAACTTTTTGAATCGAAAATCGATGATATTATGGT
TTCGTGTGGATTTTGTTGTGGACGAGAATTTGTTTATCTTCCACAAGTGT
TGATCTGTTGTACTCCGAATGTCTGTCTGATTGTCAGAGACGCGGTGTAT
TATGCCTTTCAAAATGATAAATCCAATGGCGAGAAGATAATTAGTGAATT
GACCTGTGATAGATATATTTGCTGTGAGAAGTGTTATAATGATAGTTGTG
AAGATGTGCAATTTATAAACGCTGAAAATAACGGTGCTGCATGCAAAGTT
CAAAAGTCTTTGCTGTCAAAATGTCGAAACAATGTAAAAGAAAATGAAGA
GTTTGTTTTCTGTCGCATTTGTAATCGAAAATGGCACAAAGTTTGTGCAA
ATCACATTGATGACATATGGAGAGATGGATTCTATTGCGCAACATGTATT
AGAGAAAAGTCTATTAAAATAAAACCAAACGTTTACAAATCGAAAGGTTT
ACCACACTGTGAATTAAGTAGATATATTGAAAACAGAGTTAACAAGTATT
TGAAAGACCGAGATCCAACTATTAACGAGGTAATTGTAAGAGTTCTATCG
AGCAGTGATAAAGTAGTGGAAGTTAAACCGGGAATGAAGAGTCATTATTG
TGAAACTTGTGAAATGCCAGAATCTTTTAAATATCGCTTAAAAGCTGTTT
TTGCTTTTCAAGAAATAGACGGCCAAGAAGTTTGCTTTTTTGGACTTCAT
GTACAAGAGTATGGTTCAGATTGTCCAGATCCGAATTCCCGGCGTGTTTA
TCTTGCATATCTTGATTCTGTTCATTTCTTTTCACCGCGTAAATATCGAA
CTGACGTTTATCATGAGTTTTTGGTTGGATATTTGGAATATGCCAAAAAA
CTCGGATTTACTATGGCCCATATATGGGCTTGTCCTCCTGGCGAAGGGGA
CGATTACATATTCCACATGCATCCACCTGAGCAAAAACTTCCGAAACCTA
AACGTCTCCAAGAATGGTATATTAAAATGCTTGACAAAGCTATTAAGGAG
AACGTTGTCATCGACTATAGAGATATATTTAGCGATGCTCTTAATTCAAG
TATGCTGTCACCAACTGAGCTTCCGTATTTTGAAGGCGATTATTGGCCGA
ATGCACTGGAAGATATTTTTAAAGAAATCGATGAAGAAACTAATAGACGA
TTGAAATCTTATTCTGAAACTCCAAATTCTCAAGAAGGAGAAACTTCACA
AACTGAAGTCATATCAAAAAATAATTTATCAAAAATGGACAAAAAGCCGA
AAAAACGAAAATTAAAACGAATGAATTCGCTGAATAATAAACGAAAAAGA
ATAAATGGTTCAGACACGATTAATGATGTGTCGAGAAAAGTGCTGGAGTT
AATGGAAAAACGAAAAGAAAATTTTTTTGTGATAAGACTTCACAGTCAAA
GTGACGCAGCAAATTTGCCTCCTATTAATGATCCAGATGCTCTGTTCCAT
AGCGATTTAATGGACGGTAGAGATAAATTGCTGTGTTTAGCAAGAGAAAA
ACATTTGGAATTTTCTTCTTTAAGAAGAGCAAAATTTTCGACTCTCTGCT
TTTGTTACGAATTGCACATGGAACAGAAAAATTCCGTACTTTATGCCTGT
AACGCTTGCAATAAGCAAATCGAAGTTCGATATACATGCAAACAATGCGA
AGACTTTGAACTTTGTCCTTCGTGTTATACTACTGAAACACATCCGCATT
CTTTGTTTAAAGTTGATCCTGATGAAGAATCTAACATTTTAAATTCACAA
AACCTATCACAACCAACATCCGAAGACACAACTCGAGCTCGAATGGTTAG
ATATTCTAAGAGTTTGCAGCACGCATGTCAATGTCGAGATGTAAATTGCA
GAATAAATTTGTGTGCTAAAATGAAAGGAATGATAAAACACTTCCAATGT
TGCAGCATACCTAAAAGCACTTGTAAAATGTGTCAATTGTTTTTGCGGAT
TTGTTTTGTCCATGCTAAGTTCTGTTCGGATTCCAAATGTCAAGTACCAA
ATTGCTTGGTGTTAAGATTTAATTGGAAGCAACAGGGAAGCCAACAAAGA
ATGCAACAAGCACAAATGTTGAGAAGAAGAGTAGCTTTAATGCAAAGAGG
CATGCATCCCGAAACTCCGTGTCCTACTTCTGTACCTTTACAATCACAAA
CATCTATTACGTCAATAAATACACAGCCACCTTCTATTGATGCACCAACG
GCCACAATACTTCCTGAAAAAATTTCAGAACCAAACGAATCTGATACATG
CAAAAGAAATAACATAGTAATGCAAAATAAAAGTTCAACTCCAAACAATC
ATGTTCAGTCGTACAATAGTCAATCAGAAACGCCTTTTTGTTCTGCTAAT
GCTAATGCTGTTTACAATAATAACAATAATGTCAATTATGCCATGGATTC
ACGAATAACTGATGACATTAAACTTGTTTATGATAGATACAATTTTTACT
TATCAAATATTCCAAATAAAGAAGATTTTCAAAAAACTTTTGGTACATGG
CTCAATAATAATCCTAAATATCGGTTGGCCTTTGATATGTTATGTAAGAG
ATCCAAGCGTCAGAATGACGGAATGAATAATAACAATAATAATAATAATG
AAATATCCTCTATCACAACTGATGATGACAGTTTACCTCCGCCTCCATCT
ATAGAAGCATCTGATGAATCTCCTATTCCTATTAACATATCCGATCATAT
GTCTCACATTGAGATGGTCACAGATTCTATACCGATGATCGATGAAACTC
CGTCTAGTGAGAGTTTTGATGACGTTTGTTTCAACCAGCCAACAATTATC
TTAGTCAAACCAAACGTTTTCCAAAAATGGTCACAACCAGAAGCAACGGA
AGAAAAAGAGGAAATGGTTGTCGAAGTAAAACCAGTACAAAAAACCGGAA
CAATTTTGAAATCCGGAACAAGTCAGTTTCCCGTTGGGCCGAAATCATCA
CGCACAAATAAAGTGGTGTTTTGTAACACCGTTTTCGTTGAAGATGGATC
TGAAACTATTCGGCTCAACTGCCCTTCGGAAGAAAGTGACATTGAAGAAC
AGTTAAACACGTCAGTTTCAGTCGATGATCAAGGGACAATCCGAAAAAAT
