SMED30002664

Overview
NameSMED30002664
Smed IDSMED30002664
Length (bp)978
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002664 (SMED30002664) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002664 (SMED30002664) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002664 (SMED30002664) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002664 (SMED30002664) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002664

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30002664h1SMcG0010484 Contig3127GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002664h1SMcG0010484 Contig3127GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002664h1SMcG0010484 PL08004A1D10smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30002664h1SMcG0010484 dd_Smed_v4_2782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002664h1SMcG0010484 Contig38940uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002664h1SMcG0010484 Contig38940newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002664h1SMcG0010484 dd_Smed_v4_2782_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002664 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000019:107535..122140 +4627
Homology
BLAST of SMED30002664 vs. Ensembl Human
Match: ANKK1 (ankyrin repeat and kinase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:21027])

HSP 1 Score: 102.834 bits (255), Expect = 1.393e-23
Identity = 65/204 (31.86%), Postives = 102/204 (50.00%), Query Frame = 1
Query:  187 CNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINE 798
            C    G   LL AA D ++ D+   LL +  D +  ++ GW  LH  + +G    A  LL  GA  + ++  G  P+HL+  N    V +LL+   A PN  +  G TP+  AA  GHV++VK+L S+GA+++ Q ++  TPLH          ++ LL +GA P   ++ G   L  A  +G   + K    +G S E P ++
Sbjct:  390 CQTASGYTPLLIAAQD-QQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQ 592          

HSP 2 Score: 88.9669 bits (219), Expect = 7.390e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            DE G   L  A  +  +     LL++   +D + + GWT LH  + +    +A  L+++ A+PN+ +  G+ P+H++ + GH  +VKLL    A+ +A Q N  TP+  A  +G V  ++ L   GA  +   + G  PLH        +  K+LL  GA   +   +G T L  A  KG +E+I   ++
Sbjct:  425 DEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAE 614          

HSP 3 Score: 82.0333 bits (201), Expect = 1.483e-16
Identity = 57/185 (30.81%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L  A++  K   I  LL +    D  ++ G+  LH  +  G + I   LL  GA+  +  + G  P+HL+ + GH +++ LL E  A   A     WTP+  AA  G   +V  L   GAD N   + G TPLH      + + V  LL++ A+   RN+ G T    A  KG   ++K   + G
Sbjct:  531 LHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAG 715          

HSP 4 Score: 78.9518 bits (193), Expect = 1.595e-15
Identity = 50/161 (31.06%), Postives = 71/161 (44.10%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            ++  L +   +LD + +   T LH     G       LL  GA P+  D  G  P+H +   G   + K+LL Y A      + GWTP+  AA KGH+ I+ +L    A++   G    TPLH          V  LL  GADP    + G T L  A ++
Sbjct:  509 LVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQR 669          

HSP 5 Score: 73.1738 bits (178), Expect = 1.448e-13
Identity = 47/147 (31.97%), Postives = 71/147 (48.30%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLI 687
            ++I+ L  +  ++     + WT LH  +  G   + S LL  GA+PN  +  G  P+HL+V       V  LLE+ A  +A    GWTP   AA KG+  I+K+L   GA ++ Q     TPL  L       G+   L+ G +P +
Sbjct:  607 EIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDGVSCTPLQ-LALRSRKQGIMSFLE-GKEPSV 751          

HSP 6 Score: 72.7886 bits (177), Expect = 1.886e-13
Identity = 51/176 (28.98%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            D+ G   L  A    K  +   LL     L+     GWT LH  +  G  EI   L    AN          P+HL+  +G   VV  LL+  A PNA + +GWTP+  A  +     V  L    A+++ + K G TP H      +   +K+L++ GA   +++    T L+ A
Sbjct:  557 DQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDGVSCTPLQLA 732          

HSP 7 Score: 70.0922 bits (170), Expect = 1.279e-12
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  289 YKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            Y+NK+  T LH +   G  E    LLA   + + +   G  P+ ++  +    +  LLL + A  N    +GW P+ +AA  G     ++L   GA ++ Q ++G TPLH    +      ++L+   ADP +    G T L  A   G + ++K  +  G
Sbjct:  359 YENKV--TPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQG 517          
BLAST of SMED30002664 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 100.908 bits (250), Expect = 9.797e-23
Identity = 60/189 (31.75%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HLS   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++     ++G
Sbjct:  460 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYG 648          

HSP 2 Score: 91.6633 bits (226), Expect = 1.226e-19
Identity = 57/175 (32.57%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+A+ LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  540 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 714          

HSP 3 Score: 85.5001 bits (210), Expect = 1.503e-17
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  165 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ 337          

HSP 4 Score: 83.9593 bits (206), Expect = 4.111e-17
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VVK LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   61 INICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINV 244          

HSP 5 Score: 83.1889 bits (204), Expect = 7.018e-17
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +VK L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   55 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 206          

HSP 6 Score: 79.7221 bits (195), Expect = 1.141e-15
Identity = 56/177 (31.64%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  342 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 518          

HSP 7 Score: 79.337 bits (194), Expect = 1.383e-15
Identity = 46/143 (32.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  +A +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  457 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVA 599          

HSP 8 Score: 77.411 bits (189), Expect = 6.761e-15
Identity = 46/138 (33.33%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          VK LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   46 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 183          

HSP 9 Score: 77.0258 bits (188), Expect = 8.120e-15
Identity = 50/158 (31.65%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  +  +G  +V     D G S
Sbjct:  394 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS 551          

HSP 10 Score: 77.0258 bits (188), Expect = 8.500e-15
Identity = 58/205 (28.29%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL + AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G TPLH          + +LL N A P      G TAL  A   G I V+
Sbjct:  602 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVV 806          

HSP 11 Score: 74.7146 bits (182), Expect = 4.830e-14
Identity = 51/177 (28.81%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ +A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A+P  +   G T L  A +K  I+V++     G S
Sbjct:  243 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS 419          

HSP 12 Score: 73.1738 bits (178), Expect = 1.484e-13
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  276 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 452          

HSP 13 Score: 63.1586 bits (152), Expect = 2.897e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G  P+H +   GH+ ++ +LL+ +A PN    NG T +  A   G++++V  LK
Sbjct:  687 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 14 Score: 56.9954 bits (136), Expect = 2.516e-8
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV+K   D G S
Sbjct:   62 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS 159          
BLAST of SMED30002664 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 100.908 bits (250), Expect = 9.803e-23
Identity = 60/189 (31.75%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HLS   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++     ++G
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYG 637          

HSP 2 Score: 91.6633 bits (226), Expect = 1.227e-19
Identity = 57/175 (32.57%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+A+ LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  529 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 703          

HSP 3 Score: 85.5001 bits (210), Expect = 1.503e-17
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  154 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ 326          

HSP 4 Score: 83.9593 bits (206), Expect = 4.113e-17
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VVK LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   50 INICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINV 233          

HSP 5 Score: 83.1889 bits (204), Expect = 7.022e-17
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +VK L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   44 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 195          

HSP 6 Score: 79.7221 bits (195), Expect = 1.141e-15
Identity = 56/177 (31.64%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 507          

HSP 7 Score: 79.337 bits (194), Expect = 1.384e-15
Identity = 46/143 (32.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  +A +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  446 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVA 588          

HSP 8 Score: 77.411 bits (189), Expect = 6.764e-15
Identity = 46/138 (33.33%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          VK LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   35 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 172          

HSP 9 Score: 77.0258 bits (188), Expect = 8.124e-15
Identity = 50/158 (31.65%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  +  +G  +V     D G S
Sbjct:  383 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS 540          

HSP 10 Score: 77.0258 bits (188), Expect = 8.504e-15
Identity = 58/205 (28.29%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL + AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G TPLH          + +LL N A P      G TAL  A   G I V+
Sbjct:  591 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVV 795          

HSP 11 Score: 74.7146 bits (182), Expect = 4.833e-14
Identity = 51/177 (28.81%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ +A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A+P  +   G T L  A +K  I+V++     G S
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS 408          

HSP 12 Score: 73.1738 bits (178), Expect = 1.484e-13
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  265 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 441          

HSP 13 Score: 63.1586 bits (152), Expect = 2.898e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G  P+H +   GH+ ++ +LL+ +A PN    NG T +  A   G++++V  LK
Sbjct:  676 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 14 Score: 56.9954 bits (136), Expect = 2.517e-8
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV+K   D G S
Sbjct:   51 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS 148          
BLAST of SMED30002664 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 100.908 bits (250), Expect = 1.062e-22
Identity = 60/189 (31.75%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HLS   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++     ++G
Sbjct:  466 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYG 654          

HSP 2 Score: 91.6633 bits (226), Expect = 1.327e-19
Identity = 57/175 (32.57%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+A+ LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  546 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 720          

HSP 3 Score: 85.5001 bits (210), Expect = 1.623e-17
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  171 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ 343          

HSP 4 Score: 83.9593 bits (206), Expect = 4.438e-17
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VVK LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   67 INICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINV 250          

HSP 5 Score: 83.1889 bits (204), Expect = 7.576e-17
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +VK L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   61 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 212          

HSP 6 Score: 79.7221 bits (195), Expect = 1.230e-15
Identity = 56/177 (31.64%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  348 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 524          

HSP 7 Score: 79.337 bits (194), Expect = 1.491e-15
Identity = 46/143 (32.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  +A +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  463 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVA 605          

HSP 8 Score: 77.411 bits (189), Expect = 7.282e-15
Identity = 46/138 (33.33%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          VK LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   52 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 189          

HSP 9 Score: 77.0258 bits (188), Expect = 8.745e-15
Identity = 50/158 (31.65%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  +  +G  +V     D G S
Sbjct:  400 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS 557          

HSP 10 Score: 77.0258 bits (188), Expect = 9.154e-15
Identity = 58/205 (28.29%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL + AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G TPLH          + +LL N A P      G TAL  A   G I V+
Sbjct:  608 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVV 812          

HSP 11 Score: 74.7146 bits (182), Expect = 5.197e-14
Identity = 51/177 (28.81%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ +A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A+P  +   G T L  A +K  I+V++     G S
Sbjct:  249 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS 425          

HSP 12 Score: 73.1738 bits (178), Expect = 1.595e-13
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  282 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 458          

HSP 13 Score: 63.1586 bits (152), Expect = 3.095e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G  P+H +   GH+ ++ +LL+ +A PN    NG T +  A   G++++V  LK
Sbjct:  693 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 14 Score: 56.9954 bits (136), Expect = 2.676e-8
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV+K   D G S
Sbjct:   68 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS 165          
BLAST of SMED30002664 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 100.138 bits (248), Expect = 1.477e-22
Identity = 65/191 (34.03%), Postives = 95/191 (49.74%), Query Frame = 1
Query:  181 NYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N     E G   L  A+    N  +  LL N    D K K+   ALH  +     + A+ LL    N +V+   G  P+H++   G+  V  LLL   A  + T  NG TP+  A+ +G+  +VK+L  +G  I+ + +DGLTPLH    S     V++LL+ GA  L R +RG TAL  A   G +EV++
Sbjct:  134 NQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVR 320          

HSP 2 Score: 93.5893 bits (231), Expect = 2.569e-20
Identity = 61/200 (30.50%), Postives = 97/200 (48.50%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC-YHNLCMACYHNRSSCNI 894
            K G+T LH  +  G  ++A  LL + A  +     G  P+H++    + KV  LLLE  A P+AT  NG+TP+  AA K  + I   L + GA+ N   K G+TPLH  +       V +LLD GA+  +  + GLT+L  A ++  + V    +  G   +       H ++G   + + C Y N+ M  +  +   N+
Sbjct:  400 KKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDA------HTKLGYTPLIVACHYGNVKMVNFLLKQGANV 593          

HSP 3 Score: 85.8853 bits (211), Expect = 9.460e-18
Identity = 57/189 (30.16%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + +V+  LL N   +D + +   T LH  S  G  EI   LL   A+P+     G  P+H+S   G   V  +LLE  A  +     G+TP+  AA  G + + K+L  + A  +  GK+GLTPLH      +     +LL+ GA P    + G T L  A +K  +++     ++G
Sbjct:  303 GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYG 491          

HSP 4 Score: 83.9593 bits (206), Expect = 4.108e-17
Identity = 53/177 (29.94%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            K +++  LL ++   D     G+T LH  + +G  ++AS LL  GA  ++    G  P+H++   G   V KLLL+  A  ++   NG TP+  AA   +  +  +L  KGA  +   K+G TPLH             LL+ GA+  I  ++G+T L  A ++G  +++    D G
Sbjct:  348 KTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKG 524          

HSP 5 Score: 83.5741 bits (205), Expect = 5.674e-17
Identity = 62/192 (32.29%), Postives = 98/192 (51.04%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGA--DPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I +RK+D      LL N  + D ++K G+T LH  +  G   +A+ LL +GA  +     G  P+H++   G++ +VKLLL+   + +A   +G TP+  AA  GH  +V++L  +GA +  + K G T LH    +     V+ LL NGA  D   R E+  T L  A   G  E+++
Sbjct:  164 NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ--TPLHIASRLGKTEIVQ 353          

HSP 6 Score: 83.5741 bits (205), Expect = 6.052e-17
Identity = 56/169 (33.14%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            L  A  S  + V+  LL     L  + K G TALH  +  G  E+   LL  GA  + R    + P+H++   G +++V+LLL++ A P+A   NG+TP+  +A +G V +  +L   GA  +   K G TPLH      S    K+LL   A      + GLT L  A
Sbjct:  274 LHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVA 442          

HSP 7 Score: 82.4185 bits (202), Expect = 1.301e-16
Identity = 66/227 (29.07%), Postives = 94/227 (41.41%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL---KSKGA--------------------------DINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            IN CN  + G N L  A       ++  LL     +D   K G TALH  S  G  E+   L+ +GAN N +   G  P++++    H  VVK LLE  A  +    +G+TP+A A  +GH   V IL    +KG                           + + Q K G TPLH      +     +LL+ GA        G+T L  A ++G   ++K   D G
Sbjct:   36 INTCN--QNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRG 260          

HSP 8 Score: 82.0333 bits (201), Expect = 1.763e-16
Identity = 53/168 (31.55%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            DV   LL      D   K G T LH  +     ++A  LL KGA+P+     G  P+H++      ++   LL Y A+ N     G TP+  A+ +GH  +V +L  KGA+I+   K GLT LH            IL  +GAD     + G T L  A   G ++++
Sbjct:  416 DVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMV 583          

HSP 9 Score: 82.0333 bits (201), Expect = 2.024e-16
Identity = 54/218 (24.77%), Postives = 101/218 (46.33%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAK-----------------------------PNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            GN  L  A  + + +V+  L+    +++ +++ G+T L+  + +   ++   LL  GAN +     G  P+ +++  GH++ V +LLE   K                              +    +G+TP+  AA  G+V +  +L ++GA ++F  ++G+TPLH  +   +   VK+LLD G     +   GLT L CA   G  +V++   + G
Sbjct:   76 GNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERG 293          

HSP 10 Score: 79.337 bits (194), Expect = 1.273e-15
Identity = 67/227 (29.52%), Postives = 93/227 (40.97%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            T  GF    +A    Y  L  A  L +     +  G N L  L  A       V   LL          K G+T LH  +     +IAS LL  GA  N+    G  P+HL+   GH+ +V LLL+  A  + +  +G T +  AA +  V +  IL   GAD +   K G TPL       +   V  LL  GA+   + + G T L  A ++G   +I      G
Sbjct:  399 TKKGFTPLHVA--AKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHG 623          

HSP 11 Score: 78.5666 bits (192), Expect = 2.465e-15
Identity = 51/162 (31.48%), Postives = 81/162 (50.00%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            D +   L   ID++  N+ G  ALH  + +G   +  +LL +G++ +     G   +H++   G ++VVK+L++  A  NA   NG+TP+  AA + H+ +VK L   GA+ +   +DG TPL           V ILL+N     +R    L AL  A  K
Sbjct:   24 DKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVR----LPALHIAARK 181          

HSP 12 Score: 77.411 bits (189), Expect = 6.515e-15
Identity = 52/175 (29.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +V   LLN    +D+  + G T LH  S  G   +   LL +G   + +   G  P+H +  +GH +VV+LLLE  A   A    G T +  AA  G V +V+ L   GA ++ + ++  TPLH  +       V++LL + A P      G T L  +  +G ++V     + G
Sbjct:  218 NVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAG 392          

HSP 13 Score: 69.3218 bits (168), Expect = 3.147e-12
Identity = 44/122 (36.07%), Postives = 69/122 (56.56%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            G  +L  AA + + N V   L  +  D D   K+G+T L  V+C  G  ++ + LL +GAN N +   G  P+H +   GH+ ++ +LL++ AKPNAT  NG T +A A   G++++V  LK
Sbjct:  534 GLTSLHLAAQEDKVN-VADILTKHGADQDAHTKLGYTPL-IVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 653          

HSP 14 Score: 68.9366 bits (167), Expect = 3.605e-12
Identity = 48/169 (28.40%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +++  LL+    +D K + G T LH  +  G  ++   LL +GA    R   GE  +H++   G  +VV+ LL   A  +A      TP+  A+  G   IV++L    A  +    +G TPLH            +LL+ GA   +  ++G T L  A + G+++V K
Sbjct:  251 NMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK 419          

HSP 15 Score: 65.855 bits (159), Expect = 4.335e-11
Identity = 40/124 (32.26%), Postives = 62/124 (50.00%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            L  G + N  +  G   +HL+   GH  +V+ LL   +  ++    G T +  A+  G   +VK+L  +GA+IN Q ++G TPL+          VK LL+NGA+     E G T L  A ++G
Sbjct:   30 LKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQG 153          

HSP 16 Score: 65.4698 bits (158), Expect = 5.580e-11
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL+   ++    K G T+LH  + +    +A  L   GA+ +     G  P+ ++   G+ K+V  LL+  A  NA   NG+TP+  AA +GH  I+ +L   GA  N    +G T L
Sbjct:  515 DMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 637          
BLAST of SMED30002664 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 97.8265 bits (242), Expect = 4.030e-22
Identity = 73/230 (31.74%), Postives = 103/230 (44.78%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T  GF    LA    Y  L+    L +     + EG N +  L  A     + V   LL N        K G+T LH  +     EIAS LL   A+PN +   G  P+HLS   GH ++  LL+E  +   A  NNG T +   A + HV + +IL + GA+IN +   G TPLH          VK L++NGAD   +     T L  A ++G    ++   + G S
Sbjct:  553 LTKKGFTPLHLAS--KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 89.7373 bits (221), Expect = 1.789e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            G   L  A  + + DV+  L+ N   +D + +   T LH  S  G  +I   LL  GAN N   RDN+   P+H++   G  +V  +LL+++A        G+TP+  A+  G++ +V++L  +G  ++ +GK+ +TPLH      +     +LL+NGA      + G T L  A +K  +E+      F
Sbjct:  458 GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 3 Score: 87.4261 bits (215), Expect = 9.662e-19
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            I  +KN   V+  LL     ++   + G T LH  +  G   I   LL +GANP+V    GE P+HL+     + VV++L+   AK +A      TP+  A+  G+  IV +L   GA+ N   +D  +PLH            ILLD+ AD  +  ++G T L  A + G +EV++   + G
Sbjct:  398 IACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG 580          

HSP 4 Score: 80.8777 bits (198), Expect = 1.843e-16
Identity = 72/232 (31.03%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  211 NLLF---AAIDSRKNDVIYFLL-------NNIIDL--------DYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN-----HCRIGNASI 831
            NLL    A IDSR  D++  L        + ++DL          K K G   LH  +     + A  LL   A   V D   +Y  P+H++   GH +V KLLL+ SA PN+   NG+TP+  A  K  + +V++L    A I    + GLTPLH   F  +   V  LL  GA+P +   RG T L  A      +V++     G   +    E         R+GN  I
Sbjct:  277 NLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDI 506          

HSP 5 Score: 79.7221 bits (195), Expect = 3.844e-16
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    + +V   LL++  D     K G+T LH  S  G  E+   LL +G   ++       P+H++    + KV  LLLE  A   A   NG+TP+  AA K  + I   L    AD N + + G TPLH            +L++NG+D   +   GLTA+  CA+E
Sbjct:  528 LHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQE 699          

HSP 6 Score: 78.5666 bits (192), Expect = 1.055e-15
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  127 AKCGDYDG-LKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            A+ GD +  L+   + + IN  N +  G N L  A     ++V+  L+     +D   + G TALH  S  G   I + L+  GAN NV+   G  P++++    H +VVK LL++ A    +  +G+TP+A A  +GH  +V +L    +    +GK  L  LH            +LL N  +P + ++ G T L  A   G
Sbjct:   41 ARAGDLEKVLELLRAGTDINTSNAN--GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYG 238          