CCACCGCCTCCTCCTCCTAGGAGAACAAGCCAAATCTCGTCTGGAGTTGA
CACCAATGATGGAGATATCAATTATGAAAACCTTGAATCGTTTTCATCCG
ACATGAGACATCATATTCTCCATCATAATCTCGTTTGTGTTCCATTAACT
GTGAAATCACCATCCAGTGGGCAGACTGGTACAAACCATTCCAATGAACA
TGCGGAAAAACGAAGAATAGATCCCGTTAGTATTAAACAGACGAAATTGA
AACCTCTTCCTTGTCCATCGGAAAATGATGTGTGGCAGAGACAGACAGAA
TTCAACACTCCAACTAGCAGATCCGTTCCGCCGACAACGAAACCAAACAG
TAAAACATCTGCAGATTCTACAAAACCGAAAACTGAAAAATCAAACAAAA
AGAATAAATAACGTCATTGAACAAGAAAAGGAGAATTTCAACTCGACTCT
TTTCGTTACATCATTCACATTTAGAGATTCTTTAATATTTCATCGTTTTT
CCTGAGTTATGGAGTATTTTTGGAATTAGTTTTTGCCGATTTTATCGAGA
TCCGACCCGATTGGACTC
back to top

protein sequence of SMED30002665-orf-1

>SMED30002665-orf-1 ID=SMED30002665-orf-1|Name=SMED30002665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1637bp
MTSSSEVMSVENTDKNKQPLVDSDKRFLIRQQLYYLFHASKCTRLAYTTG
KGDCHNQHCIMMRSVVKHITKCQSGKDCKFQHCPSSKEIIKHWKNCNDVE
CQVCAPLRPNNNIRKSVSNKPKINGITNYNDQFNNDKEVNWRNTILSIRP
NFLVKLTDELIPVKVCEDVKNHSGYIDVSNYVKSFEFEIFQKAININDYL
YKLAEKFAMVYQLLLSKRNPKENESILAHNITNNPTKQIEKFFQLIKSEF
DKFFIAFKGNMKDNLEFGTIKKELVANEIPMTPDKEYEQKLAYGSYIKTE
SWTENDIDSKRELLESSPNAAAKSTPVKLPATQLSTDVKMSPDSTSTPNK
DHTNAHKKWSSEELSDLFMEIHQLILSDKDSEPFKLPVNWELLDIPDYPS
IVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKM
CSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLICCTPNVCLIVRDAVY
YAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKV
QKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCI
REKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLS
SSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLH
VQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKK
LGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKE
NVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRR
LKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKR
INGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAANLPPINDPDALFH
SDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHMEQKNSVLYAC
NACNKQIEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQ
NLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQC
CSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNCLVLRFNWKQQGSQQR
MQQAQMLRRRVALMQRGMHPETPCPTSVPLQSQTSITSINTQPPSIDAPT
ATILPEKISEPNESDTCKRNNIVMQNKSSTPNNHVQSYNSQSETPFCSAN
ANAVYNNNNNVNYAMDSRITDDIKLVYDRYNFYLSNIPNKEDFQKTFGTW
LNNNPKYRLAFDMLCKRSKRQNDGMNNNNNNNNEISSITTDDDSLPPPPS
IEASDESPIPINISDHMSHIEMVTDSIPMIDETPSSESFDDVCFNQPTII
LVKPNVFQKWSQPEATEEKEEMVVEVKPVQKTGTILKSGTSQFPVGPKSS
RTNKVVFCNTVFVEDGSETIRLNCPSEESDIEEQLNTSVSVDDQGTIRKN
PPPPPPRRTSQISSGVDTNDGDINYENLESFSSDMRHHILHHNLVCVPLT
VKSPSSGQTGTNHSNEHAEKRRIDPVSIKQTKLKPLPCPSENDVWQRQTE
FNTPTSRSVPPTTKPNSKTSADSTKPKTEKSNKKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035898TAZ_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR043145Znf_ZZ_sf
IPR036427Bromodomain-like_sf
IPR038547RING_CBP-p300_sf
IPR001487Bromodomain
IPR000197Znf_TAZ
IPR013178Histone_AcTrfase_Rtt109/CBP
IPR000433Znf_ZZ
IPR010303RING_CBP-p300
IPR031162CBP_P300_HAT
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004402histone acetyltransferase activity
GO:0003712transcription cofactor activity
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0016573histone acetylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 379..392
score: 33.7
coord: 411..429
score: 32.61
coord: 395..411
score: 54.35
coord: 429..448
score: 42.61
IPR001487BromodomainSMARTSM00297bromo_6coord: 357..467
e-value: 6.1E-31
score: 118.8
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 374..451
e-value: 2.9E-17
score: 62.5
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 376..448
score: 17.936
IPR000197Zinc finger, TAZ-typeSMARTSM00551TAZ_2coord: 24..107
e-value: 1.6E-19
score: 80.9
coord: 1059..1136
e-value: 6.4E-6
score: 31.8
IPR000197Zinc finger, TAZ-typePFAMPF02135zf-TAZcoord: 1068..1135
e-value: 3.9E-7
score: 30.4
coord: 29..104
e-value: 1.5E-14
score: 54.2
IPR000197Zinc finger, TAZ-typePROSITEPS50134ZF_TAZcoord: 22..107
score: 17.543
IPR000197Zinc finger, TAZ-typePROSITEPS50134ZF_TAZcoord: 1058..1138
score: 11.58
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 994..1035
e-value: 7.6E-8
score: 42.1
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 998..1033
e-value: 5.0E-9
score: 35.8
IPR000433Zinc finger, ZZ-typePROSITEPS01357ZF_ZZ_1coord: 1000..1025
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 998..1037
score: 10.902
IPR013178Histone acetyltransferase Rtt109/CBPSMARTSM01250KAT11_2coord: 630..941
e-value: 3.3E-112
score: 388.8
IPR013178Histone acetyltransferase Rtt109/CBPPFAMPF08214HAT_KAT11coord: 630..941
e-value: 2.2E-59
score: 201.5
IPR010303CREB-binding protein/p300, atypical RING domainPFAMPF06001DUF902coord: 465..504
e-value: 1.2E-12
score: 48.1
IPR035898TAZ domain superfamilyGENE3DG3DSA:1.20.1020.10coord: 17..114
e-value: 2.2E-26
score: 93.6
IPR035898TAZ domain superfamilyGENE3DG3DSA:1.20.1020.10coord: 1055..1164
e-value: 1.4E-23
score: 84.8
IPR035898TAZ domain superfamilySUPERFAMILYSSF57933TAZ domaincoord: 21..109
IPR035898TAZ domain superfamilySUPERFAMILYSSF57933TAZ domaincoord: 1059..1137
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 562..605
e-value: 7.5E-13
score: 49.8
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 992..1041
e-value: 1.8E-13
score: 52.1
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 336..468
e-value: 5.9E-36
score: 125.3
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 342..466
IPR038547CBP/p300, atypical RING domain superfamilyGENE3DG3DSA:2.10.110.40coord: 479..560
e-value: 3.6E-8
score: 35.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 879..896
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 853..874
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 850..905
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..356
NoneNo IPR availablePANTHERPTHR13808CBP/P300-RELATEDcoord: 6..112
NoneNo IPR availablePANTHERPTHR13808:SF29HISTONE ACETYLTRANSFERASE P300coord: 277..1228
NoneNo IPR availablePANTHERPTHR13808CBP/P300-RELATEDcoord: 277..1228
NoneNo IPR availablePANTHERPTHR13808:SF29HISTONE ACETYLTRANSFERASE P300coord: 6..112
NoneNo IPR availableCDDcd15557PHD_CBP_p300coord: 568..599
e-value: 1.29039E-8
score: 49.958
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 994..1038
IPR031162CBP/p300-type histone acetyltransferase domainPROSITEPS51727CBP_P300_HATcoord: 611..993
score: 89.498
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 556..604