HSP 7 Score: 77.7962 bits (190), Expect = 1.551e-15
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC 810
            E G   L  A+    + V+  LL N    D K K+   ALH  +       A+ LL    NP+V    G  P+H++   GH  V +LLLE  A  N    +  +P+  A   G   +  +L S+GA I+ + KD LTPLH    S     V +L+  GA    + + GL  L  A +   ++  +          D  + +  P++   HC
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC 369          

HSP 8 Score: 75.485 bits (184), Expect = 1.151e-14
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVI--YFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF------------LTFSKSAMG---------------------VKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I ++K+D      LL N  + D  +K G+T LH  +  G   +   LL KGAN N +      P+H++   G + +  LLL   A  ++   +  TP+  AA  GH  +V +L  +GA I+ + K+GL PLH             L + ++ +                       K+LLD  ADP  R   G T L  A +K  I+V++
Sbjct:  187 NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVE 409          

HSP 9 Score: 75.0998 bits (183), Expect = 1.357e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T LH  +  G   +A  LL + A+PN R   G  P+H++      KVV+LLL+Y A   AT  +G TP+  AA  G + IV  L  +GA+ + +   G TPLH    +     V++L+ NGA    +     T L  A   G  +++
Sbjct:  361 TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 10 Score: 72.4034 bits (176), Expect = 1.095e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  358 KLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +LL  G + N  +  G   +HL+   GHS+VV+ L++  A+ +A    G T +  A+  G   IV IL   GA++N Q  +G TPL+          VK LL +GA+  +  E G T L  A ++G   V+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVV 181          

HSP 11 Score: 72.0182 bits (175), Expect = 1.351e-13
Identity = 55/180 (30.56%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            EG  + L AA   R  D+  +  LL    D++  N  G  +LH  S +G  E+  +L+ + A  +     G   +H++   G S +V +L+E  A  N    NG+TP+  AA + H  +VK L   GA+     +DG TPL           V +LL+N +   +R    L AL  A +K
Sbjct:   32 EGSASFLRAA---RAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKK 204          

HSP 12 Score: 68.9366 bits (167), Expect = 1.611e-12
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            + ++   LL+    +D + K   T LH  +  G  ++   L+ +GA  + +   G  P+H++    H    + LL + A  +    +  TP+  AA  GHV + K+L  + AD N +  +G TPLH          V++LL   A      E GLT L  A   GAI ++
Sbjct:  272 RTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIV 441          

HSP 13 Score: 61.2326 bits (147), Expect = 5.149e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
             L+ N  D+  K   G TA+H  + +    +A  L   GA  N + N G  P+H++   G   +VK L+E  A         +TP+  AA +GH   V+ L   GA  N Q   G TPL
Sbjct:  674 LLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 14 Score: 57.7658 bits (138), Expect = 5.598e-9
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            V   L NN  +++ K   G+T LH V+C  G   +   L+  GA+   +      P+H +   GH+  V+ LLE  A PN     G TP++ A   G+V++V+ L+
Sbjct:  704 VAQILYNNGAEINSKTNAGYTPLH-VACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 15 Score: 50.8322 bits (120), Expect = 1.105e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL      N +  NG   +  A+ +GH  +V+ L  + A ++   + G T LH  + +  ++ V IL++NGA+  +++  G T L  A ++   EV+K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of SMED30002664 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 97.8265 bits (242), Expect = 4.030e-22
Identity = 73/230 (31.74%), Postives = 103/230 (44.78%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T  GF    LA    Y  L+    L +     + EG N +  L  A     + V   LL N        K G+T LH  +     EIAS LL   A+PN +   G  P+HLS   GH ++  LL+E  +   A  NNG T +   A + HV + +IL + GA+IN +   G TPLH          VK L++NGAD   +     T L  A ++G    ++   + G S
Sbjct:  553 LTKKGFTPLHLAS--KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 89.7373 bits (221), Expect = 1.789e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            G   L  A  + + DV+  L+ N   +D + +   T LH  S  G  +I   LL  GAN N   RDN+   P+H++   G  +V  +LL+++A        G+TP+  A+  G++ +V++L  +G  ++ +GK+ +TPLH      +     +LL+NGA      + G T L  A +K  +E+      F
Sbjct:  458 GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 3 Score: 87.4261 bits (215), Expect = 9.662e-19
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            I  +KN   V+  LL     ++   + G T LH  +  G   I   LL +GANP+V    GE P+HL+     + VV++L+   AK +A      TP+  A+  G+  IV +L   GA+ N   +D  +PLH            ILLD+ AD  +  ++G T L  A + G +EV++   + G
Sbjct:  398 IACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG 580          

HSP 4 Score: 80.8777 bits (198), Expect = 1.843e-16
Identity = 72/232 (31.03%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  211 NLLF---AAIDSRKNDVIYFLL-------NNIIDL--------DYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN-----HCRIGNASI 831
            NLL    A IDSR  D++  L        + ++DL          K K G   LH  +     + A  LL   A   V D   +Y  P+H++   GH +V KLLL+ SA PN+   NG+TP+  A  K  + +V++L    A I    + GLTPLH   F  +   V  LL  GA+P +   RG T L  A      +V++     G   +    E         R+GN  I
Sbjct:  277 NLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDI 506          

HSP 5 Score: 79.7221 bits (195), Expect = 3.844e-16
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    + +V   LL++  D     K G+T LH  S  G  E+   LL +G   ++       P+H++    + KV  LLLE  A   A   NG+TP+  AA K  + I   L    AD N + + G TPLH            +L++NG+D   +   GLTA+  CA+E
Sbjct:  528 LHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQE 699          

HSP 6 Score: 78.5666 bits (192), Expect = 1.055e-15
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  127 AKCGDYDG-LKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            A+ GD +  L+   + + IN  N +  G N L  A     ++V+  L+     +D   + G TALH  S  G   I + L+  GAN NV+   G  P++++    H +VVK LL++ A    +  +G+TP+A A  +GH  +V +L    +    +GK  L  LH            +LL N  +P + ++ G T L  A   G
Sbjct:   41 ARAGDLEKVLELLRAGTDINTSNAN--GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYG 238          

HSP 7 Score: 77.7962 bits (190), Expect = 1.551e-15
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC 810
            E G   L  A+    + V+  LL N    D K K+   ALH  +       A+ LL    NP+V    G  P+H++   GH  V +LLLE  A  N    +  +P+  A   G   +  +L S+GA I+ + KD LTPLH    S     V +L+  GA    + + GL  L  A +   ++  +          D  + +  P++   HC
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC 369          

HSP 8 Score: 75.485 bits (184), Expect = 1.151e-14
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVI--YFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF------------LTFSKSAMG---------------------VKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I ++K+D      LL N  + D  +K G+T LH  +  G   +   LL KGAN N +      P+H++   G + +  LLL   A  ++   +  TP+  AA  GH  +V +L  +GA I+ + K+GL PLH             L + ++ +                       K+LLD  ADP  R   G T L  A +K  I+V++
Sbjct:  187 NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVE 409          

HSP 9 Score: 75.0998 bits (183), Expect = 1.357e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T LH  +  G   +A  LL + A+PN R   G  P+H++      KVV+LLL+Y A   AT  +G TP+  AA  G + IV  L  +GA+ + +   G TPLH    +     V++L+ NGA    +     T L  A   G  +++
Sbjct:  361 TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 10 Score: 72.4034 bits (176), Expect = 1.095e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  358 KLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +LL  G + N  +  G   +HL+   GHS+VV+ L++  A+ +A    G T +  A+  G   IV IL   GA++N Q  +G TPL+          VK LL +GA+  +  E G T L  A ++G   V+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVV 181          

HSP 11 Score: 72.0182 bits (175), Expect = 1.351e-13
Identity = 55/180 (30.56%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            EG  + L AA   R  D+  +  LL    D++  N  G  +LH  S +G  E+  +L+ + A  +     G   +H++   G S +V +L+E  A  N    NG+TP+  AA + H  +VK L   GA+     +DG TPL           V +LL+N +   +R    L AL  A +K
Sbjct:   32 EGSASFLRAA---RAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKK 204          

HSP 12 Score: 68.9366 bits (167), Expect = 1.611e-12
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            + ++   LL+    +D + K   T LH  +  G  ++   L+ +GA  + +   G  P+H++    H    + LL + A  +    +  TP+  AA  GHV + K+L  + AD N +  +G TPLH          V++LL   A      E GLT L  A   GAI ++
Sbjct:  272 RTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIV 441          

HSP 13 Score: 61.2326 bits (147), Expect = 5.149e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
             L+ N  D+  K   G TA+H  + +    +A  L   GA  N + N G  P+H++   G   +VK L+E  A         +TP+  AA +GH   V+ L   GA  N Q   G TPL
Sbjct:  674 LLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 14 Score: 57.7658 bits (138), Expect = 5.598e-9
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            V   L NN  +++ K   G+T LH V+C  G   +   L+  GA+   +      P+H +   GH+  V+ LLE  A PN     G TP++ A   G+V++V+ L+
Sbjct:  704 VAQILYNNGAEINSKTNAGYTPLH-VACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 15 Score: 50.8322 bits (120), Expect = 1.105e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL      N +  NG   +  A+ +GH  +V+ L  + A ++   + G T LH  + +  ++ V IL++NGA+  +++  G T L  A ++   EV+K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of SMED30002664 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 97.8265 bits (242), Expect = 4.038e-22
Identity = 73/230 (31.74%), Postives = 103/230 (44.78%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T  GF    LA    Y  L+    L +     + EG N +  L  A     + V   LL N        K G+T LH  +     EIAS LL   A+PN +   G  P+HLS   GH ++  LL+E  +   A  NNG T +   A + HV + +IL + GA+IN +   G TPLH          VK L++NGAD   +     T L  A ++G    ++   + G S
Sbjct:  553 LTKKGFTPLHLAS--KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 89.7373 bits (221), Expect = 1.792e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            G   L  A  + + DV+  L+ N   +D + +   T LH  S  G  +I   LL  GAN N   RDN+   P+H++   G  +V  +LL+++A        G+TP+  A+  G++ +V++L  +G  ++ +GK+ +TPLH      +     +LL+NGA      + G T L  A +K  +E+      F
Sbjct:  458 GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 3 Score: 87.4261 bits (215), Expect = 9.682e-19
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            I  +KN   V+  LL     ++   + G T LH  +  G   I   LL +GANP+V    GE P+HL+     + VV++L+   AK +A      TP+  A+  G+  IV +L   GA+ N   +D  +PLH            ILLD+ AD  +  ++G T L  A + G +EV++   + G
Sbjct:  398 IACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG 580          

HSP 4 Score: 80.8777 bits (198), Expect = 1.846e-16
Identity = 72/232 (31.03%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  211 NLLF---AAIDSRKNDVIYFLL-------NNIIDL--------DYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN-----HCRIGNASI 831
            NLL    A IDSR  D++  L        + ++DL          K K G   LH  +     + A  LL   A   V D   +Y  P+H++   GH +V KLLL+ SA PN+   NG+TP+  A  K  + +V++L    A I    + GLTPLH   F  +   V  LL  GA+P +   RG T L  A      +V++     G   +    E         R+GN  I
Sbjct:  277 NLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDI 506          

HSP 5 Score: 79.7221 bits (195), Expect = 3.851e-16
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    + +V   LL++  D     K G+T LH  S  G  E+   LL +G   ++       P+H++    + KV  LLLE  A   A   NG+TP+  AA K  + I   L    AD N + + G TPLH            +L++NG+D   +   GLTA+  CA+E
Sbjct:  528 LHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQE 699          

HSP 6 Score: 78.5666 bits (192), Expect = 1.057e-15
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  127 AKCGDYDG-LKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            A+ GD +  L+   + + IN  N +  G N L  A     ++V+  L+     +D   + G TALH  S  G   I + L+  GAN NV+   G  P++++    H +VVK LL++ A    +  +G+TP+A A  +GH  +V +L    +    +GK  L  LH            +LL N  +P + ++ G T L  A   G
Sbjct:   41 ARAGDLEKVLELLRAGTDINTSNAN--GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYG 238          

HSP 7 Score: 77.7962 bits (190), Expect = 1.554e-15
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC 810
            E G   L  A+    + V+  LL N    D K K+   ALH  +       A+ LL    NP+V    G  P+H++   GH  V +LLLE  A  N    +  +P+  A   G   +  +L S+GA I+ + KD LTPLH    S     V +L+  GA    + + GL  L  A +   ++  +          D  + +  P++   HC
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC 369          

HSP 8 Score: 75.485 bits (184), Expect = 1.153e-14
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVI--YFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF------------LTFSKSAMG---------------------VKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I ++K+D      LL N  + D  +K G+T LH  +  G   +   LL KGAN N +      P+H++   G + +  LLL   A  ++   +  TP+  AA  GH  +V +L  +GA I+ + K+GL PLH             L + ++ +                       K+LLD  ADP  R   G T L  A +K  I+V++
Sbjct:  187 NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVE 409          

HSP 9 Score: 75.0998 bits (183), Expect = 1.359e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T LH  +  G   +A  LL + A+PN R   G  P+H++      KVV+LLL+Y A   AT  +G TP+  AA  G + IV  L  +GA+ + +   G TPLH    +     V++L+ NGA    +     T L  A   G  +++
Sbjct:  361 TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 10 Score: 72.4034 bits (176), Expect = 1.097e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  358 KLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +LL  G + N  +  G   +HL+   GHS+VV+ L++  A+ +A    G T +  A+  G   IV IL   GA++N Q  +G TPL+          VK LL +GA+  +  E G T L  A ++G   V+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVV 181          

HSP 11 Score: 72.0182 bits (175), Expect = 1.353e-13
Identity = 55/180 (30.56%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            EG  + L AA   R  D+  +  LL    D++  N  G  +LH  S +G  E+  +L+ + A  +     G   +H++   G S +V +L+E  A  N    NG+TP+  AA + H  +VK L   GA+     +DG TPL           V +LL+N +   +R    L AL  A +K
Sbjct:   32 EGSASFLRAA---RAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKK 204          

HSP 12 Score: 68.9366 bits (167), Expect = 1.614e-12
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            + ++   LL+    +D + K   T LH  +  G  ++   L+ +GA  + +   G  P+H++    H    + LL + A  +    +  TP+  AA  GHV + K+L  + AD N +  +G TPLH          V++LL   A      E GLT L  A   GAI ++
Sbjct:  272 RTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIV 441          

HSP 13 Score: 61.2326 bits (147), Expect = 5.158e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
             L+ N  D+  K   G TA+H  + +    +A  L   GA  N + N G  P+H++   G   +VK L+E  A         +TP+  AA +GH   V+ L   GA  N Q   G TPL
Sbjct:  674 LLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 14 Score: 57.7658 bits (138), Expect = 5.608e-9
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            V   L NN  +++ K   G+T LH V+C  G   +   L+  GA+   +      P+H +   GH+  V+ LLE  A PN     G TP++ A   G+V++V+ L+
Sbjct:  704 VAQILYNNGAEINSKTNAGYTPLH-VACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 15 Score: 50.8322 bits (120), Expect = 1.106e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL      N +  NG   +  A+ +GH  +V+ L  + A ++   + G T LH  + +  ++ V IL++NGA+  +++  G T L  A ++   EV+K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of SMED30002664 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 97.8265 bits (242), Expect = 4.038e-22
Identity = 73/230 (31.74%), Postives = 103/230 (44.78%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T  GF    LA    Y  L+    L +     + EG N +  L  A     + V   LL N        K G+T LH  +     EIAS LL   A+PN +   G  P+HLS   GH ++  LL+E  +   A  NNG T +   A + HV + +IL + GA+IN +   G TPLH          VK L++NGAD   +     T L  A ++G    ++   + G S
Sbjct:  553 LTKKGFTPLHLAS--KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 89.7373 bits (221), Expect = 1.792e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            G   L  A  + + DV+  L+ N   +D + +   T LH  S  G  +I   LL  GAN N   RDN+   P+H++   G  +V  +LL+++A        G+TP+  A+  G++ +V++L  +G  ++ +GK+ +TPLH      +     +LL+NGA      + G T L  A +K  +E+      F
Sbjct:  458 GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 3 Score: 87.4261 bits (215), Expect = 9.682e-19
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            I  +KN   V+  LL     ++   + G T LH  +  G   I   LL +GANP+V    GE P+HL+     + VV++L+   AK +A      TP+  A+  G+  IV +L   GA+ N   +D  +PLH            ILLD+ AD  +  ++G T L  A + G +EV++   + G
Sbjct:  398 IACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG 580          

HSP 4 Score: 80.8777 bits (198), Expect = 1.846e-16
Identity = 72/232 (31.03%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  211 NLLF---AAIDSRKNDVIYFLL-------NNIIDL--------DYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN-----HCRIGNASI 831
            NLL    A IDSR  D++  L        + ++DL          K K G   LH  +     + A  LL   A   V D   +Y  P+H++   GH +V KLLL+ SA PN+   NG+TP+  A  K  + +V++L    A I    + GLTPLH   F  +   V  LL  GA+P +   RG T L  A      +V++     G   +    E         R+GN  I
Sbjct:  277 NLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDI 506          

HSP 5 Score: 79.7221 bits (195), Expect = 3.851e-16
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    + +V   LL++  D     K G+T LH  S  G  E+   LL +G   ++       P+H++    + KV  LLLE  A   A   NG+TP+  AA K  + I   L    AD N + + G TPLH            +L++NG+D   +   GLTA+  CA+E
Sbjct:  528 LHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQE 699          

HSP 6 Score: 78.5666 bits (192), Expect = 1.057e-15
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  127 AKCGDYDG-LKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            A+ GD +  L+   + + IN  N +  G N L  A     ++V+  L+     +D   + G TALH  S  G   I + L+  GAN NV+   G  P++++    H +VVK LL++ A    +  +G+TP+A A  +GH  +V +L    +    +GK  L  LH            +LL N  +P + ++ G T L  A   G
Sbjct:   41 ARAGDLEKVLELLRAGTDINTSNAN--GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYG 238          

HSP 7 Score: 77.7962 bits (190), Expect = 1.554e-15
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC 810
            E G   L  A+    + V+  LL N    D K K+   ALH  +       A+ LL    NP+V    G  P+H++   GH  V +LLLE  A  N    +  +P+  A   G   +  +L S+GA I+ + KD LTPLH    S     V +L+  GA    + + GL  L  A +   ++  +          D  + +  P++   HC
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC 369          

HSP 8 Score: 75.485 bits (184), Expect = 1.153e-14
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVI--YFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF------------LTFSKSAMG---------------------VKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I ++K+D      LL N  + D  +K G+T LH  +  G   +   LL KGAN N +      P+H++   G + +  LLL   A  ++   +  TP+  AA  GH  +V +L  +GA I+ + K+GL PLH             L + ++ +                       K+LLD  ADP  R   G T L  A +K  I+V++
Sbjct:  187 NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVE 409          

HSP 9 Score: 75.0998 bits (183), Expect = 1.359e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T LH  +  G   +A  LL + A+PN R   G  P+H++      KVV+LLL+Y A   AT  +G TP+  AA  G + IV  L  +GA+ + +   G TPLH    +     V++L+ NGA    +     T L  A   G  +++
Sbjct:  361 TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 10 Score: 72.4034 bits (176), Expect = 1.097e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  358 KLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +LL  G + N  +  G   +HL+   GHS+VV+ L++  A+ +A    G T +  A+  G   IV IL   GA++N Q  +G TPL+          VK LL +GA+  +  E G T L  A ++G   V+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVV 181          

HSP 11 Score: 72.0182 bits (175), Expect = 1.353e-13
Identity = 55/180 (30.56%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            EG  + L AA   R  D+  +  LL    D++  N  G  +LH  S +G  E+  +L+ + A  +     G   +H++   G S +V +L+E  A  N    NG+TP+  AA + H  +VK L   GA+     +DG TPL           V +LL+N +   +R    L AL  A +K
Sbjct:   32 EGSASFLRAA---RAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKK 204          

HSP 12 Score: 68.9366 bits (167), Expect = 1.614e-12
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            + ++   LL+    +D + K   T LH  +  G  ++   L+ +GA  + +   G  P+H++    H    + LL + A  +    +  TP+  AA  GHV + K+L  + AD N +  +G TPLH          V++LL   A      E GLT L  A   GAI ++
Sbjct:  272 RTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIV 441          

HSP 13 Score: 61.2326 bits (147), Expect = 5.158e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
             L+ N  D+  K   G TA+H  + +    +A  L   GA  N + N G  P+H++   G   +VK L+E  A         +TP+  AA +GH   V+ L   GA  N Q   G TPL
Sbjct:  674 LLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 14 Score: 57.7658 bits (138), Expect = 5.608e-9
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            V   L NN  +++ K   G+T LH V+C  G   +   L+  GA+   +      P+H +   GH+  V+ LLE  A PN     G TP++ A   G+V++V+ L+
Sbjct:  704 VAQILYNNGAEINSKTNAGYTPLH-VACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 15 Score: 50.8322 bits (120), Expect = 1.106e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL      N +  NG   +  A+ +GH  +V+ L  + A ++   + G T LH  + +  ++ V IL++NGA+  +++  G T L  A ++   EV+K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of SMED30002664 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 97.8265 bits (242), Expect = 4.047e-22
Identity = 73/230 (31.74%), Postives = 103/230 (44.78%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T  GF    LA    Y  L+    L +     + EG N +  L  A     + V   LL N        K G+T LH  +     EIAS LL   A+PN +   G  P+HLS   GH ++  LL+E  +   A  NNG T +   A + HV + +IL + GA+IN +   G TPLH          VK L++NGAD   +     T L  A ++G    ++   + G S
Sbjct:  553 LTKKGFTPLHLAS--KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 89.7373 bits (221), Expect = 1.796e-19
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            G   L  A  + + DV+  L+ N   +D + +   T LH  S  G  +I   LL  GAN N   RDN+   P+H++   G  +V  +LL+++A        G+TP+  A+  G++ +V++L  +G  ++ +GK+ +TPLH      +     +LL+NGA      + G T L  A +K  +E+      F
Sbjct:  458 GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 3 Score: 87.4261 bits (215), Expect = 9.701e-19
Identity = 58/183 (31.69%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            I  +KN   V+  LL     ++   + G T LH  +  G   I   LL +GANP+V    GE P+HL+     + VV++L+   AK +A      TP+  A+  G+  IV +L   GA+ N   +D  +PLH            ILLD+ AD  +  ++G T L  A + G +EV++   + G
Sbjct:  398 IACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG 580          

HSP 4 Score: 80.8777 bits (198), Expect = 1.850e-16
Identity = 72/232 (31.03%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  211 NLLF---AAIDSRKNDVIYFLL-------NNIIDL--------DYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN-----HCRIGNASI 831
            NLL    A IDSR  D++  L        + ++DL          K K G   LH  +     + A  LL   A   V D   +Y  P+H++   GH +V KLLL+ SA PN+   NG+TP+  A  K  + +V++L    A I    + GLTPLH   F  +   V  LL  GA+P +   RG T L  A      +V++     G   +    E         R+GN  I
Sbjct:  277 NLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAP--VDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDI 506          

HSP 5 Score: 79.7221 bits (195), Expect = 3.859e-16
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    + +V   LL++  D     K G+T LH  S  G  E+   LL +G   ++       P+H++    + KV  LLLE  A   A   NG+TP+  AA K  + I   L    AD N + + G TPLH            +L++NG+D   +   GLTA+  CA+E
Sbjct:  528 LHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQE 699          

HSP 6 Score: 78.5666 bits (192), Expect = 1.059e-15
Identity = 60/204 (29.41%), Postives = 96/204 (47.06%), Query Frame = 1
Query:  127 AKCGDYDG-LKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            A+ GD +  L+   + + IN  N +  G N L  A     ++V+  L+     +D   + G TALH  S  G   I + L+  GAN NV+   G  P++++    H +VVK LL++ A    +  +G+TP+A A  +GH  +V +L    +    +GK  L  LH            +LL N  +P + ++ G T L  A   G
Sbjct:   41 ARAGDLEKVLELLRAGTDINTSNAN--GLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYG 238          

HSP 7 Score: 77.7962 bits (190), Expect = 1.557e-15
Identity = 60/211 (28.44%), Postives = 91/211 (43.13%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC 810
            E G   L  A+    + V+  LL N    D K K+   ALH  +       A+ LL    NP+V    G  P+H++   GH  V +LLLE  A  N    +  +P+  A   G   +  +L S+GA I+ + KD LTPLH    S     V +L+  GA    + + GL  L  A +   ++  +          D  + +  P++   HC
Sbjct:  163 EDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC 369          

HSP 8 Score: 75.485 bits (184), Expect = 1.155e-14
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVI--YFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF------------LTFSKSAMG---------------------VKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            N+ +G   L    I ++K+D      LL N  + D  +K G+T LH  +  G   +   LL KGAN N +      P+H++   G + +  LLL   A  ++   +  TP+  AA  GH  +V +L  +GA I+ + K+GL PLH             L + ++ +                       K+LLD  ADP  R   G T L  A +K  I+V++
Sbjct:  187 NDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVE 409          

HSP 9 Score: 75.0998 bits (183), Expect = 1.362e-14
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T LH  +  G   +A  LL + A+PN R   G  P+H++      KVV+LLL+Y A   AT  +G TP+  AA  G + IV  L  +GA+ + +   G TPLH    +     V++L+ NGA    +     T L  A   G  +++
Sbjct:  361 TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 10 Score: 72.4034 bits (176), Expect = 1.099e-13
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 1
Query:  358 KLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +LL  G + N  +  G   +HL+   GHS+VV+ L++  A+ +A    G T +  A+  G   IV IL   GA++N Q  +G TPL+          VK LL +GA+  +  E G T L  A ++G   V+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVV 181          

HSP 11 Score: 72.0182 bits (175), Expect = 1.356e-13
Identity = 55/180 (30.56%), Postives = 84/180 (46.67%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            EG  + L AA   R  D+  +  LL    D++  N  G  +LH  S +G  E+  +L+ + A  +     G   +H++   G S +V +L+E  A  N    NG+TP+  AA + H  +VK L   GA+     +DG TPL           V +LL+N +   +R    L AL  A +K
Sbjct:   32 EGSASFLRAA---RAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKK 204          

HSP 12 Score: 68.9366 bits (167), Expect = 1.617e-12
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            + ++   LL+    +D + K   T LH  +  G  ++   L+ +GA  + +   G  P+H++    H    + LL + A  +    +  TP+  AA  GHV + K+L  + AD N +  +G TPLH          V++LL   A      E GLT L  A   GAI ++
Sbjct:  272 RTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIV 441          

HSP 13 Score: 61.2326 bits (147), Expect = 5.166e-10
Identity = 39/119 (32.77%), Postives = 55/119 (46.22%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
             L+ N  D+  K   G TA+H  + +    +A  L   GA  N + N G  P+H++   G   +VK L+E  A         +TP+  AA +GH   V+ L   GA  N Q   G TPL
Sbjct:  674 LLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 14 Score: 57.7658 bits (138), Expect = 5.616e-9
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            V   L NN  +++ K   G+T LH V+C  G   +   L+  GA+   +      P+H +   GH+  V+ LLE  A PN     G TP++ A   G+V++V+ L+
Sbjct:  704 VAQILYNNGAEINSKTNAGYTPLH-VACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 15 Score: 50.8322 bits (120), Expect = 1.108e-6
Identity = 28/98 (28.57%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL      N +  NG   +  A+ +GH  +V+ L  + A ++   + G T LH  + +  ++ V IL++NGA+  +++  G T L  A ++   EV+K
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK 149          
BLAST of SMED30002664 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 91.6633 bits (226), Expect = 6.088e-20
Identity = 62/189 (32.80%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + D+I  LL +   +D   + G T LH  S  G   I   LL  GA  N + N     +H++   G   +V++LLE  A+ NA    G+TP+  A   G   +V+IL   GA I+FQGK+ +TPLH  T   +   V++LL NG+ P +    G  A+  A +K  +E+       G
Sbjct:  465 GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHG 652          

HSP 2 Score: 82.8037 bits (203), Expect = 4.770e-17
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            K +V+  LL N   +D++ K   T LH  +      I   LL  G++PN+    G+  IH++    + ++   LL++ A  N    +G++P+  AA  G+V +V++L   G  I+   K+GLTPLH        +  +ILL++GA+   R   G T L  A   G ++++K F
Sbjct:  575 KQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 3 Score: 80.8777 bits (198), Expect = 2.389e-16
Identity = 66/196 (33.67%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +KI+    D  G   L  A  S   +VI  LL     +  K K G +ALH ++  G  + A+ LL     P V +   +Y   +H++   GH KV KLLL+Y A PNA   NG+TP+  A  K  + +V++L   GA+I    + GLTPLH  +F      V  LL + A   +   RG T L  A      ++I+
Sbjct:  291 AKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH-MAAQGEHDEAAHLLLDNKAP-VDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIR 482          

HSP 4 Score: 79.7221 bits (195), Expect = 5.414e-16
Identity = 52/171 (30.41%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            ++   LL +  D++  +K G++ LH  +  G  ++   LL  G       N G  P+H++   GH  V ++LLE+ A  +    NG+TP+  AA  GH+ +VK      ADI      G TPLH        M + +LL + A+P    + G TAL  A   G + V+++ 
Sbjct:  643 EIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN-GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 78.9518 bits (193), Expect = 8.808e-16
Identity = 63/212 (29.72%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  112 KIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K+     CG+         +S IN CN + G N L  AA D    D+   LL   I +D   K G TALH  S  G  ++ ++L+   AN NV+   G  P++++    H    + LL   A P+ +  +G+TP+A A  +GH  IV +L       + +GK  L  LH           K+LL +  +  I ++ G T L  A   G +++
Sbjct:   53 KVMDFLDCGE---------ISDINSCNAN-GLNALHLAAKDGYV-DICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDI 249          

HSP 6 Score: 76.2554 bits (186), Expect = 6.739e-15
Identity = 51/178 (28.65%), Postives = 87/178 (48.88%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            ++  L+ +  ++    + G T LH  S  G   I   LL   A+ ++    GE P+HL+     + ++++LL  SAK +A    G TP+  A+  G++ I+ +L   GA+IN Q  D  + LH          V++LL+NGA+     ++G T L  A + G   V++     G S +
Sbjct:  414 MVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASID 590          

HSP 7 Score: 73.1738 bits (178), Expect = 6.612e-14
Identity = 58/189 (30.69%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G + L  A     ++  + LL+N   +D       TALH  +  G  ++A  LL   ANPN R   G  P+H++      K+V+LL+++ A   AT  +G TP+  A+  G + IV  L    A  +     G TPLH    +  A  ++ILL +     I  E G T L  A   G I +I      G
Sbjct:  333 GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 8 Score: 73.1738 bits (178), Expect = 8.080e-14
Identity = 62/195 (31.79%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            N+  G   L    I ++KNDV     LL +  + D  +K G+T LH  +  G  +IA+ LL   A+ N        P+H++   G   +  LLL   AK +A   +G TP+  A+  GHV ++K L  + A I  + K+GL+ LH     +      +LLDN A         LTAL  A   G ++V K   D+
Sbjct:  194 NDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY 388          

HSP 9 Score: 71.633 bits (174), Expect = 2.615e-13
Identity = 57/200 (28.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            ++IN  +ND+  + L  AA + ++N ++  LL N  + +   K G+T LH     G   +   LL  GA+ + +      P+H++    +  +V+LLL+  + PN    NG   I  A  K ++ I   L   GAD+N   K G +PLH      +   V++LL+ G       + GLT L  A ++G + V +   + G
Sbjct:  521 AEINAQSNDKY-SALHIAAKEGQEN-IVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHG 717          

HSP 10 Score: 70.8626 bits (172), Expect = 4.047e-13
Identity = 56/208 (26.92%), Postives = 90/208 (43.27%), Query Frame = 1
Query:  106 GFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            GF    +A   ++D        +  N   + E G   L  A+    + ++  LL N    D + K+   ALH  +       A  LL    N ++    G  P+H++   G+  +  LLL   A  N    +  TP+  A   G +++  +L  +GA I+   +DGLTPLH  + S     +K LL   A  L + + GL+AL  A +
Sbjct:  139 GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQ 342          

HSP 11 Score: 68.9366 bits (167), Expect = 1.594e-12
Identity = 54/176 (30.68%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            D+   LLNN  D++Y  K   T LH V+C  G   + + LL +GA  +     G  P+H +  +GH +V+K LL+ +A       NG + +  AA   H     +L    A ++    D LT LH           K+LLD  A+P  R   G T L  A +K  I++++     G
Sbjct:  248 DIATLLLNNKADVNYVAKHNITPLH-VACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHG 422          

HSP 12 Score: 57.7658 bits (138), Expect = 8.177e-9
Identity = 41/158 (25.95%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   94 MTSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            ++ SGF    LA + G+ D ++       I+    +  G   L  A       V   LL +  ++  + + G+T LH  +  G  ++    +   A+  +  N G  P+H +   GH  ++ LLL + A PNA   +G T +  A++ G+VT+++ LK
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN--GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          
BLAST of SMED30002664 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 91.6633 bits (226), Expect = 6.088e-20
Identity = 62/189 (32.80%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + D+I  LL +   +D   + G T LH  S  G   I   LL  GA  N + N     +H++   G   +V++LLE  A+ NA    G+TP+  A   G   +V+IL   GA I+FQGK+ +TPLH  T   +   V++LL NG+ P +    G  A+  A +K  +E+       G
Sbjct:  465 GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHG 652          

HSP 2 Score: 82.8037 bits (203), Expect = 4.770e-17
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            K +V+  LL N   +D++ K   T LH  +      I   LL  G++PN+    G+  IH++    + ++   LL++ A  N    +G++P+  AA  G+V +V++L   G  I+   K+GLTPLH        +  +ILL++GA+   R   G T L  A   G ++++K F
Sbjct:  575 KQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 3 Score: 80.8777 bits (198), Expect = 2.389e-16
Identity = 66/196 (33.67%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +KI+    D  G   L  A  S   +VI  LL     +  K K G +ALH ++  G  + A+ LL     P V +   +Y   +H++   GH KV KLLL+Y A PNA   NG+TP+  A  K  + +V++L   GA+I    + GLTPLH  +F      V  LL + A   +   RG T L  A      ++I+
Sbjct:  291 AKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH-MAAQGEHDEAAHLLLDNKAP-VDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIR 482          

HSP 4 Score: 79.7221 bits (195), Expect = 5.414e-16
Identity = 52/171 (30.41%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            ++   LL +  D++  +K G++ LH  +  G  ++   LL  G       N G  P+H++   GH  V ++LLE+ A  +    NG+TP+  AA  GH+ +VK      ADI      G TPLH        M + +LL + A+P    + G TAL  A   G + V+++ 
Sbjct:  643 EIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN-GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 78.9518 bits (193), Expect = 8.808e-16
Identity = 63/212 (29.72%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  112 KIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K+     CG+         +S IN CN + G N L  AA D    D+   LL   I +D   K G TALH  S  G  ++ ++L+   AN NV+   G  P++++    H    + LL   A P+ +  +G+TP+A A  +GH  IV +L       + +GK  L  LH           K+LL +  +  I ++ G T L  A   G +++
Sbjct:   53 KVMDFLDCGE---------ISDINSCNAN-GLNALHLAAKDGYV-DICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDI 249          

HSP 6 Score: 76.2554 bits (186), Expect = 6.739e-15
Identity = 51/178 (28.65%), Postives = 87/178 (48.88%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            ++  L+ +  ++    + G T LH  S  G   I   LL   A+ ++    GE P+HL+     + ++++LL  SAK +A    G TP+  A+  G++ I+ +L   GA+IN Q  D  + LH          V++LL+NGA+     ++G T L  A + G   V++     G S +
Sbjct:  414 MVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASID 590          

HSP 7 Score: 73.1738 bits (178), Expect = 6.612e-14
Identity = 58/189 (30.69%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G + L  A     ++  + LL+N   +D       TALH  +  G  ++A  LL   ANPN R   G  P+H++      K+V+LL+++ A   AT  +G TP+  A+  G + IV  L    A  +     G TPLH    +  A  ++ILL +     I  E G T L  A   G I +I      G
Sbjct:  333 GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 8 Score: 73.1738 bits (178), Expect = 8.080e-14
Identity = 62/195 (31.79%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            N+  G   L    I ++KNDV     LL +  + D  +K G+T LH  +  G  +IA+ LL   A+ N        P+H++   G   +  LLL   AK +A   +G TP+  A+  GHV ++K L  + A I  + K+GL+ LH     +      +LLDN A         LTAL  A   G ++V K   D+
Sbjct:  194 NDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY 388          

HSP 9 Score: 71.633 bits (174), Expect = 2.615e-13
Identity = 57/200 (28.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            ++IN  +ND+  + L  AA + ++N ++  LL N  + +   K G+T LH     G   +   LL  GA+ + +      P+H++    +  +V+LLL+  + PN    NG   I  A  K ++ I   L   GAD+N   K G +PLH      +   V++LL+ G       + GLT L  A ++G + V +   + G
Sbjct:  521 AEINAQSNDKY-SALHIAAKEGQEN-IVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHG 717          

HSP 10 Score: 70.8626 bits (172), Expect = 4.047e-13
Identity = 56/208 (26.92%), Postives = 90/208 (43.27%), Query Frame = 1
Query:  106 GFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            GF    +A   ++D        +  N   + E G   L  A+    + ++  LL N    D + K+   ALH  +       A  LL    N ++    G  P+H++   G+  +  LLL   A  N    +  TP+  A   G +++  +L  +GA I+   +DGLTPLH  + S     +K LL   A  L + + GL+AL  A +
Sbjct:  139 GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQ 342          

HSP 11 Score: 68.9366 bits (167), Expect = 1.594e-12
Identity = 54/176 (30.68%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            D+   LLNN  D++Y  K   T LH V+C  G   + + LL +GA  +     G  P+H +  +GH +V+K LL+ +A       NG + +  AA   H     +L    A ++    D LT LH           K+LLD  A+P  R   G T L  A +K  I++++     G
Sbjct:  248 DIATLLLNNKADVNYVAKHNITPLH-VACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHG 422          

HSP 12 Score: 57.7658 bits (138), Expect = 8.177e-9
Identity = 41/158 (25.95%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   94 MTSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            ++ SGF    LA + G+ D ++       I+    +  G   L  A       V   LL +  ++  + + G+T LH  +  G  ++    +   A+  +  N G  P+H +   GH  ++ LLL + A PNA   +G T +  A++ G+VT+++ LK
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN--GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          
BLAST of SMED30002664 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 91.6633 bits (226), Expect = 6.088e-20
Identity = 62/189 (32.80%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + D+I  LL +   +D   + G T LH  S  G   I   LL  GA  N + N     +H++   G   +V++LLE  A+ NA    G+TP+  A   G   +V+IL   GA I+FQGK+ +TPLH  T   +   V++LL NG+ P +    G  A+  A +K  +E+       G
Sbjct:  465 GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHG 652          

HSP 2 Score: 82.8037 bits (203), Expect = 4.770e-17
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            K +V+  LL N   +D++ K   T LH  +      I   LL  G++PN+    G+  IH++    + ++   LL++ A  N    +G++P+  AA  G+V +V++L   G  I+   K+GLTPLH        +  +ILL++GA+   R   G T L  A   G ++++K F
Sbjct:  575 KQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 3 Score: 80.8777 bits (198), Expect = 2.389e-16
Identity = 66/196 (33.67%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +KI+    D  G   L  A  S   +VI  LL     +  K K G +ALH ++  G  + A+ LL     P V +   +Y   +H++   GH KV KLLL+Y A PNA   NG+TP+  A  K  + +V++L   GA+I    + GLTPLH  +F      V  LL + A   +   RG T L  A      ++I+
Sbjct:  291 AKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH-MAAQGEHDEAAHLLLDNKAP-VDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIR 482          

HSP 4 Score: 79.7221 bits (195), Expect = 5.414e-16
Identity = 52/171 (30.41%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            ++   LL +  D++  +K G++ LH  +  G  ++   LL  G       N G  P+H++   GH  V ++LLE+ A  +    NG+TP+  AA  GH+ +VK      ADI      G TPLH        M + +LL + A+P    + G TAL  A   G + V+++ 
Sbjct:  643 EIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN-GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 78.9518 bits (193), Expect = 8.808e-16
Identity = 63/212 (29.72%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  112 KIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K+     CG+         +S IN CN + G N L  AA D    D+   LL   I +D   K G TALH  S  G  ++ ++L+   AN NV+   G  P++++    H    + LL   A P+ +  +G+TP+A A  +GH  IV +L       + +GK  L  LH           K+LL +  +  I ++ G T L  A   G +++
Sbjct:   53 KVMDFLDCGE---------ISDINSCNAN-GLNALHLAAKDGYV-DICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDI 249          

HSP 6 Score: 76.2554 bits (186), Expect = 6.739e-15
Identity = 51/178 (28.65%), Postives = 87/178 (48.88%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            ++  L+ +  ++    + G T LH  S  G   I   LL   A+ ++    GE P+HL+     + ++++LL  SAK +A    G TP+  A+  G++ I+ +L   GA+IN Q  D  + LH          V++LL+NGA+     ++G T L  A + G   V++     G S +
Sbjct:  414 MVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASID 590          

HSP 7 Score: 73.1738 bits (178), Expect = 6.612e-14
Identity = 58/189 (30.69%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G + L  A     ++  + LL+N   +D       TALH  +  G  ++A  LL   ANPN R   G  P+H++      K+V+LL+++ A   AT  +G TP+  A+  G + IV  L    A  +     G TPLH    +  A  ++ILL +     I  E G T L  A   G I +I      G
Sbjct:  333 GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 8 Score: 73.1738 bits (178), Expect = 8.080e-14
Identity = 62/195 (31.79%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            N+  G   L    I ++KNDV     LL +  + D  +K G+T LH  +  G  +IA+ LL   A+ N        P+H++   G   +  LLL   AK +A   +G TP+  A+  GHV ++K L  + A I  + K+GL+ LH     +      +LLDN A         LTAL  A   G ++V K   D+
Sbjct:  194 NDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY 388          

HSP 9 Score: 71.633 bits (174), Expect = 2.615e-13
Identity = 57/200 (28.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            ++IN  +ND+  + L  AA + ++N ++  LL N  + +   K G+T LH     G   +   LL  GA+ + +      P+H++    +  +V+LLL+  + PN    NG   I  A  K ++ I   L   GAD+N   K G +PLH      +   V++LL+ G       + GLT L  A ++G + V +   + G
Sbjct:  521 AEINAQSNDKY-SALHIAAKEGQEN-IVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHG 717          

HSP 10 Score: 70.8626 bits (172), Expect = 4.047e-13
Identity = 56/208 (26.92%), Postives = 90/208 (43.27%), Query Frame = 1
Query:  106 GFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            GF    +A   ++D        +  N   + E G   L  A+    + ++  LL N    D + K+   ALH  +       A  LL    N ++    G  P+H++   G+  +  LLL   A  N    +  TP+  A   G +++  +L  +GA I+   +DGLTPLH  + S     +K LL   A  L + + GL+AL  A +
Sbjct:  139 GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQ 342          

HSP 11 Score: 68.9366 bits (167), Expect = 1.594e-12
Identity = 54/176 (30.68%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            D+   LLNN  D++Y  K   T LH V+C  G   + + LL +GA  +     G  P+H +  +GH +V+K LL+ +A       NG + +  AA   H     +L    A ++    D LT LH           K+LLD  A+P  R   G T L  A +K  I++++     G
Sbjct:  248 DIATLLLNNKADVNYVAKHNITPLH-VACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHG 422          

HSP 12 Score: 57.7658 bits (138), Expect = 8.177e-9
Identity = 41/158 (25.95%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   94 MTSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            ++ SGF    LA + G+ D ++       I+    +  G   L  A       V   LL +  ++  + + G+T LH  +  G  ++    +   A+  +  N G  P+H +   GH  ++ LLL + A PNA   +G T +  A++ G+VT+++ LK
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN--GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          
BLAST of SMED30002664 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 91.6633 bits (226), Expect = 6.088e-20
Identity = 62/189 (32.80%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + D+I  LL +   +D   + G T LH  S  G   I   LL  GA  N + N     +H++   G   +V++LLE  A+ NA    G+TP+  A   G   +V+IL   GA I+FQGK+ +TPLH  T   +   V++LL NG+ P +    G  A+  A +K  +E+       G
Sbjct:  465 GETPLHLAARANQADIIRILLRSA-KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHG 652          

HSP 2 Score: 82.8037 bits (203), Expect = 4.770e-17
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            K +V+  LL N   +D++ K   T LH  +      I   LL  G++PN+    G+  IH++    + ++   LL++ A  N    +G++P+  AA  G+V +V++L   G  I+   K+GLTPLH        +  +ILL++GA+   R   G T L  A   G ++++K F
Sbjct:  575 KQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFF 746          

HSP 3 Score: 80.8777 bits (198), Expect = 2.389e-16
Identity = 66/196 (33.67%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +KI+    D  G   L  A  S   +VI  LL     +  K K G +ALH ++  G  + A+ LL     P V +   +Y   +H++   GH KV KLLL+Y A PNA   NG+TP+  A  K  + +V++L   GA+I    + GLTPLH  +F      V  LL + A   +   RG T L  A      ++I+
Sbjct:  291 AKIDAATRD--GLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALH-MAAQGEHDEAAHLLLDNKAP-VDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIR 482          

HSP 4 Score: 79.7221 bits (195), Expect = 5.414e-16
Identity = 52/171 (30.41%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            ++   LL +  D++  +K G++ LH  +  G  ++   LL  G       N G  P+H++   GH  V ++LLE+ A  +    NG+TP+  AA  GH+ +VK      ADI      G TPLH        M + +LL + A+P    + G TAL  A   G + V+++ 
Sbjct:  643 EIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN-GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 5 Score: 78.9518 bits (193), Expect = 8.808e-16
Identity = 63/212 (29.72%), Postives = 97/212 (45.75%), Query Frame = 1
Query:  112 KIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K+     CG+         +S IN CN + G N L  AA D    D+   LL   I +D   K G TALH  S  G  ++ ++L+   AN NV+   G  P++++    H    + LL   A P+ +  +G+TP+A A  +GH  IV +L       + +GK  L  LH           K+LL +  +  I ++ G T L  A   G +++
Sbjct:   53 KVMDFLDCGE---------ISDINSCNAN-GLNALHLAAKDGYV-DICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDI 249          

HSP 6 Score: 76.2554 bits (186), Expect = 6.739e-15
Identity = 51/178 (28.65%), Postives = 87/178 (48.88%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            ++  L+ +  ++    + G T LH  S  G   I   LL   A+ ++    GE P+HL+     + ++++LL  SAK +A    G TP+  A+  G++ I+ +L   GA+IN Q  D  + LH          V++LL+NGA+     ++G T L  A + G   V++     G S +
Sbjct:  414 MVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR-SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASID 590          

HSP 7 Score: 73.1738 bits (178), Expect = 6.612e-14
Identity = 58/189 (30.69%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G + L  A     ++  + LL+N   +D       TALH  +  G  ++A  LL   ANPN R   G  P+H++      K+V+LL+++ A   AT  +G TP+  A+  G + IV  L    A  +     G TPLH    +  A  ++ILL +     I  E G T L  A   G I +I      G
Sbjct:  333 GLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHG 520          

HSP 8 Score: 73.1738 bits (178), Expect = 8.080e-14
Identity = 62/195 (31.79%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            N+  G   L    I ++KNDV     LL +  + D  +K G+T LH  +  G  +IA+ LL   A+ N        P+H++   G   +  LLL   AK +A   +G TP+  A+  GHV ++K L  + A I  + K+GL+ LH     +      +LLDN A         LTAL  A   G ++V K   D+
Sbjct:  194 NDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY 388          

HSP 9 Score: 71.633 bits (174), Expect = 2.615e-13
Identity = 57/200 (28.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            ++IN  +ND+  + L  AA + ++N ++  LL N  + +   K G+T LH     G   +   LL  GA+ + +      P+H++    +  +V+LLL+  + PN    NG   I  A  K ++ I   L   GAD+N   K G +PLH      +   V++LL+ G       + GLT L  A ++G + V +   + G
Sbjct:  521 AEINAQSNDKY-SALHIAAKEGQEN-IVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAA-KNGLTPLHVAAQEGHVLVSQILLEHG 717          

HSP 10 Score: 70.8626 bits (172), Expect = 4.047e-13
Identity = 56/208 (26.92%), Postives = 90/208 (43.27%), Query Frame = 1
Query:  106 GFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            GF    +A   ++D        +  N   + E G   L  A+    + ++  LL N    D + K+   ALH  +       A  LL    N ++    G  P+H++   G+  +  LLL   A  N    +  TP+  A   G +++  +L  +GA I+   +DGLTPLH  + S     +K LL   A  L + + GL+AL  A +
Sbjct:  139 GFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQ 342          

HSP 11 Score: 68.9366 bits (167), Expect = 1.594e-12
Identity = 54/176 (30.68%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            D+   LLNN  D++Y  K   T LH V+C  G   + + LL +GA  +     G  P+H +  +GH +V+K LL+ +A       NG + +  AA   H     +L    A ++    D LT LH           K+LLD  A+P  R   G T L  A +K  I++++     G
Sbjct:  248 DIATLLLNNKADVNYVAKHNITPLH-VACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHG 422          

HSP 12 Score: 57.7658 bits (138), Expect = 8.177e-9
Identity = 41/158 (25.95%), Postives = 74/158 (46.84%), Query Frame = 1
Query:   94 MTSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            ++ SGF    LA + G+ D ++       I+    +  G   L  A       V   LL +  ++  + + G+T LH  +  G  ++    +   A+  +  N G  P+H +   GH  ++ LLL + A PNA   +G T +  A++ G+VT+++ LK
Sbjct:  658 ISKSGFSPLHLAAQGGNVDMVQLLLEYGVISAAAKN--GLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK 813          
BLAST of SMED30002664 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 90.5077 bits (223), Expect = 1.227e-19
Identity = 63/208 (30.29%), Postives = 92/208 (44.23%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTP-----------------------------LHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            +G  + L AA       V+  L NNI D++  N  G  ALH  S DG   + S+LL +GA  +     G   +H++   G  +VVKLLLE++A  N    NG+TP+  AA + H  +V++L S GA+ +   +DG TP                             LH            +LLDN  +P + ++ G T L  A   G
Sbjct:   10 DGNTSFLRAARAGNLERVLEHLKNNI-DINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYG 216          

HSP 2 Score: 89.3521 bits (220), Expect = 3.132e-19
Identity = 55/189 (29.10%), Postives = 89/189 (47.09%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + D+I  LL N   +D + +   T LH  S  G  +I   LL  GA  +         +H++   G  +V  +L+E  A  +A    G+TP+   A  GH+ + ++L  K AD++ QGK+G+TPLH      +     +LL+ GA P    + G T L  A  K  +++     ++G
Sbjct:  436 GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYG 624          

HSP 3 Score: 88.5817 bits (218), Expect = 5.216e-19
Identity = 52/151 (34.44%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K G T LH  +     +IA+ LL  GA  N     G  P+HLS   GH+++  LL+E+ A  N    NG TP+   A + +V + +IL+  GA+I+   K G TPLH  +    A  V+ LL NGA+       G T L    ++G   ++
Sbjct:  599 KNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIV 749          

HSP 4 Score: 86.2705 bits (212), Expect = 3.031e-18
Identity = 52/168 (30.95%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            V   LL    D+D + K G T LH        ++A  LL KGA+P+     G  P+H++       +   LLEY A  NA    G+TP+  ++ +GH  I  +L    A +N   K+GLTP+H      +    +IL  NGA+  +  + G T L  A   G   +++
Sbjct:  550 VAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVR 717          

HSP 5 Score: 84.3445 bits (207), Expect = 1.201e-17
Identity = 62/181 (34.25%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  229 IDSRKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            I ++K+DV     LL+N  + D  +K G+T LH  S  G   IA+ L+ KGA+ N        P+H++   G + +V LLLE      A   +G TP+  AA  GH  +V +L  +GA I+ + K+GL PLH     +     +ILL + A         LTAL  A   G + V K   D
Sbjct:  178 IAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD 358          

HSP 6 Score: 83.1889 bits (204), Expect = 3.052e-17
Identity = 58/219 (26.48%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAK-----------------------------PNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLT-FSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            GN  L  A  + + +V+  LL +   ++ +++ G+T L+  + +    +   LL+ GAN ++    G  P+ +++  GH KVV +LLE   +                             P+ T  +G+TP+  A+  G+  I  +L  KGAD+N+  K  ++PLH    + K+ M V +LL+ G +   +   GLT L CA   G  +V+    + G
Sbjct:   77 GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM-VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERG 294          

HSP 7 Score: 80.8777 bits (198), Expect = 2.254e-16
Identity = 57/172 (33.14%), Postives = 85/172 (49.42%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE-CAEE 729
            L  A    +++V   L+ N   LD   K G+T LH  +  G  ++A  LL K A+ + +   G  P+H++    + +V  LLLE  A P+AT  NG TP+  AA K  + I   L   GA  N + K G TPLH  +    A    +L+++ A      + GLT +  CA+E
Sbjct:  506 LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQE 677          

HSP 8 Score: 80.4925 bits (197), Expect = 2.889e-16
Identity = 54/168 (32.14%), Postives = 86/168 (51.19%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGV-KILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            D++  LL +   +D   K  +TALH  + +G  E+A+ L+  GA  +     G  P+HL+   GH KV +LLL+  A  +A   NG TP+  A    +  +  +L  KGA  +   K+G TPLH +   K+ M +   LL+ GA     ++ G T L  + ++G  E+
Sbjct:  483 DIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLH-IAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI 649          

HSP 9 Score: 78.1814 bits (191), Expect = 1.524e-15
Identity = 55/177 (31.07%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            ++   L+    D++Y  K   + LH  +  G   + S LL KG N   +   G  P+H +  +GH +VV +LLE  A  +A   NG  P+  AA   HV   +IL    A ++    D LT LH           K+LLD  AD   R   G T L  A +K  ++V++     G S
Sbjct:  219 NIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGAS 395          

HSP 10 Score: 76.6406 bits (187), Expect = 4.536e-15
Identity = 70/284 (24.65%), Postives = 119/284 (41.90%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINE--------------CNHCRI--------GNASIR-LPCYHNLCMACYHNR 879
            + +GF    +A   ++D +      +  N     E G   L  A+    + V+  LL +    D + K+   ALH  +     + A+ LL    NP+V    G  P+H++   G+  +  LL++  A  N +  +  +P+  AA  G   +V +L  KG +I  + +DGLTPLH    S     V +LL+ GA    + + GL  L  A +   ++  +      +    P++E              C H R+         +A+ R L  +  L +AC  NR
Sbjct:  107 SQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL----LYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNR 382          

HSP 11 Score: 76.6406 bits (187), Expect = 5.017e-15
Identity = 48/170 (28.24%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K +++  LL    +++ K + G T LH  +  G  ++   LL +GA  + +   G  P+H++    H    ++LL + A  +    +  T +  AA  GHV + K+L  + AD N +  +G TPLH          V++LL +GA      E GLT L  A   G + ++
Sbjct:  250 KTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIV 419          

HSP 12 Score: 71.633 bits (174), Expect = 2.387e-13
Identity = 51/175 (29.14%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  229 IDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            I  +KN   V+  LL +   +    + G T LH  +  G   I   LL   A+P+V    GE P+HL+     + ++++LL   A+ +A      TP+  A+  G+V IV +L   GA ++   KD  T LH            +L++NGA      ++G T L    + G I+V
Sbjct:  376 IACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKV 550          

HSP 13 Score: 70.4774 bits (171), Expect = 5.511e-13
Identity = 49/147 (33.33%), Postives = 70/147 (47.62%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            TALH  +  G   +A  LL + A+ N R   G  P+H++      KVV+LLL + A  +AT  +G TP+  AA  G + IV  L    A  +     G TPLH    +     ++ILL NGA    R     T L  A   G ++++
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIV 485          

HSP 14 Score: 67.3958 bits (163), Expect = 5.670e-12
Identity = 47/166 (28.31%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            V   LL+   D + +   G+T LH        ++   LL  GA+ +     G  P+H++ + G   +V  LL++ A P+     G TP+  AA      I++IL   GA ++ + ++  TPLH  +   +   V +LL +GA      +   TAL  A ++G  EV
Sbjct:  352 VAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEV 517          

HSP 15 Score: 66.2402 bits (160), Expect = 1.223e-11
Identity = 37/107 (34.58%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKS 567
            +V   L  N  ++D   K G+T LH  S  G   +   LL  GAN +   + G  P+H +   GH  +V LLLE+ A  NA   NG TP+  A   G+++++  LK+
Sbjct:  681 NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKT 787          

HSP 16 Score: 65.4698 bits (158), Expect = 2.387e-11
Identity = 44/159 (27.67%), Postives = 75/159 (47.17%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            +++ +LL +    D     G T LH  +     +I   LL  GA  + R    + P+H++   G+  +V LLL++ A+ +AT  + +T +  AA +G   +  +L   GA ++   K G TPLH           ++LL   AD   + + G+T L  A
Sbjct:  417 NIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA 575          

HSP 17 Score: 62.3882 bits (150), Expect = 2.055e-10
Identity = 36/120 (30.00%), Postives = 62/120 (51.67%), Query Frame = 1
Query:  259 FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLH 618
             L+ +   +++  K G T +H  + +    +A  L   GAN ++    G  P+H++   G + +V+ LL+  A  +A  + G+TP+   A +GH  IV +L    A+ N Q  +G TPLH
Sbjct:  652 LLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 771          
BLAST of SMED30002664 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 111.309 bits (277), Expect = 1.604e-26
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI  +LL KGA PN     G  P+HLS   GH ++  LLLE  +  +A    G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +E+     ++G        ECN
Sbjct:  467 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGA-------ECN 659          

HSP 2 Score: 86.6557 bits (213), Expect = 3.308e-18
Identity = 53/160 (33.12%), Postives = 74/160 (46.25%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL   A  N    NG TP+  AA      + ++L + GA+I+ Q K G TPLH      +      LL+N A P  + + G T L  A ++G   +I     +G S
Sbjct:  630 KNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGAS 789          

HSP 3 Score: 83.5741 bits (205), Expect = 3.932e-17
Identity = 65/208 (31.25%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+  +L+  GAN N +   G  P++++    H  VV+ LLE ++  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   55 LEKVLDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINV 251          

HSP 4 Score: 83.1889 bits (204), Expect = 4.997e-17
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +     V+ LL NGA   I+ +   TAL  A   G +E+++
Sbjct:  370 TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQ 517          

HSP 5 Score: 83.1889 bits (204), Expect = 4.997e-17
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA---EEKGAIEVI 750
            ++   LL     L    K G+T LH  +  G  E+A+ LL K A P+     G  P+H++    + +V  LLL+  A P++   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A   ++ G  EV+
Sbjct:  547 EIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVL 717          

HSP 6 Score: 82.4185 bits (202), Expect = 9.613e-17
Identity = 58/177 (32.77%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL   A  +    N  TP+  A+ +G+  +VK+L  +G+ I  + KDGLTPLH    S     V++LLD GA  L + + GL+ L  A +
Sbjct:  172 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ 344          

HSP 7 Score: 80.8777 bits (198), Expect = 2.458e-16
Identity = 52/167 (31.14%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +V   LL      D   K G T LH  +      +A  LL +GA+P+     G  P+H++      ++   LLEY A+ N     G +P+  AA +G V +V +L +K A++N   K+GLTPLH       A   ++LL++GA+   + + G T L  A   G +++
Sbjct:  580 EVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKM 746          

HSP 8 Score: 76.2554 bits (186), Expect = 8.804e-15
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    ++ K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL+++A  +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  283 NMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 459          

HSP 9 Score: 73.9442 bits (180), Expect = 5.135e-14
Identity = 43/123 (34.96%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + D    +   LL  GA  + +   G  P+H++   G+ K+   LLE  AKPNA   NG+TP+  AA +GH  I+ +L   GA  N    +G T L
Sbjct:  679 DLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTAL 801          

HSP 10 Score: 73.559 bits (179), Expect = 7.601e-14
Identity = 49/165 (29.70%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G  ++V+ LL+  A PNA   +G+TP+  +A +GH  I  +L  +G+ ++   K G TPLH            +LL   A P    + GLT L  A       V     D G S   P
Sbjct:  464 NVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSP 628          

HSP 11 Score: 73.1738 bits (178), Expect = 9.547e-14
Identity = 46/148 (31.08%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G + +V+ L   GA ++ + KD  T LH  +       V+ LL  GA P      G T L  +  +G  E+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEI 548          

HSP 12 Score: 71.633 bits (174), Expect = 2.953e-13
Identity = 42/124 (33.87%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA D  K  V   LLN+  ++D + K G+T LH     G  ++A+ LL   A PN +   G  P+H +   GH+ ++ +LL+Y A PN    NG T ++ A   G++++V  L+
Sbjct:  695 NKNGLTPLHLAAQDD-KAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 817          

HSP 13 Score: 70.8626 bits (172), Expect = 6.001e-13
Identity = 59/207 (28.50%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G   VV+ LL+  AK +    +  T +  A+  G + IV+ L  KGA  N     G TPLH            +LL+ G+      ++G T L  A + G +EV
Sbjct:  376 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEV 581          

HSP 14 Score: 70.0922 bits (170), Expect = 9.979e-13
Identity = 48/179 (26.82%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            +V   LLN    +D+  +   T LH  S  G   +   LL +G+    +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L    A ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  250 NVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 428          

HSP 15 Score: 67.0106 bits (162), Expect = 9.872e-12
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL+N +   I  E G T L  A ++G  +V+
Sbjct:   62 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVV 190          
BLAST of SMED30002664 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 111.309 bits (277), Expect = 1.604e-26
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI  +LL KGA PN     G  P+HLS   GH ++  LLLE  +  +A    G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +E+     ++G        ECN
Sbjct:  467 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGA-------ECN 659          

HSP 2 Score: 86.6557 bits (213), Expect = 3.308e-18
Identity = 53/160 (33.12%), Postives = 74/160 (46.25%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL   A  N    NG TP+  AA      + ++L + GA+I+ Q K G TPLH      +      LL+N A P  + + G T L  A ++G   +I     +G S
Sbjct:  630 KNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGAS 789          

HSP 3 Score: 83.5741 bits (205), Expect = 3.932e-17
Identity = 65/208 (31.25%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+  +L+  GAN N +   G  P++++    H  VV+ LLE ++  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   55 LEKVLDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINV 251          

HSP 4 Score: 83.1889 bits (204), Expect = 4.997e-17
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +     V+ LL NGA   I+ +   TAL  A   G +E+++
Sbjct:  370 TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQ 517          

HSP 5 Score: 83.1889 bits (204), Expect = 4.997e-17
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA---EEKGAIEVI 750
            ++   LL     L    K G+T LH  +  G  E+A+ LL K A P+     G  P+H++    + +V  LLL+  A P++   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A   ++ G  EV+
Sbjct:  547 EIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVL 717          

HSP 6 Score: 82.4185 bits (202), Expect = 9.613e-17
Identity = 58/177 (32.77%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL   A  +    N  TP+  A+ +G+  +VK+L  +G+ I  + KDGLTPLH    S     V++LLD GA  L + + GL+ L  A +
Sbjct:  172 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ 344          

HSP 7 Score: 80.8777 bits (198), Expect = 2.458e-16
Identity = 52/167 (31.14%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +V   LL      D   K G T LH  +      +A  LL +GA+P+     G  P+H++      ++   LLEY A+ N     G +P+  AA +G V +V +L +K A++N   K+GLTPLH       A   ++LL++GA+   + + G T L  A   G +++
Sbjct:  580 EVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKM 746          

HSP 8 Score: 76.2554 bits (186), Expect = 8.804e-15
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    ++ K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL+++A  +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  283 NMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 459          

HSP 9 Score: 73.9442 bits (180), Expect = 5.135e-14
Identity = 43/123 (34.96%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + D    +   LL  GA  + +   G  P+H++   G+ K+   LLE  AKPNA   NG+TP+  AA +GH  I+ +L   GA  N    +G T L
Sbjct:  679 DLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTAL 801          

HSP 10 Score: 73.559 bits (179), Expect = 7.601e-14
Identity = 49/165 (29.70%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G  ++V+ LL+  A PNA   +G+TP+  +A +GH  I  +L  +G+ ++   K G TPLH            +LL   A P    + GLT L  A       V     D G S   P
Sbjct:  464 NVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSP 628          

HSP 11 Score: 73.1738 bits (178), Expect = 9.547e-14
Identity = 46/148 (31.08%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G + +V+ L   GA ++ + KD  T LH  +       V+ LL  GA P      G T L  +  +G  E+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEI 548          

HSP 12 Score: 71.633 bits (174), Expect = 2.953e-13
Identity = 42/124 (33.87%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA D  K  V   LLN+  ++D + K G+T LH     G  ++A+ LL   A PN +   G  P+H +   GH+ ++ +LL+Y A PN    NG T ++ A   G++++V  L+
Sbjct:  695 NKNGLTPLHLAAQDD-KAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 817          

HSP 13 Score: 70.8626 bits (172), Expect = 6.001e-13
Identity = 59/207 (28.50%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G   VV+ LL+  AK +    +  T +  A+  G + IV+ L  KGA  N     G TPLH            +LL+ G+      ++G T L  A + G +EV
Sbjct:  376 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEV 581          

HSP 14 Score: 70.0922 bits (170), Expect = 9.979e-13
Identity = 48/179 (26.82%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            +V   LLN    +D+  +   T LH  S  G   +   LL +G+    +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L    A ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  250 NVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 428          

HSP 15 Score: 67.0106 bits (162), Expect = 9.872e-12
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL+N +   I  E G T L  A ++G  +V+
Sbjct:   62 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVV 190          
BLAST of SMED30002664 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 111.309 bits (277), Expect = 1.620e-26
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI  +LL KGA PN     G  P+HLS   GH ++  LLLE  +  +A    G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +E+     ++G        ECN
Sbjct:  467 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGA-------ECN 659          

HSP 2 Score: 83.5741 bits (205), Expect = 4.082e-17
Identity = 65/208 (31.25%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+  +L+  GAN N +   G  P++++    H  VV+ LLE ++  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   55 LEKVLDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINV 251          

HSP 3 Score: 83.1889 bits (204), Expect = 5.046e-17
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA---EEKGAIEVI 750
            ++   LL     L    K G+T LH  +  G  E+A+ LL K A P+     G  P+H++    + +V  LLL+  A P++   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A   ++ G  EV+
Sbjct:  547 EIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVL 717          

HSP 4 Score: 83.1889 bits (204), Expect = 5.140e-17
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +     V+ LL NGA   I+ +   TAL  A   G +E+++
Sbjct:  370 TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQ 517          

HSP 5 Score: 82.4185 bits (202), Expect = 9.888e-17
Identity = 58/177 (32.77%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL   A  +    N  TP+  A+ +G+  +VK+L  +G+ I  + KDGLTPLH    S     V++LLD GA  L + + GL+ L  A +
Sbjct:  172 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ 344          

HSP 6 Score: 80.8777 bits (198), Expect = 2.505e-16
Identity = 52/167 (31.14%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +V   LL      D   K G T LH  +      +A  LL +GA+P+     G  P+H++      ++   LLEY A+ N     G +P+  AA +G V +V +L +K A++N   K+GLTPLH       A   ++LL++GA+   + + G T L  A   G +++
Sbjct:  580 EVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKM 746          

HSP 7 Score: 76.2554 bits (186), Expect = 9.220e-15
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    ++ K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL+++A  +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  283 NMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 459          

HSP 8 Score: 73.9442 bits (180), Expect = 5.680e-14
Identity = 45/128 (35.16%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP 681
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL   A  N    NG TP+  AA      + ++L + GA+I+ Q K G TPLH      +      LL+N A P
Sbjct:  630 KNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKP 757          

HSP 9 Score: 73.559 bits (179), Expect = 7.816e-14
Identity = 49/165 (29.70%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G  ++V+ LL+  A PNA   +G+TP+  +A +GH  I  +L  +G+ ++   K G TPLH            +LL   A P    + GLT L  A       V     D G S   P
Sbjct:  464 NVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSP 628          

HSP 10 Score: 73.1738 bits (178), Expect = 9.906e-14
Identity = 46/148 (31.08%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G + +V+ L   GA ++ + KD  T LH  +       V+ LL  GA P      G T L  +  +G  E+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEI 548          

HSP 11 Score: 70.8626 bits (172), Expect = 6.226e-13
Identity = 59/207 (28.50%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G   VV+ LL+  AK +    +  T +  A+  G + IV+ L  KGA  N     G TPLH            +LL+ G+      ++G T L  A + G +EV
Sbjct:  376 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEV 581          

HSP 12 Score: 70.0922 bits (170), Expect = 1.007e-12
Identity = 48/179 (26.82%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            +V   LLN    +D+  +   T LH  S  G   +   LL +G+    +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L    A ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  250 NVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 428          

HSP 13 Score: 67.0106 bits (162), Expect = 9.966e-12
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL+N +   I  E G T L  A ++G  +V+
Sbjct:   62 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVV 190          

HSP 14 Score: 62.003 bits (149), Expect = 4.662e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVR-----DNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA D  K  V   LLN+  ++D + K G+T LH     G  ++A+ LL   A PN +     + + +  I  S   GH+ ++ +LL+Y A PN    NG T ++ A   G++++V  L+
Sbjct:  695 NKNGLTPLHLAAQDD-KAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 822          

HSP 15 Score: 58.5362 bits (140), Expect = 5.761e-9
Identity = 46/156 (29.49%), Postives = 72/156 (46.15%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGK-------DGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G + LH  + +G  ++ S LL K AN N+ +  G  P+HL+  +  + V ++LL + A+ +A   +G+TP+  A   G++ +   L    A  N + K       D L P  F         + +LL  GA P      G TAL  A   G I V+
Sbjct:  665 GISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIP--FSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVV 818          
BLAST of SMED30002664 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 111.309 bits (277), Expect = 1.766e-26
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI  +LL KGA PN     G  P+HLS   GH ++  LLLE  +  +A    G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +E+     ++G        ECN
Sbjct:  453 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGA-------ECN 645          

HSP 2 Score: 83.1889 bits (204), Expect = 5.466e-17
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA---EEKGAIEVI 750
            ++   LL     L    K G+T LH  +  G  E+A+ LL K A P+     G  P+H++    + +V  LLL+  A P++   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A   ++ G  EV+
Sbjct:  533 EIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVL 703          

HSP 3 Score: 83.1889 bits (204), Expect = 5.567e-17
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +     V+ LL NGA   I+ +   TAL  A   G +E+++
Sbjct:  356 TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQ 503          

HSP 4 Score: 80.8777 bits (198), Expect = 2.711e-16
Identity = 52/167 (31.14%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +V   LL      D   K G T LH  +      +A  LL +GA+P+     G  P+H++      ++   LLEY A+ N     G +P+  AA +G V +V +L +K A++N   K+GLTPLH       A   ++LL++GA+   + + G T L  A   G +++
Sbjct:  566 EVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKM 732          

HSP 5 Score: 77.7962 bits (190), Expect = 3.143e-15
Identity = 66/216 (30.56%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN--------ERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+  +L+  GAN N +   G  P++++    H  VV+ LLE ++  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + +        E G T L  A   G I V
Sbjct:   33 LEKVLDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINV 237          

HSP 6 Score: 76.2554 bits (186), Expect = 1.005e-14
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    ++ K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL+++A  +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  269 NMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 445          

HSP 7 Score: 73.9442 bits (180), Expect = 6.128e-14
Identity = 45/128 (35.16%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP 681
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL   A  N    NG TP+  AA      + ++L + GA+I+ Q K G TPLH      +      LL+N A P
Sbjct:  616 KNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKP 743          

HSP 8 Score: 73.559 bits (179), Expect = 8.507e-14
Identity = 49/165 (29.70%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G  ++V+ LL+  A PNA   +G+TP+  +A +GH  I  +L  +G+ ++   K G TPLH            +LL   A P    + GLT L  A       V     D G S   P
Sbjct:  450 NVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSP 614          

HSP 9 Score: 73.1738 bits (178), Expect = 1.068e-13
Identity = 46/148 (31.08%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G + +V+ L   GA ++ + KD  T LH  +       V+ LL  GA P      G T L  +  +G  E+
Sbjct:  387 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEI 534          

HSP 10 Score: 70.8626 bits (172), Expect = 6.525e-13
Identity = 54/204 (26.47%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            SK+      E G   L  A      +V   LLN    +D+  +   T LH  S  G   +   LL +G+    +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L    A ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  211 SKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 414          

HSP 11 Score: 70.8626 bits (172), Expect = 6.706e-13
Identity = 59/207 (28.50%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G   VV+ LL+  AK +    +  T +  A+  G + IV+ L  KGA  N     G TPLH            +LL+ G+      ++G T L  A + G +EV
Sbjct:  362 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEV 567          

HSP 12 Score: 67.0106 bits (162), Expect = 1.071e-11
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL+N +   I  E G T L  A ++G  +V+
Sbjct:   40 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVV 168          

HSP 13 Score: 62.003 bits (149), Expect = 5.036e-10
Identity = 41/129 (31.78%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVR-----DNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA D  K  V   LLN+  ++D + K G+T LH     G  ++A+ LL   A PN +     + + +  I  S   GH+ ++ +LL+Y A PN    NG T ++ A   G++++V  L+
Sbjct:  681 NKNGLTPLHLAAQDD-KAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 808          

HSP 14 Score: 58.5362 bits (140), Expect = 6.151e-9
Identity = 46/156 (29.49%), Postives = 72/156 (46.15%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGK-------DGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G + LH  + +G  ++ S LL K AN N+ +  G  P+HL+  +  + V ++LL + A+ +A   +G+TP+  A   G++ +   L    A  N + K       D L P  F         + +LL  GA P      G TAL  A   G I V+
Sbjct:  651 GISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIP--FSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVV 804          
BLAST of SMED30002664 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 111.309 bits (277), Expect = 1.767e-26
Identity = 71/200 (35.50%), Postives = 96/200 (48.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI  +LL KGA PN     G  P+HLS   GH ++  LLLE  +  +A    G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +E+     ++G        ECN
Sbjct:  458 GETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGA-------ECN 650          

HSP 2 Score: 86.6557 bits (213), Expect = 3.760e-18
Identity = 53/160 (33.12%), Postives = 74/160 (46.25%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL   A  N    NG TP+  AA      + ++L + GA+I+ Q K G TPLH      +      LL+N A P  + + G T L  A ++G   +I     +G S
Sbjct:  621 KNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGAS 780          

HSP 3 Score: 83.1889 bits (204), Expect = 5.467e-17
Identity = 55/171 (32.16%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA---EEKGAIEVI 750
            ++   LL     L    K G+T LH  +  G  E+A+ LL K A P+     G  P+H++    + +V  LLL+  A P++   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A   ++ G  EV+
Sbjct:  538 EIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVL 708          

HSP 4 Score: 83.1889 bits (204), Expect = 5.569e-17
Identity = 53/148 (35.81%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +     V+ LL NGA   I+ +   TAL  A   G +E+++
Sbjct:  361 TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQ 508          

HSP 5 Score: 80.8777 bits (198), Expect = 2.712e-16
Identity = 52/167 (31.14%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +V   LL      D   K G T LH  +      +A  LL +GA+P+     G  P+H++      ++   LLEY A+ N     G +P+  AA +G V +V +L +K A++N   K+GLTPLH       A   ++LL++GA+   + + G T L  A   G +++
Sbjct:  571 EVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKM 737          

HSP 6 Score: 77.7962 bits (190), Expect = 3.144e-15
Identity = 66/216 (30.56%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN--------ERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+  +L+  GAN N +   G  P++++    H  VV+ LLE ++  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + +        E G T L  A   G I V
Sbjct:   38 LEKVLDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINV 242          

HSP 7 Score: 76.2554 bits (186), Expect = 1.005e-14
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    ++ K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL+++A  +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  274 NMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 450          

HSP 8 Score: 73.9442 bits (180), Expect = 5.595e-14
Identity = 43/123 (34.96%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + D    +   LL  GA  + +   G  P+H++   G+ K+   LLE  AKPNA   NG+TP+  AA +GH  I+ +L   GA  N    +G T L
Sbjct:  670 DLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTAL 792          

HSP 9 Score: 73.559 bits (179), Expect = 8.510e-14
Identity = 49/165 (29.70%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G  ++V+ LL+  A PNA   +G+TP+  +A +GH  I  +L  +G+ ++   K G TPLH            +LL   A P    + GLT L  A       V     D G S   P
Sbjct:  455 NVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSP 619          

HSP 10 Score: 73.1738 bits (178), Expect = 1.069e-13
Identity = 46/148 (31.08%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G + +V+ L   GA ++ + KD  T LH  +       V+ LL  GA P      G T L  +  +G  E+
Sbjct:  392 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEI 539          

HSP 11 Score: 71.633 bits (174), Expect = 3.332e-13
Identity = 42/124 (33.87%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA D  K  V   LLN+  ++D + K G+T LH     G  ++A+ LL   A PN +   G  P+H +   GH+ ++ +LL+Y A PN    NG T ++ A   G++++V  L+
Sbjct:  686 NKNGLTPLHLAAQDD-KAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLR 808          

HSP 12 Score: 70.8626 bits (172), Expect = 6.527e-13
Identity = 54/204 (26.47%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            SK+      E G   L  A      +V   LLN    +D+  +   T LH  S  G   +   LL +G+    +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L    A ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  216 SKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 419          

HSP 13 Score: 70.8626 bits (172), Expect = 6.707e-13
Identity = 59/207 (28.50%), Postives = 86/207 (41.55%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G   VV+ LL+  AK +    +  T +  A+  G + IV+ L  KGA  N     G TPLH            +LL+ G+      ++G T L  A + G +EV
Sbjct:  367 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEV 572          

HSP 14 Score: 67.0106 bits (162), Expect = 1.071e-11
Identity = 40/129 (31.01%), Postives = 65/129 (50.39%), Query Frame = 1
Query:  364 LAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL+N +   I  E G T L  A ++G  +V+
Sbjct:   45 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVV 173          
BLAST of SMED30002664 vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:549110])

HSP 1 Score: 103.605 bits (257), Expect = 1.250e-25
Identity = 66/207 (31.88%), Postives = 99/207 (47.83%), Query Frame = 1
Query:  103 SGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            S  ++  LA  GD + LK+     K      D+     L  A  + + +V  +LL   + +D K+  GWT LH  +  G  +I   L+ KGA  N  +  G  P+H +      ++  +LLE  A P+A  N   TP+  AASKG++ IV+IL    A  N Q  +G TPLH     +     K L+++GA   I N+   T L+ A
Sbjct:    7 SDVEVCNLAYRGDLEELKSRILADKSLATKTDQDDRTALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKDNLESTPLHRAASKGNLRIVQILLKHQASTNIQDTEGNTPLHLACDEERVEEAKCLVEHGASIYIENKEEKTPLQVA 213          

HSP 2 Score: 70.4774 bits (171), Expect = 1.320e-13
Identity = 43/138 (31.16%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  340 LWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            L E+ S++LA  +     D      +H +   G ++V + LL      +A  + GWTP+  AAS G   IV+ L  KGA +N   + G TPLH+           +LL+NGA P  ++    T L  A  KG + +++
Sbjct:   20 LEELKSRILADKSLATKTDQDDRTALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKDNLESTPLHRAASKGNLRIVQ 157          

HSP 3 Score: 68.9366 bits (167), Expect = 4.997e-13
Identity = 50/156 (32.05%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            TALH     G  E+A  LL  G   + +D+ G  P+H++   G   +V+ L+   A+ NA    G TP+ YAASK    I  +L   GA  + +     TPLH      +   V+ILL + A   I++  G T L  A ++  +E  K   + G S
Sbjct:   43 TALHWACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAANQIGCTPLHYAASKNKHEIALMLLENGASPDAKDNLESTPLHRAASKGNLRIVQILLKHQASTNIQDTEGNTPLHLACDEERVEEAKCLVEHGAS 198          
BLAST of SMED30002664 vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 104.76 bits (260), Expect = 4.039e-24
Identity = 66/197 (33.50%), Postives = 106/197 (53.81%), Query Frame = 1
Query:  187 CNNDEGGN-NLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRD-NFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            CN ++  N   L +A      +++  LL+   +L++++  GWTAL   S  G  ++   LL+KGANPN+    +  YP+  +   GHS +VKLLL+Y AK N +   G TP+ +AA KGH+  VK L   GAD++ +G + +T L           VK +L    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   64 CNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAG 260          

HSP 2 Score: 75.0998 bits (183), Expect = 3.274e-14
Identity = 60/191 (31.41%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQG-KDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G  NLL A ++      +  LL    D+D +N+ G TAL   +  G  EI  +LL   AN N+ D      +  +   GH ++V+ LL Y+A        GWT + +A+ KG + +V +L SKGA+ N  G +  + P+ +      +  VK+LL  GA     ++ G T L  A  KG +E +K     G
Sbjct:    5 GPQNLL-AYVEEGNIAALKTLLEKCKDVDERNENGQTALMLAAEQGNLEIVQELLRNRANCNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMG 194          

HSP 3 Score: 72.7886 bits (177), Expect = 1.661e-13
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   + + +LL    D+D +     TAL      G  +   ++L +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K ADI+ +G+D  T L++     +A  V+ +L    D     + G T L  A +  +IEV++   D G
Sbjct:  162 AKVN-CSDKFGTTPLIWAA---RKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKG 359          

HSP 4 Score: 70.4774 bits (171), Expect = 1.034e-12
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     D +  +L    +++  +K G TAL   + +G  EI   LL  G   N+ D  G+  +  +V  GH ++V+ LL   A  +    +  T + +A  KG+ T+V+ +     D  F  KDG TPL   T  +S   V++LLD GA     +++G T L  A
Sbjct:  198 DQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIA 376          

HSP 5 Score: 56.9954 bits (136), Expect = 2.249e-8
Identity = 50/190 (26.32%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ ++R    +  ++ +V  G++ +V+ +L+ +     +  +G TP+  A     + +V++L  KGA ++   K G TPLH     +S    ++LL N  D   L R N+ G T   ++C+ +K  +  I
Sbjct:  234 DKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQI 423          
BLAST of SMED30002664 vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 104.76 bits (260), Expect = 4.041e-24
Identity = 66/197 (33.50%), Postives = 106/197 (53.81%), Query Frame = 1
Query:  187 CNNDEGGN-NLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRD-NFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            CN ++  N   L +A      +++  LL+   +L++++  GWTAL   S  G  ++   LL+KGANPN+    +  YP+  +   GHS +VKLLL+Y AK N +   G TP+ +AA KGH+  VK L   GAD++ +G + +T L           VK +L    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   31 CNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAG 227          

HSP 2 Score: 72.7886 bits (177), Expect = 1.662e-13
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   + + +LL    D+D +     TAL      G  +   ++L +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K ADI+ +G+D  T L++     +A  V+ +L    D     + G T L  A +  +IEV++   D G
Sbjct:  129 AKVN-CSDKFGTTPLIWAA---RKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKG 326          

HSP 3 Score: 70.4774 bits (171), Expect = 1.035e-12
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     D +  +L    +++  +K G TAL   + +G  EI   LL  G   N+ D  G+  +  +V  GH ++V+ LL   A  +    +  T + +A  KG+ T+V+ +     D  F  KDG TPL   T  +S   V++LLD GA     +++G T L  A
Sbjct:  165 DQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIA 343          

HSP 4 Score: 56.9954 bits (136), Expect = 2.249e-8
Identity = 50/190 (26.32%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ ++R    +  ++ +V  G++ +V+ +L+ +     +  +G TP+  A     + +V++L  KGA ++   K G TPLH     +S    ++LL N  D   L R N+ G T   ++C+ +K  +  I
Sbjct:  201 DKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQI 390          

HSP 5 Score: 49.6766 bits (117), Expect = 4.912e-6
Identity = 34/124 (27.42%), Postives = 62/124 (50.00%), Query Frame = 1
Query:  403 GEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN-ERGLTALECAEEKGAIEVIKAFSDFG 771
            G+  + L+   G+ ++V+ LL   A  N    + WT +  AA +GH+ IV+ L S  A++  +   G T L + ++  S   V +LL  GA+P I   +  +  +  A  +G  +++K    +G
Sbjct:    5 GQTALMLAAEQGNLEIVQELLRNRANCNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYG 128          
BLAST of SMED30002664 vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 104.76 bits (260), Expect = 4.044e-24
Identity = 66/197 (33.50%), Postives = 106/197 (53.81%), Query Frame = 1
Query:  187 CNNDEGGN-NLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRD-NFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            CN ++  N   L +A      +++  LL+   +L++++  GWTAL   S  G  ++   LL+KGANPN+    +  YP+  +   GHS +VKLLL+Y AK N +   G TP+ +AA KGH+  VK L   GAD++ +G + +T L           VK +L    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   64 CNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAG 260          

HSP 2 Score: 75.0998 bits (183), Expect = 3.245e-14
Identity = 60/191 (31.41%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQG-KDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G  NLL A ++      +  LL    D+D +N+ G TAL   +  G  EI  +LL   AN N+ D      +  +   GH ++V+ LL Y+A        GWT + +A+ KG + +V +L SKGA+ N  G +  + P+ +      +  VK+LL  GA     ++ G T L  A  KG +E +K     G
Sbjct:    5 GPQNLL-AYVEEGNIAALKTLLEKCKDVDERNENGQTALMLAAEQGNLEIVQELLRNRANCNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMG 194          

HSP 3 Score: 72.7886 bits (177), Expect = 1.662e-13
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   + + +LL    D+D +     TAL      G  +   ++L +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K ADI+ +G+D  T L++     +A  V+ +L    D     + G T L  A +  +IEV++   D G
Sbjct:  162 AKVN-CSDKFGTTPLIWAA---RKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKG 359          

HSP 4 Score: 70.4774 bits (171), Expect = 1.025e-12
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     D +  +L    +++  +K G TAL   + +G  EI   LL  G   N+ D  G+  +  +V  GH ++V+ LL   A  +    +  T + +A  KG+ T+V+ +     D  F  KDG TPL   T  +S   V++LLD GA     +++G T L  A
Sbjct:  198 DQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIA 376          

HSP 5 Score: 57.3806 bits (137), Expect = 2.227e-8
Identity = 50/190 (26.32%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ ++R    +  ++ +V  G++ +V+ +L+ +     +  +G TP+  A     + +V++L  KGA ++   K G TPLH     +S    ++LL N  D   L R N+ G T   ++C+ +K  +  I
Sbjct:  234 DKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQI 423          
BLAST of SMED30002664 vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 104.76 bits (260), Expect = 4.059e-24
Identity = 66/197 (33.50%), Postives = 106/197 (53.81%), Query Frame = 1
Query:  187 CNNDEGGN-NLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRD-NFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            CN ++  N   L +A      +++  LL+   +L++++  GWTAL   S  G  ++   LL+KGANPN+    +  YP+  +   GHS +VKLLL+Y AK N +   G TP+ +AA KGH+  VK L   GAD++ +G + +T L           VK +L    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   64 CNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAG 260          

HSP 2 Score: 75.0998 bits (183), Expect = 3.288e-14
Identity = 60/191 (31.41%), Postives = 92/191 (48.17%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQG-KDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G  NLL A ++      +  LL    D+D +N+ G TAL   +  G  EI  +LL   AN N+ D      +  +   GH ++V+ LL Y+A        GWT + +A+ KG + +V +L SKGA+ N  G +  + P+ +      +  VK+LL  GA     ++ G T L  A  KG +E +K     G
Sbjct:    5 GPQNLL-AYVEEGNIAALKTLLEKCKDVDERNENGQTALMLAAEQGNLEIVQELLRNRANCNLEDVDNWTALISAAKEGHLEIVRELLSYNANLEHRDMGGWTALIWASYKGSIDVVDLLLSKGANPNITGLQYSVYPVIWAAGRGHSDIVKLLLQYGAKVNCSDKFGTTPLIWAARKGHLECVKYLLQMG 194          

HSP 3 Score: 72.7886 bits (177), Expect = 1.668e-13
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   + + +LL    D+D +     TAL      G  +   ++L +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K ADI+ +G+D  T L++     +A  V+ +L    D     + G T L  A +  +IEV++   D G
Sbjct:  162 AKVN-CSDKFGTTPLIWAA---RKGHLECVKYLLQMGADVDQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKG 359          

HSP 4 Score: 70.4774 bits (171), Expect = 1.039e-12
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     D +  +L    +++  +K G TAL   + +G  EI   LL  G   N+ D  G+  +  +V  GH ++V+ LL   A  +    +  T + +A  KG+ T+V+ +     D  F  KDG TPL   T  +S   V++LLD GA     +++G T L  A
Sbjct:  198 DQEGANSITALIVAVKGGYTDTVKEILKRNPNVNLTDKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIA 376          

HSP 5 Score: 56.9954 bits (136), Expect = 2.257e-8
Identity = 50/190 (26.32%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ ++R    +  ++ +V  G++ +V+ +L+ +     +  +G TP+  A     + +V++L  KGA ++   K G TPLH     +S    ++LL N  D   L R N+ G T   ++C+ +K  +  I
Sbjct:  234 DKDGNTALTIAAKEGHTEIVQDLLDAGTYVNIPDRNGDTVLIGAVRGGHVEIVRALLNKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEFSTKDGETPLIKATKMRSIEVVELLLDKGAKVSAVDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQI 423          
BLAST of SMED30002664 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 100.138 bits (248), Expect = 1.133e-22
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HL+   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 637          

HSP 2 Score: 92.8189 bits (229), Expect = 3.442e-20
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  529 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 703          

HSP 3 Score: 85.8853 bits (211), Expect = 7.384e-18
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  154 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ 326          

HSP 4 Score: 83.1889 bits (204), Expect = 6.001e-17
Identity = 57/190 (30.00%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   50 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINV 233          

HSP 5 Score: 82.8037 bits (203), Expect = 6.113e-17
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  294 SGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 466          

HSP 6 Score: 82.4185 bits (202), Expect = 9.086e-17
Identity = 63/209 (30.14%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K A  L       N +  N      I  +KN   V+  LL +   +    + G T +H  +  G   I S+L+  GA+PN  +  GE  +H++  +G ++VV+ L++  A+  A   +  TP+  +A  G   IV+ L  +GA  N     G TPLH             LLD+GA   I  ++G T L  A + G +EV
Sbjct:  358 AHCGHY---KVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEV 563          

HSP 7 Score: 82.0333 bits (201), Expect = 1.289e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 195          

HSP 8 Score: 80.4925 bits (197), Expect = 3.854e-16
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  AA +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  446 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 588          

HSP 9 Score: 77.7962 bits (190), Expect = 2.905e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKI-LLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K D++  LL      +     G+T LH  + +G  ++A+ LL  GA+ ++    G  P+H++   G  +V  LLL+ SA P+A   +G TP+  AA   +  +  +L  +GA  +   K+G TPLH +   K+ M +   LL+ GAD      +G+ ++  A ++G ++++
Sbjct:  494 KADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH-IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMV 663          

HSP 10 Score: 77.7962 bits (190), Expect = 2.986e-15
Identity = 51/158 (32.28%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  A  +G  +V     D G S
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS 540          

HSP 11 Score: 76.6406 bits (187), Expect = 8.328e-15
Identity = 54/177 (30.51%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K A+PN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 507          

HSP 12 Score: 76.6406 bits (187), Expect = 8.639e-15
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 172          

HSP 13 Score: 74.7146 bits (182), Expect = 2.914e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ SA   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A P  +   G T L  A +K  I V++     G S
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 408          

HSP 14 Score: 74.3294 bits (181), Expect = 4.199e-14
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G T LH          + +LL N A P      G TAL  A   G I V+
Sbjct:  591 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 795          

HSP 15 Score: 72.4034 bits (176), Expect = 1.908e-13
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A  N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  265 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 441          

HSP 16 Score: 61.2326 bits (147), Expect = 7.849e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G   +H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  676 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 17 Score: 56.225 bits (134), Expect = 3.584e-8
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   51 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 148          
BLAST of SMED30002664 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 100.138 bits (248), Expect = 1.136e-22
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HL+   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  460 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 648          

HSP 2 Score: 92.8189 bits (229), Expect = 3.452e-20
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  540 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 714          

HSP 3 Score: 85.8853 bits (211), Expect = 7.404e-18
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  165 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ 337          

HSP 4 Score: 83.1889 bits (204), Expect = 6.018e-17
Identity = 57/190 (30.00%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   61 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINV 244          

HSP 5 Score: 82.8037 bits (203), Expect = 6.130e-17
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  305 SGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 477          

HSP 6 Score: 82.4185 bits (202), Expect = 9.110e-17
Identity = 63/209 (30.14%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K A  L       N +  N      I  +KN   V+  LL +   +    + G T +H  +  G   I S+L+  GA+PN  +  GE  +H++  +G ++VV+ L++  A+  A   +  TP+  +A  G   IV+ L  +GA  N     G TPLH             LLD+GA   I  ++G T L  A + G +EV
Sbjct:  369 AHCGHY---KVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEV 574          

HSP 7 Score: 82.0333 bits (201), Expect = 1.293e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   55 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 206          

HSP 8 Score: 80.4925 bits (197), Expect = 3.864e-16
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  AA +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  457 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 599          

HSP 9 Score: 77.7962 bits (190), Expect = 2.912e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKI-LLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K D++  LL      +     G+T LH  + +G  ++A+ LL  GA+ ++    G  P+H++   G  +V  LLL+ SA P+A   +G TP+  AA   +  +  +L  +GA  +   K+G TPLH +   K+ M +   LL+ GAD      +G+ ++  A ++G ++++
Sbjct:  505 KADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH-IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMV 674          

HSP 10 Score: 77.7962 bits (190), Expect = 2.993e-15
Identity = 51/158 (32.28%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  A  +G  +V     D G S
Sbjct:  394 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS 551          

HSP 11 Score: 76.6406 bits (187), Expect = 8.350e-15
Identity = 54/177 (30.51%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K A+PN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  342 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 518          

HSP 12 Score: 76.6406 bits (187), Expect = 8.662e-15
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   46 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 183          

HSP 13 Score: 74.7146 bits (182), Expect = 2.922e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ SA   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A P  +   G T L  A +K  I V++     G S
Sbjct:  243 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 419          

HSP 14 Score: 74.3294 bits (181), Expect = 4.210e-14
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G T LH          + +LL N A P      G TAL  A   G I V+
Sbjct:  602 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 806          

HSP 15 Score: 72.4034 bits (176), Expect = 1.912e-13
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A  N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  276 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 452          

HSP 16 Score: 61.2326 bits (147), Expect = 7.867e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G   +H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  687 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 810          

HSP 17 Score: 56.225 bits (134), Expect = 3.592e-8
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   62 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 159          
BLAST of SMED30002664 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 100.138 bits (248), Expect = 1.141e-22
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HL+   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 637          

HSP 2 Score: 92.8189 bits (229), Expect = 3.466e-20
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  529 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 703          

HSP 3 Score: 85.8853 bits (211), Expect = 7.434e-18
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  154 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ 326          

HSP 4 Score: 83.1889 bits (204), Expect = 6.042e-17
Identity = 57/190 (30.00%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   50 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINV 233          

HSP 5 Score: 82.8037 bits (203), Expect = 6.154e-17
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  294 SGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 466          

HSP 6 Score: 82.4185 bits (202), Expect = 9.147e-17
Identity = 63/209 (30.14%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K A  L       N +  N      I  +KN   V+  LL +   +    + G T +H  +  G   I S+L+  GA+PN  +  GE  +H++  +G ++VV+ L++  A+  A   +  TP+  +A  G   IV+ L  +GA  N     G TPLH             LLD+GA   I  ++G T L  A + G +EV
Sbjct:  358 AHCGHY---KVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEV 563          

HSP 7 Score: 82.0333 bits (201), Expect = 1.298e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 195          

HSP 8 Score: 80.4925 bits (197), Expect = 3.880e-16
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  AA +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  446 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 588          

HSP 9 Score: 77.7962 bits (190), Expect = 2.924e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKI-LLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K D++  LL      +     G+T LH  + +G  ++A+ LL  GA+ ++    G  P+H++   G  +V  LLL+ SA P+A   +G TP+  AA   +  +  +L  +GA  +   K+G TPLH +   K+ M +   LL+ GAD      +G+ ++  A ++G ++++
Sbjct:  494 KADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH-IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMV 663          

HSP 10 Score: 77.7962 bits (190), Expect = 3.005e-15
Identity = 51/158 (32.28%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  A  +G  +V     D G S
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS 540          

HSP 11 Score: 76.6406 bits (187), Expect = 8.382e-15
Identity = 54/177 (30.51%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K A+PN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 507          

HSP 12 Score: 76.6406 bits (187), Expect = 8.695e-15
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 172          

HSP 13 Score: 74.7146 bits (182), Expect = 2.933e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ SA   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A P  +   G T L  A +K  I V++     G S
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 408          

HSP 14 Score: 74.3294 bits (181), Expect = 4.226e-14
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G T LH          + +LL N A P      G TAL  A   G I V+
Sbjct:  591 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 795          

HSP 15 Score: 72.4034 bits (176), Expect = 1.920e-13
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A  N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  265 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 441          

HSP 16 Score: 61.2326 bits (147), Expect = 7.893e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G   +H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  676 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 17 Score: 56.225 bits (134), Expect = 3.603e-8
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   51 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 148          
BLAST of SMED30002664 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 100.138 bits (248), Expect = 1.152e-22
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HL+   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 637          

HSP 2 Score: 92.8189 bits (229), Expect = 3.497e-20
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  529 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 703          

HSP 3 Score: 85.8853 bits (211), Expect = 7.499e-18
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  154 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ 326          

HSP 4 Score: 83.1889 bits (204), Expect = 6.094e-17
Identity = 57/190 (30.00%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   50 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINV 233          

HSP 5 Score: 82.8037 bits (203), Expect = 6.207e-17
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  294 SGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 466          

HSP 6 Score: 82.4185 bits (202), Expect = 9.225e-17
Identity = 63/209 (30.14%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K A  L       N +  N      I  +KN   V+  LL +   +    + G T +H  +  G   I S+L+  GA+PN  +  GE  +H++  +G ++VV+ L++  A+  A   +  TP+  +A  G   IV+ L  +GA  N     G TPLH             LLD+GA   I  ++G T L  A + G +EV
Sbjct:  358 AHCGHY---KVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEV 563          

HSP 7 Score: 82.0333 bits (201), Expect = 1.309e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 195          

HSP 8 Score: 80.4925 bits (197), Expect = 3.912e-16
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  AA +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  446 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 588          

HSP 9 Score: 77.7962 bits (190), Expect = 2.948e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKI-LLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K D++  LL      +     G+T LH  + +G  ++A+ LL  GA+ ++    G  P+H++   G  +V  LLL+ SA P+A   +G TP+  AA   +  +  +L  +GA  +   K+G TPLH +   K+ M +   LL+ GAD      +G+ ++  A ++G ++++
Sbjct:  494 KADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH-IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMV 663          

HSP 10 Score: 77.7962 bits (190), Expect = 3.030e-15
Identity = 51/158 (32.28%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  A  +G  +V     D G S
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS 540          

HSP 11 Score: 76.6406 bits (187), Expect = 8.452e-15
Identity = 54/177 (30.51%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K A+PN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 507          

HSP 12 Score: 76.6406 bits (187), Expect = 8.767e-15
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 172          

HSP 13 Score: 74.7146 bits (182), Expect = 2.957e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ SA   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A P  +   G T L  A +K  I V++     G S
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 408          

HSP 14 Score: 74.3294 bits (181), Expect = 4.261e-14
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G T LH          + +LL N A P      G TAL  A   G I V+
Sbjct:  591 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 795          

HSP 15 Score: 72.4034 bits (176), Expect = 1.935e-13
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A  N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  265 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 441          

HSP 16 Score: 61.2326 bits (147), Expect = 7.950e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G   +H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  676 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 17 Score: 56.225 bits (134), Expect = 3.627e-8
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   51 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 148          
BLAST of SMED30002664 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 100.138 bits (248), Expect = 1.153e-22
Identity = 59/189 (31.22%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HL+   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  449 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 637          

HSP 2 Score: 92.8189 bits (229), Expect = 3.502e-20
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  529 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 703          

HSP 3 Score: 85.8853 bits (211), Expect = 7.508e-18
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  154 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQ 326          

HSP 4 Score: 83.1889 bits (204), Expect = 6.101e-17
Identity = 57/190 (30.00%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   50 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINV 233          

HSP 5 Score: 82.8037 bits (203), Expect = 6.215e-17
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  294 SGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 466          

HSP 6 Score: 82.4185 bits (202), Expect = 9.236e-17
Identity = 63/209 (30.14%), Postives = 95/209 (45.45%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   K A  L       N +  N      I  +KN   V+  LL +   +    + G T +H  +  G   I S+L+  GA+PN  +  GE  +H++  +G ++VV+ L++  A+  A   +  TP+  +A  G   IV+ L  +GA  N     G TPLH             LLD+GA   I  ++G T L  A + G +EV
Sbjct:  358 AHCGHY---KVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEV 563          

HSP 7 Score: 82.0333 bits (201), Expect = 1.311e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 195          

HSP 8 Score: 80.4925 bits (197), Expect = 3.917e-16
Identity = 47/143 (32.87%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  AA +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  446 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 588          

HSP 9 Score: 77.7962 bits (190), Expect = 2.952e-15
Identity = 50/171 (29.24%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKI-LLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K D++  LL      +     G+T LH  + +G  ++A+ LL  GA+ ++    G  P+H++   G  +V  LLL+ SA P+A   +G TP+  AA   +  +  +L  +GA  +   K+G TPLH +   K+ M +   LL+ GAD      +G+ ++  A ++G ++++
Sbjct:  494 KADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH-IAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMV 663          

HSP 10 Score: 77.7962 bits (190), Expect = 3.034e-15
Identity = 51/158 (32.28%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  A  +G  +V     D G S
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS 540          

HSP 11 Score: 76.6406 bits (187), Expect = 8.462e-15
Identity = 54/177 (30.51%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K A+PN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  331 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 507          

HSP 12 Score: 76.6406 bits (187), Expect = 8.777e-15
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 172          

HSP 13 Score: 74.7146 bits (182), Expect = 2.961e-14
Identity = 52/177 (29.38%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ SA   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A P  +   G T L  A +K  I V++     G S
Sbjct:  232 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 408          

HSP 14 Score: 74.3294 bits (181), Expect = 4.266e-14
Identity = 57/205 (27.80%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G T LH          + +LL N A P      G TAL  A   G I V+
Sbjct:  591 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 795          

HSP 15 Score: 72.4034 bits (176), Expect = 1.937e-13
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A  N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  265 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 441          

HSP 16 Score: 61.2326 bits (147), Expect = 7.959e-10
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G   +H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  676 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 799          

HSP 17 Score: 56.225 bits (134), Expect = 3.631e-8
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   51 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 148          
BLAST of SMED30002664 vs. UniProt/SwissProt
Match: sp|Q8NFD2|ANKK1_HUMAN (Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.691e-23
Identity = 65/204 (31.86%), Postives = 102/204 (50.00%), Query Frame = 1
Query:  187 CNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINE 798
            C    G   LL AA D ++ D+   LL +  D +  ++ GW  LH  + +G    A  LL  GA  + ++  G  P+HL+  N    V +LL+   A PN  +  G TP+  AA  GHV++VK+L S+GA+++ Q ++  TPLH          ++ LL +GA P   ++ G   L  A  +G   + K    +G S E P ++
Sbjct:  390 CQTASGYTPLLIAAQD-QQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQ 592          

HSP 2 Score: 88.9669 bits (219), Expect = 3.549e-18
Identity = 56/190 (29.47%), Postives = 94/190 (49.47%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            DE G   L  A  +  +     LL++   +D + + GWT LH  + +    +A  L+++ A+PN+ +  G+ P+H++ + GH  +VKLL    A+ +A Q N  TP+  A  +G V  ++ L   GA  +   + G  PLH        +  K+LL  GA   +   +G T L  A  KG +E+I   ++
Sbjct:  425 DEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAE 614          

HSP 3 Score: 82.0333 bits (201), Expect = 7.121e-16
Identity = 57/185 (30.81%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L  A++  K   I  LL +    D  ++ G+  LH  +  G + I   LL  GA+  +  + G  P+HL+ + GH +++ LL E  A   A     WTP+  AA  G   +V  L   GAD N   + G TPLH      + + V  LL++ A+   RN+ G T    A  KG   ++K   + G
Sbjct:  531 LHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAG 715          

HSP 4 Score: 78.9518 bits (193), Expect = 7.660e-15
Identity = 50/161 (31.06%), Postives = 71/161 (44.10%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            ++  L +   +LD + +   T LH     G       LL  GA P+  D  G  P+H +   G   + K+LL Y A      + GWTP+  AA KGH+ I+ +L    A++   G    TPLH          V  LL  GADP    + G T L  A ++
Sbjct:  509 LVKLLTSQGAELDAQQRNLRTPLHLAVERGKVRAIQHLLKSGAVPDALDQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQR 669          

HSP 5 Score: 73.1738 bits (178), Expect = 6.952e-13
Identity = 47/147 (31.97%), Postives = 71/147 (48.30%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLI 687
            ++I+ L  +  ++     + WT LH  +  G   + S LL  GA+PN  +  G  P+HL+V       V  LLE+ A  +A    GWTP   AA KG+  I+K+L   GA ++ Q     TPL  L       G+   L+ G +P +
Sbjct:  607 EIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDGVSCTPLQ-LALRSRKQGIMSFLE-GKEPSV 751          

HSP 6 Score: 72.7886 bits (177), Expect = 9.059e-13
Identity = 51/176 (28.98%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            D+ G   L  A    K  +   LL     L+     GWT LH  +  G  EI   L    AN          P+HL+  +G   VV  LL+  A PNA + +GWTP+  A  +     V  L    A+++ + K G TP H      +   +K+L++ GA   +++    T L+ A
Sbjct:  557 DQSGYGPLHTAAARGKYLICKMLLRYGASLELPTHQGWTPLHLAAYKGHLEIIHLLAESHANMGALGAVNWTPLHLAARHGEEAVVSALLQCGADPNAAEQSGWTPLHLAVQRSTFLSVINLLEHHANVHARNKVGWTPAHLAALKGNTAILKVLVEAGAQLDVQDGVSCTPLQLA 732          

HSP 7 Score: 70.0922 bits (170), Expect = 6.141e-12
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  289 YKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            Y+NK+  T LH +   G  E    LLA   + + +   G  P+ ++  +    +  LLL + A  N    +GW P+ +AA  G     ++L   GA ++ Q ++G TPLH    +      ++L+   ADP +    G T L  A   G + ++K  +  G
Sbjct:  359 YENKV--TPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQEREGWTPLHLAAQNNFENVARLLVSRQADPNLHEAEGKTPLHVAAYFGHVSLVKLLTSQG 517          
BLAST of SMED30002664 vs. UniProt/SwissProt
Match: sp|Q7T163|KDISB_DANRE (Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 1.639e-22
Identity = 65/186 (34.95%), Postives = 98/186 (52.69%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVR-DNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +A      +V+  LL N   +++++  GWTAL   S  G  E+A+ LL  GANPN     +  YPI  +   GH+++VKLLLE+ AK N +   G TP+ +AA KGH   V  L   GAD++ +G + +T L           VK LL    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   83 LISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAG 268          

HSP 2 Score: 77.411 bits (189), Expect = 3.001e-14
Identity = 59/188 (31.38%), Postives = 90/188 (47.87%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNAT-QNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            +D G   L+ A+ +    +++  L+    +++  +   W+AL   + +G  E+  +LL   A    RD  G   +  + + G  +V  +LLE  A PN T Q     PI +AA +GH  IVK+L   GA +N   K G TPL +         V  LL+NGAD        +TAL  A + G  EV+K
Sbjct:   43 SDNGQTPLMLAS-EQGSLEIVQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVK 229          

HSP 3 Score: 71.2478 bits (173), Expect = 2.778e-12
Identity = 59/202 (29.21%), Postives = 98/202 (48.51%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   D +  LL N  D+D +     TAL      G  E+  +LL +  N N+ D  G   + ++   G++++V+ LL+     N    +G T +  A   GHV IV+ L  K ADI+ +G++  T L++     +A  V+ +L    D     +   T L  A +  +IEV++   D G
Sbjct:  170 AKVN-CSDKYGTTPLIWAA---RKGHYDCVMHLLENGADVDQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQENKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRSIEVVELLLDKG 367          

HSP 4 Score: 67.3958 bits (163), Expect = 6.232e-11
Identity = 54/179 (30.17%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     +V+  LL    +++  +K G TAL   + +G  EI   LL  G   N+ D  G+  +  +V  GH ++V+ LL   A  +       T + +A  KG+ T+V+ +     D     KD  TPL   T  +S   V++LLD GA     ++RG T L  A
Sbjct:  206 DQEGANSMTALIVAVKGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQENKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRSIEVVELLLDKGAKVSAVDKRGDTPLHIA 384          

HSP 5 Score: 57.3806 bits (137), Expect = 9.813e-8
Identity = 50/190 (26.32%), Postives = 90/190 (47.37%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ ++R    +  ++ +V  G++ +V+ +L+ +     T  +  TP+  A     + +V++L  KGA ++   K G TPLH     +S    ++LL N  D   L R N+ G T   ++C+ +K  +  I
Sbjct:  242 DKDGNTALMIAAKEGYTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRGQENKTALYWAVEKGNATMVRDILQCNPDTETTTKDSETPLIKATKMRSIEVVELLLDKGAKVSAVDKRGDTPLHIAIRGRSRRLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSILTQI 431          

HSP 6 Score: 52.7582 bits (125), Expect = 3.391e-6
Identity = 34/128 (26.56%), Postives = 62/128 (48.44%), Query Frame = 1
Query:  391 RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNER-GLTALECAEEKGAIEVIKAFSDFG 771
            R + G+ P+ L+   G  ++V+ L+   A  N    + W+ +  AA +GHV +VK L    A I  +   G T L + ++        +LL+NGA+P    ++  +  +  A  +G  E++K   + G
Sbjct:   42 RSDNGQTPLMLASEQGSLEIVQELIRRGANVNLDDVDCWSALISAAKEGHVEVVKELLENSAYIEHRDMGGWTALTWASYKGRVEVATVLLENGANPNTTGQQYSVYPIIWAAGRGHAEIVKLLLEHG 169          
BLAST of SMED30002664 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 3.374e-22
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HLS   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++  +  ++G
Sbjct:  474 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYG 662          

HSP 2 Score: 92.8189 bits (229), Expect = 2.536e-19
Identity = 58/175 (33.14%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+AS LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  554 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 728          

HSP 3 Score: 83.5741 bits (205), Expect = 3.197e-16
Identity = 58/175 (33.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  235 SRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S    V+  LL+    +  K K G + LH  +          LL    N  V D   +Y   +H++   GH KV K+LL+  A PNA   NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F      V  L+ +GA P   N RG TAL  A   G  EV++
Sbjct:  319 SGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR 491          

HSP 4 Score: 82.0333 bits (201), Expect = 9.481e-16
Identity = 51/156 (32.69%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +V+ L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   61 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 212          

HSP 5 Score: 79.337 bits (194), Expect = 6.969e-15
Identity = 46/143 (32.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  +A +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  471 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVA 613          

HSP 6 Score: 78.9518 bits (193), Expect = 8.766e-15
Identity = 57/185 (30.81%), Postives = 88/185 (47.57%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNF--------GEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N ++            G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  171 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ 351          

HSP 7 Score: 78.5666 bits (192), Expect = 1.220e-14
Identity = 55/177 (31.07%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K ANPN +   G  P+H++      +V++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  356 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 532          

HSP 8 Score: 78.1814 bits (191), Expect = 1.965e-14
Identity = 59/198 (29.80%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN--------ERGLTALECAEEKGAIEV 747
            +N CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VV+ LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  I +        E G T L  A   G I V
Sbjct:   67 VNICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINV 258          

HSP 9 Score: 77.7962 bits (190), Expect = 2.275e-14
Identity = 58/205 (28.29%), Postives = 90/205 (43.90%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL++ AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G TPLH          + +LL N A P      G TAL  A   G I V+
Sbjct:  616 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV 820          

HSP 10 Score: 76.6406 bits (187), Expect = 5.380e-14
Identity = 50/158 (31.65%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  +  +G  +V     D G S
Sbjct:  408 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS 565          

HSP 11 Score: 76.6406 bits (187), Expect = 6.343e-14
Identity = 45/138 (32.61%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          V+ LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   52 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 189          

HSP 12 Score: 74.3294 bits (181), Expect = 3.196e-13
Identity = 51/177 (28.81%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ +A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A+P  +   G T L  A +K  I V++     G S
Sbjct:  257 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS 433          

HSP 13 Score: 73.1738 bits (178), Expect = 7.462e-13
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  290 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 466          

HSP 14 Score: 64.6994 bits (156), Expect = 4.431e-10
Identity = 43/126 (34.13%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G  P+H +   GH+ ++ +LL+ +A PN    NG T +A A   G++++V  LK
Sbjct:  701 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLK 824          

HSP 15 Score: 56.225 bits (134), Expect = 2.608e-7
Identity = 31/98 (31.63%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV++   D G S
Sbjct:   68 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGAS 165          
BLAST of SMED30002664 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 5.102e-22
Identity = 60/189 (31.75%), Postives = 92/189 (48.68%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  S + +V+ +L+ +   ++ K K   T LH  +  G  +I  +LL +GA+PN     G  P+HLS   GH  V   LL++ A  + T   G+TP+  AA  G + +  +L  K A  +  GK GLTPLH      +     +LLD GA P    + G T L  A +K  +++     ++G
Sbjct:  466 GETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYG 654          

HSP 2 Score: 91.6633 bits (226), Expect = 6.372e-19
Identity = 57/175 (32.57%), Postives = 86/175 (49.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV  FLL++   L    K G+T LH  +  G  E+A+ LL K A+P+     G  P+H++    + KV  LLL+  A P+A   NG+TP+  AA K  + I   L   GAD N   + G+  +H          V +LL   A+  + N+ GLT L  A ++  + V +   + G
Sbjct:  546 DVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG 720          

HSP 3 Score: 85.5001 bits (210), Expect = 7.795e-17
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL  +A  + T  N  TP+  A+ +G+  +VK+L  +GA I+ + +DGLTPLH    S     V++LLD  A  L + + GL+ L  A +
Sbjct:  171 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQ 343          

HSP 4 Score: 83.9593 bits (206), Expect = 2.131e-16
Identity = 59/190 (31.05%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            IN CN  + G N L  A      +V+  LL    ++D   K G TALH  S  G  E+   L+  GAN N +   G  P++++    H +VVK LL+  A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   67 INICN--QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINV 250          

HSP 5 Score: 83.1889 bits (204), Expect = 3.638e-16
Identity = 52/156 (33.33%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            + N +D++  N+ G  ALH  S +G  E+ S+LL + AN +     G   +H++   G ++VVK+L+   A  NA   NG+TP+  AA + H+ +VK L   GA  +   +DG TPL           V +LL+N     +R    L AL  A  K
Sbjct:   61 IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARK 212          

HSP 6 Score: 79.7221 bits (195), Expect = 5.906e-15
Identity = 56/177 (31.64%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            + +  LL + + +D       TALH  +  G +++A  LL K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GHV IV  L   GA  N     G T LH    S  A  V+ L+ +GA    + +   T L  +   G  ++++     G S
Sbjct:  348 NCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGAS 524          

HSP 7 Score: 79.337 bits (194), Expect = 7.162e-15
Identity = 46/143 (32.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N  G TALH  +  G  E+   L+  GA    +    + P+H+S   G + +V+ LL+  A PNA   +G+TP+  +A +GH  +   L   GA ++   K G TPLH            +LL   A P    + GLT L  A
Sbjct:  463 NVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVA 605          

HSP 8 Score: 77.411 bits (189), Expect = 3.497e-14
Identity = 46/138 (33.33%), Postives = 70/138 (50.72%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   +  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +VK+L + GA++N Q ++G TPL+          VK LLDNGA   +  E G T L  A ++G  +V+
Sbjct:   52 GHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVV 189          

HSP 9 Score: 77.0258 bits (188), Expect = 4.199e-14
Identity = 50/158 (31.65%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +V  L+ + A PN T   G T +  AA  G   +V+ L   GA +  + KD  TPLH       A  V+ LL  GA P      G T L  +  +G  +V     D G S
Sbjct:  400 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGAS 557          

HSP 10 Score: 77.0258 bits (188), Expect = 4.396e-14
Identity = 58/205 (28.29%), Postives = 89/205 (43.41%), Query Frame = 1
Query:  142 YDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            YD  K A  L       +    N      I ++KN  D+   LL    D +   + G  ++H  + +G  ++ S LL + AN N+ +  G  P+HL+       V ++L+   A  +A    G+TP+      G++ IV  L    A +N + K+G TPLH          + +LL N A P      G TAL  A   G I V+
Sbjct:  608 YDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVV 812          

HSP 11 Score: 74.7146 bits (182), Expect = 2.496e-13
Identity = 51/177 (28.81%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  +   T LH  S  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+ +A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+LLD  A+P  +   G T L  A +K  I+V++     G S
Sbjct:  249 NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS 425          

HSP 12 Score: 73.1738 bits (178), Expect = 7.659e-13
Identity = 48/177 (27.12%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +++  LL+    +D K + G T LH  +  G  ++   LL + A    +   G  P+H++    H   V+LLL+++   +   N+  T +  AA  GH  + K+L  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G + ++      G S
Sbjct:  282 NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS 458          

HSP 13 Score: 63.1586 bits (152), Expect = 1.486e-9
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            +N  G   L  AA + R N V   L+N    +D + K+G+T LH V C  G  +I + LL   A  N +   G  P+H +   GH+ ++ +LL+ +A PN    NG T +  A   G++++V  LK
Sbjct:  693 SNKSGLTPLHLAAQEDRVN-VAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 14 Score: 56.9954 bits (136), Expect = 1.285e-7
Identity = 32/98 (32.65%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L  + A+++   K G T LH  + +  A  VK+L+ NGA+   +++ G T L  A ++  +EV+K   D G S
Sbjct:   68 NICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGAS 165          
BLAST of SMED30002664 vs. UniProt/SwissProt
Match: sp|Q54F46|WARA_DICDI (Homeobox protein Wariai OS=Dictyostelium discoideum OX=44689 GN=warA PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.587e-22
Identity = 65/192 (33.85%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNF-GEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            D  GN  L AA       ++  LL +  D +  N  G + L      G  +IAS LL   A  +V+    GE P+H++   G  K+ KLL+E  AK +   +N  TP+ +A   G+ +I K+L   GAD+N    DG TPLH  +     +  ++LL+NGADP I++  G T +  A  +  IE +K    F
Sbjct:  405 DNQGNTPLIAASVLGNQPIVELLLEHRADPNLVNDEGVSPLFSACKGGHLQIASSLLDHDAEVSVKTKINGETPLHIASLKGFEKICKLLIETEAKASVIDSNNRTPLHHACIMGYFSIAKLLICNGADMNAIDIDGHTPLHTSSLMGHDLITRLLLENGADPNIQDSEGYTPIHYAVRESRIETVKFLIKF 596          

HSP 2 Score: 76.6406 bits (187), Expect = 4.807e-14
Identity = 56/172 (32.56%), Postives = 79/172 (45.93%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF-LTFSKSAMGVKILLDNG----ADPLIRNERGLTALECAEEKGAIEVIKAFSDFG----ISWEKPINE 798
            T LH     G + IA  L+  GA+ N  D  G  P+H S   GH  + +LLLE  A PN   + G+TPI YA  +  +  VK L    + +N + K+G   +H  + F+   MG  I    G    AD    +++G T L  A + G    +K     G    I+ EK I E
Sbjct:  510 TPLHHACIMGYFSIAKLLICNGADMNAIDIDGHTPLHTSSLMGHDLITRLLLENGADPNIQDSEGYTPIHYAVRESRIETVKFLIKFNSKLNIKTKNGQNLIHLSVQFASLMMGQMIFESKGCEIAADD--SDDQGYTPLYLAAKAGKTNFVKYLLSKGASKKIALEKLIQE 679          

HSP 3 Score: 72.0182 bits (175), Expect = 1.483e-12
Identity = 45/152 (29.61%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  271 NIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGK-DGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            N ID++ ++  G + L   +  G      +L+  GANPN++DN G  P+  +   G+  +V+LLLE+ A PN   + G +P+  A   GH+ I   L    A+++ + K +G TPLH  +        K+L++  A   + +    T L  A
Sbjct:  364 NSIDVNARDSKGLSLLFTAAFLGYEYQVRRLIESGANPNIKDNQGNTPLIAASVLGNQPIVELLLEHRADPNLVNDEGVSPLFSACKGGHLQIASSLLDHDAEVSVKTKINGETPLHIASLKGFEKICKLLIETEAKASVIDSNNRTPLHHA 515          

HSP 4 Score: 69.707 bits (169), Expect = 8.994e-12
Identity = 51/158 (32.28%), Postives = 77/158 (48.73%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKI-GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILL 663
            NDEG + L F+A       +   LL++  ++  K KI G T LH  S  G  +I   L+   A  +V D+    P+H +   G+  + KLL+   A  NA   +G TP+  ++  GH  I ++L   GAD N Q  +G TP+H+         VK L+
Sbjct:  438 NDEGVSPL-FSACKGGHLQIASSLLDHDAEVSVKTKINGETPLHIASLKGFEKICKLLIETEAKASVIDSNNRTPLHHACIMGYFSIAKLLICNGADMNAIDIDGHTPLHTSSLMGHDLITRLLLENGADPNIQDSEGYTPIHYAVRESRIETVKFLI 594          
BLAST of SMED30002664 vs. TrEMBL
Match: A0A2T9WJQ3 (ANK_REP_REGION domain-containing protein (Fragment) OS=Sulfolobus sp. SCGC AB-777_G05 OX=1987490 GN=DDW01_01185 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 9.732e-38
Identity = 85/224 (37.95%), Postives = 123/224 (54.91%), Query Frame = 1
Query:  112 KIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGW----TPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            K+ + A+ GD   ++TA          +  G   L +AA      +++  LL    D + KN  GWT LH  +  G  EI   LL  GANPN + N G  P+H++   GH ++VKLLLE+ A PN   + GW    TP+  AA +GHV IVKIL  +GAD N +   G+TPLH   F      VK+LL++GA+P I++  G+T L  A ++G +E++K   + G
Sbjct:   23 KLLKAAENGDLIKVQTALEKGANPNAKDKYGLTPLHWAAFRGHV-EIVKILLERGADPNTKNYAGWTPLHDAALHGHVEIVKLLLEHGANPNAKINNGWTPLHMAAQEGHVEIVKLLLEHGANPNTKDDAGWNAGITPLHIAAQEGHVEIVKILLERGADPNAKNNAGITPLHDAVFRGHVEIVKLLLEHGANPNIKDCYGITPLHIAAQEGHVEIVKILLERG 245          

HSP 2 Score: 90.5077 bits (223), Expect = 2.154e-17
Identity = 51/125 (40.80%), Postives = 73/125 (58.40%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGW----TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGAD 579
            L  A      +++  LL +  + + K+  GW    T LH  + +G  EI   LL +GA+PN ++N G  P+H +V+ GH ++VKLLLE+ A PN     G TP+  AA +GHV IVKIL  +GAD
Sbjct:  123 LHMAAQEGHVEIVKLLLEHGANPNTKDDAGWNAGITPLHIAAQEGHVEIVKILLERGADPNAKNNAGITPLHDAVFRGHVEIVKLLLEHGANPNIKDCYGITPLHIAAQEGHVEIVKILLERGAD 247          

HSP 3 Score: 58.9214 bits (141), Expect = 2.821e-6
Identity = 36/91 (39.56%), Postives = 48/91 (52.75%), Query Frame = 1
Query:  523 AASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPIN 795
            AA  G +  V+    KGA+ N + K GLTPLH+  F      VKILL+ GADP  +N  G T L  A   G +E++K   + G +    IN
Sbjct:   27 AAENGDLIKVQTALEKGANPNAKDKYGLTPLHWAAFRGHVEIVKILLERGADPNTKNYAGWTPLHDAALHGHVEIVKLLLEHGANPNAKIN 117          
BLAST of SMED30002664 vs. TrEMBL
Match: A0A1W6JWK5 (Uncharacterized protein OS=Acidianus manzaensis OX=282676 GN=B6F84_00210 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.248e-35
Identity = 78/164 (47.56%), Postives = 107/164 (65.24%), Query Frame = 1
Query:  238 RKNDV--IYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            RK D+  +  LLN+  DL+ ++K G+T LH  S  G +EI + LL  GANPNV++  G  P+H++V++G  ++V  LL + A PN    +GWTP+  A+SKG+  IVKIL   GAD N Q K G TPLH   + + A  VKILLD+GADP IRN +G TA++ A
Sbjct:    7 RKGDLKEVEKLLNSE-DLNVRDKNGYTPLHYASRFGYYEIVNLLLEHGANPNVQEKHGSTPLHIAVYDGRIEIVNTLLYHGADPNIKNRDGWTPLHIASSKGYSEIVKILLEHGADPNIQEKHGSTPLHVAVYDRKAEIVKILLDHGADPNIRNNKGETAVQLA 169          

HSP 2 Score: 94.3597 bits (233), Expect = 1.314e-17
Identity = 52/129 (40.31%), Postives = 72/129 (55.81%), Query Frame = 1
Query:  385 NVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            NVRD  G  P+H +   G+ ++V LLLE+ A PN  + +G TP+  A   G + IV  L   GAD N + +DG TPLH  +    +  VKILL++GADP I+ + G T L  A      E++K   D G
Sbjct:   24 NVRDKNGYTPLHYASRFGYYEIVNLLLEHGANPNVQEKHGSTPLHIAVYDGRIEIVNTLLYHGADPNIKNRDGWTPLHIASSKGYSEIVKILLEHGADPNIQEKHGSTPLHVAVYDRKAEIVKILLDHG 152          

HSP 3 Score: 75.485 bits (184), Expect = 2.306e-11
Identity = 38/111 (34.23%), Postives = 65/111 (58.56%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYA 525
             ++ G+  L  A+   + +++  LL +  D + KN+ GWT LH  S  G  EI   LL  GA+PN+++  G  P+H++V++  +++VK+LL++ A PN   N G T +  A
Sbjct:   59 QEKHGSTPLHIAVYDGRIEIVNTLLYHGADPNIKNRDGWTPLHIASSKGYSEIVKILLEHGADPNIQEKHGSTPLHVAVYDRKAEIVKILLDHGADPNIRNNKGETAVQLA 169          
BLAST of SMED30002664 vs. TrEMBL
Match: C3NIT9 (Ankyrin OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) OX=419942 GN=YN1551_2013 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.892e-34
Identity = 68/175 (38.86%), Postives = 100/175 (57.14%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            DV+  LL    D + K+  G T LH  +  G  ++   LL +GA+PN +DN G+ P+H++   G   VV++LLE  A PNA  NNG TP+  AA KG V +V++L  +GAD N +  +G TPLH          V++LL+ GADP  ++  G T L  A  KG ++V++   + G
Sbjct:  152 DVVRVLLERGADPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAQEGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGHVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGHVDVVRVLLEHG 326          

HSP 2 Score: 131.724 bits (330), Expect = 7.945e-32
Identity = 70/191 (36.65%), Postives = 103/191 (53.93%), Query Frame = 1
Query:  115 IYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLI 687
            ++  A+ GD D ++        +    D  G   L  A      DV+  LL    D + K+  G T LH  + +G  ++   LL +GA+PN +DN G+ P+H++   G   VV++LLE  A PNA  NNG TP+  AA KGHV +V++L  +GAD N +  +G TPLH          V++LL++GADP I
Sbjct:  142 LHMAAQIGDVDVVRVLLERGA-DPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAQEGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGHVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGHVDVVRVLLEHGADPRI 331          

HSP 3 Score: 127.872 bits (320), Expect = 2.704e-30
Identity = 61/156 (39.10%), Postives = 91/156 (58.33%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G T LH  +  G  ++   LL +GA+PN +DN G+ P+H++   G   VV++LLE  A PNA  NNG TP+  AA +G V +V++L  +GAD N +  +G TPLH          V++LL+ GADP  ++  G T L  A  KG ++V++   + G
Sbjct:  138 GLTPLHMAAQIGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAQEGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGDVDVVRVLLERGADPNAKDNNGQTPLHMAAHKGHVDVVRVLLERG 293          
BLAST of SMED30002664 vs. TrEMBL
Match: V4JZM1 (Ankyrin repeat OS=uncultured Acidilobus sp. MG OX=1410573 GN=MGAcid_05560 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.405e-31
Identity = 76/214 (35.51%), Postives = 111/214 (51.87%), Query Frame = 1
Query:  145 DGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEK 786
            D  K    L  ++  + D  GN  L  A      +++  LL+   D + +N  G T LH  +  G  +    LL  GA+PN RD+ G  P+H +   GH++V  LL+E  A PNA    G TP+ +AA KGH  +VK+L  +GAD+N +   G+TPLH+      A  V +LL  GADP  ++  GLT L+ A   G   V++   D G S ++
Sbjct:   16 DATKALALLKSVDPSSRDRFGNTPLHWAAAYGPEELVKSLLDMRADPNARNSDGVTPLHWAAWGGRADNVRALLKAGADPNARDDNGFTPLHRAADRGHAEVAWLLIENGADPNARDREGRTPLHWAADKGHAEVVKVLLREGADVNARDDHGVTPLHWAAERGHAEVVWLLLQRGADPKAKDNCGLTPLDRAAAGGHEGVVRMLLDAGASPQR 229          

HSP 2 Score: 92.4337 bits (228), Expect = 3.335e-18
Identity = 52/140 (37.14%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTP 612
             D+ G   L  A D    +V + L+ N  D + +++ G T LH  +  G  E+   LL +GA+ N RD+ G  P+H +   GH++VV LLL+  A P A  N G TP+  AA+ GH  +V++L   GA    QG+ GL P
Sbjct:   98 RDDNGFTPLHRAADRGHAEVAWLLIENGADPNARDREGRTPLHWAADKGHAEVVKVLLREGADVNARDDHGVTPLHWAAERGHAEVVWLLLQRGADPKAKDNCGLTPLDRAAAGGHEGVVRMLLDAGASPQRQGQVGLEP 237          

HSP 3 Score: 58.9214 bits (141), Expect = 2.814e-6
Identity = 35/109 (32.11%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIA 519
             D  G   L  A D    +V+  LL    D++ ++  G T LH  +  G  E+   LL +GA+P  +DN G  P+  +   GH  VV++LL+  A P      G  P A
Sbjct:  131 RDREGRTPLHWAADKGHAEVVKVLLREGADVNARDDHGVTPLHWAAERGHAEVVWLLLQRGADPKAKDNCGLTPLDRAAAGGHEGVVRMLLDAGASPQRQGQVGLEPAA 239          
BLAST of SMED30002664 vs. TrEMBL
Match: A0A4Q4WH96 (ANK_REP_REGION domain-containing protein OS=Monosporascus sp. mg162 OX=1081914 GN=DL768_007093 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.313e-30
Identity = 72/180 (40.00%), Postives = 103/180 (57.22%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNER-GLTALECAEEKGAIEVIK 753
            L  AID    +V+  LL   +D+   +  GWT L+  SCDG  E+   LL KGA+  V +  G  P+HL+V +GH +VVKLLLE         NNGWTP+ +A+++GHV +VK+L  KGAD+    +DG TPLH  +       VK+LL  G +   R+ + G T L CA   G+  +++
Sbjct: 1521 LHLAIDHEHVEVVKLLLEKGVDITVASNNGWTPLNLASCDGHVEVVKLLLEKGADMTVVEQDGWTPLHLAVGHGHVEVVKLLLEKGVDITVASNNGWTPLHWASNEGHVEVVKLLLEKGADMTVVEQDGWTPLHLASNKGHVEVVKLLLRKGVNADQRDAKHGWTPLSCAARVGSPAIVR 1700          

HSP 2 Score: 120.939 bits (302), Expect = 2.286e-26
Identity = 70/192 (36.46%), Postives = 100/192 (52.08%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            ++ G   L  A+     +V+  LL+   D+   N  GW  LH  S +G  E+   LL KGA+  V +     P+HL++ + H +VVKLLLE         NNGWTP+  A+  GHV +VK+L  KGAD+    +DG TPLH          VK+LL+ G D  + +  G T L  A  +G +EV+K   + G
Sbjct: 1448 NQDGWTPLNLALKKEHVEVVKLLLDKGADITVANNDGWMPLHWASNEGHVEVVKLLLEKGADMAVVNRDEWTPLHLAIDHEHVEVVKLLLEKGVDITVASNNGWTPLNLASCDGHVEVVKLLLEKGADMTVVEQDGWTPLHLAVGHGHVEVVKLLLEKGVDITVASNNGWTPLHWASNEGHVEVVKLLLEKG 1639          

HSP 3 Score: 117.857 bits (294), Expect = 2.084e-25
Identity = 73/205 (35.61%), Postives = 104/205 (50.73%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEK 786
            + I   NND  G   L  A +    +V+  LL    D+   N+  WT LH        E+   LL KG +  V  N G  P++L+  +GH +VVKLLLE  A     + +GWTP+  A   GHV +VK+L  KG DI     +G TPLH+ +       VK+LL+ GAD  +  + G T L  A  KG +EV+K     G++ ++
Sbjct: 1475 ADITVANND--GWMPLHWASNEGHVEVVKLLLEKGADMAVVNRDEWTPLHLAIDHEHVEVVKLLLEKGVDITVASNNGWTPLNLASCDGHVEVVKLLLEKGADMTVVEQDGWTPLHLAVGHGHVEVVKLLLEKGVDITVASNNGWTPLHWASNEGHVEVVKLLLEKGADMTVVEQDGWTPLHLASNKGHVEVVKLLLRKGVNADQ 1677          

HSP 4 Score: 111.694 bits (278), Expect = 2.883e-23
Identity = 68/190 (35.79%), Postives = 104/190 (54.74%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L FAA + R+  V+  LL+   D++ K++ G T L      G   I  +LL+KGA+  V +  G  P++L++   H +VVKLLL+  A      N+GW P+ +A+++GHV +VK+L  KGAD+    +D  TPLH     +    VK+LL+ G D  + +  G T L  A   G +EV+K   + G
Sbjct: 1385 GQTALSFAAKNGRET-VVQRLLDKNADINSKDRNGQTPLSLAVESGHETIVQQLLSKGADMGVVNQDGWTPLNLALKKEHVEVVKLLLDKGADITVANNDGWMPLHWASNEGHVEVVKLLLEKGADMAVVNRDEWTPLHLAIDHEHVEVVKLLLEKGVDITVASNNGWTPLNLASCDGHVEVVKLLLEKG 1573          

HSP 5 Score: 109.383 bits (272), Expect = 1.822e-22
Identity = 67/195 (34.36%), Postives = 97/195 (49.74%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGI 774
            + D  G   L  A++S    ++  LL+   D+   N+ GWT L+        E+   LL KGA+  V +N G  P+H +   GH +VVKLLLE  A       + WTP+  A    HV +VK+L  KG DI     +G TPL+  +       VK+LL+ GAD  +  + G T L  A   G +EV+K   + G+
Sbjct: 1413 SKDRNGQTPLSLAVESGHETIVQQLLSKGADMGVVNQDGWTPLNLALKKEHVEVVKLLLDKGADITVANNDGWMPLHWASNEGHVEVVKLLLEKGADMAVVNRDEWTPLHLAIDHEHVEVVKLLLEKGVDITVASNNGWTPLNLASCDGHVEVVKLLLEKGADMTVVEQDGWTPLHLAVGHGHVEVVKLLLEKGV 1607          

HSP 6 Score: 101.679 bits (252), Expect = 6.653e-20
Identity = 57/157 (36.31%), Postives = 83/157 (52.87%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGI 774
            G TAL   + +G   +  +LL K A+ N +D  G+ P+ L+V +GH  +V+ LL   A       +GWTP+  A  K HV +VK+L  KGADI     DG  PLH+ +       VK+LL+ GAD  + N    T L  A +   +EV+K   + G+
Sbjct: 1385 GQTALSFAAKNGRETVVQRLLDKNADINSKDRNGQTPLSLAVESGHETIVQQLLSKGADMGVVNQDGWTPLNLALKKEHVEVVKLLLDKGADITVANNDGWMPLHWASNEGHVEVVKLLLEKGADMAVVNRDEWTPLHLAIDHEHVEVVKLLLEKGV 1541          

HSP 7 Score: 92.8189 bits (229), Expect = 6.449e-17
Identity = 71/231 (30.74%), Postives = 103/231 (44.59%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVR---DNFGEYPIHLSVWNGHSKVVKLLLE---------------------YSAKP----------------NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +GG   L  A  +    V+  LL+   D++ K++ GWT L   +  G   +  +LL KGA+  V     N G  P+ L+   GH  VV+ LL+                     ++AK                 N+   NG TP++ A   GH TIV+ L SKGAD+    +DG TPL+     +    VK+LLD GAD  + N  G   L  A  +G +EV+K   + G
Sbjct: 1277 DGGQTPLSLAAKNGHETVLQRLLDKDADINSKDRNGWTPLSWAANRGHGAVVQQLLDKGADIEVAISGHNAGMTPLILAAGEGHEAVVQQLLDKGADIEAKLTSDYFAGQTALSFAAKNGRETVVQRLLDKNADINSKDRNGQTPLSLAVESGHETIVQQLLSKGADMGVVNQDGWTPLNLALKKEHVEVVKLLLDKGADITVANNDGWMPLHWASNEGHVEVVKLLLEKG 1507          

HSP 8 Score: 80.1073 bits (196), Expect = 1.144e-12
Identity = 55/150 (36.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  349 IASKLLAKGANPNVRD----NFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADIN--FQGKD-GLTPLHFLTFSKSAMGVKILLDNGADPLIRNER----GLTALECAEEKGAIEVIKAFSD 765
            I  KLL KGA   V+     + G+ P+ L+  NGH  V++ LL+  A  N+   NGWTP+++AA++GH  +V+ L  KGADI     G + G+TPL           V+ LLD GAD   +       G TAL  A + G   V++   D
Sbjct: 1257 IVQKLLDKGAKTEVKTIGGYDGGQTPLSLAAKNGHETVLQRLLDKDADINSKDRNGWTPLSWAANRGHGAVVQQLLDKGADIEVAISGHNAGMTPLILAAGEGHEAVVQQLLDKGADIEAKLTSDYFAGQTALSFAAKNGRETVVQRLLD 1406          

HSP 9 Score: 70.8626 bits (172), Expect = 1.233e-9
Identity = 57/195 (29.23%), Postives = 83/195 (42.56%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLL-----------------------------------EYSAKPNATQNNGWTPIAYAASKGHVTIVKI-LKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNG 672
            ++ G   L  A+     +V+  LL   +D+   +  GWT LH  S +G  E+   LL KGA+  V +  G  P+HL+   GH +VVKLLL                                   EY+  P +    G TP++YAA  GH  +V + L +K  + + +   G TPL   T +     VK LL  G
Sbjct: 1580 EQDGWTPLHLAVGHGHVEVVKLLLEKGVDITVASNNGWTPLHWASNEGHVEVVKLLLEKGADMTVVEQDGWTPLHLASNKGHVEVVKLLLRKGVNADQRDAKHGWTPLSCAARVGSPAIVRLLLTEYAVDPKSRDTLGRTPLSYAAKNGHQEVVMVLLTNKMVNPDLKDCYGSTPLLIATRNGHTGVVKSLLATG 1774          

HSP 10 Score: 68.1662 bits (165), Expect = 8.748e-9
Identity = 63/223 (28.25%), Postives = 98/223 (43.95%), Query Frame = 1
Query:  151 LKTAFSLSKINYCNND-EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQ---GKDG-LTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECN 804
            + T  S   ++Y +++ + G   L  A  S    V   LL +  DL  ++  G TALH+ +  G   I   LL  GA    +DN G  P+  +  +G+  V++LL         +++     + + A KG  TIV+ L  KGA    +   G DG  TPL     +     ++ LLD  AD   ++  G T L  A  +G   V++   D G   E  I+  N
Sbjct: 1124 INTQVSFEGLDYEDDELDYGGTALHCAASSGNIAVTQLLLRHSPDLHIQDIYGRTALHRAAVHGHEAIVKLLLESGAEAQSKDNEGRTPLFHAARHGYRMVMELLPATHGVSQESEDMYQGVLLFVAEKGDETIVQKLLDKGAKTEVKTIGGYDGGQTPLSLAAKNGHETVLQRLLDKDADINSKDRNGWTPLSWAANRGHGAVVQQLLDKGADIEVAISGHN 1346          

HSP 11 Score: 66.6254 bits (161), Expect = 3.188e-8
Identity = 51/163 (31.29%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  280 DLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKS--KGADINFQGKDGLTPLHFLTFSKSAMGVKILLDN-GADPLIRNERGLTALECAEEKGAIEVIKAF 759
            D+  K++   TAL + + +G + IA  LL+ GA+   RD+ G+ P+ L+   GH  +V+LL+ ++A  +   ++  + +  AA  GH+ IV+ L       DI+   +D  TPLH     K+   V+IL++   AD    NE G T    A E G  ++++ F
Sbjct:  958 DVKTKDRYSRTALLRAAENGHYAIAQLLLSHGADVTDRDDRGDTPLFLAAERGHKAIVQLLMRHNADIHGC-DDLESAVHVAAENGHLEIVRDLLDCYDCIDISATARD--TPLHSAVLGKAYEVVEILVEKYDADVNAFNEFGRTPFHYAIEDGIEDLVQYF 1117          
BLAST of SMED30002664 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 108.612 bits (270), Expect = 1.042e-25
Identity = 69/189 (36.51%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI   LL KGA  +     G  P+HL+V  GH +   LLLE+ A  +A    G+TP+  AA  G +   K+L  K A  +  GK GLTPLH      +     +LLD+GA P    + G T L  A +K  +E+     +FG
Sbjct:  468 GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFG 656          

HSP 2 Score: 88.5817 bits (218), Expect = 5.788e-19
Identity = 64/223 (28.70%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC-YHNLCMACY 870
            G   L  A+     +    LL +   L    K G+T LH  +  G  E A  LL K A P+     G  P+H++    + +V  LLL++ A P+A   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A ++  + V +   + G   +       H + G   + + C Y N+ M  +
Sbjct:  534 GYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDA------HTKTGYTPLHVACHYGNMKMVSF 750          

HSP 3 Score: 85.1149 bits (209), Expect = 8.394e-18
Identity = 60/177 (33.90%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            E G   L  A+    + V+  LL N    D K K+   ALH  +     + A+ LL    N +V    G  P+H++   G+  V  LLL   A  +    N  TP+  AA +G+  +VK+L  +GA I+ + KDGLTPLH    S     V++LLD GA  L + + GL+ L  A +
Sbjct:  173 EDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQ 345          

HSP 4 Score: 84.7297 bits (208), Expect = 1.272e-17
Identity = 57/169 (33.73%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + +  LL + + +D       TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +  A  V+ LL NGA   I+ +   TAL  A   G  E+++
Sbjct:  350 NCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQ 518          

HSP 5 Score: 84.7297 bits (208), Expect = 1.447e-17
Identity = 65/208 (31.25%), Postives = 95/208 (45.67%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL     +D   K G TALH  S  G  ++  +L+  GAN N +   G  P++++    H +VV+ LLE+ A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++ G T L  A   G I V
Sbjct:   56 LEKALDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINV 252          

HSP 6 Score: 80.1073 bits (196), Expect = 4.215e-16
Identity = 50/151 (33.11%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL  +A  N    NG TP+  AA +  V + ++L + GA+++   K G TPLH      +   V  LL+N A    + + G T L  A ++G   +I
Sbjct:  631 KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHII 781          

HSP 7 Score: 76.6406 bits (187), Expect = 5.808e-15
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            L  A      +++  LL+    +D K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL++    +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  274 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 460          

HSP 8 Score: 75.485 bits (184), Expect = 1.450e-14
Identity = 60/209 (28.71%), Postives = 88/209 (42.11%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G + VV+ LL+  AK +    +  T +  A+  G   IV++L  KGA  +     G TPLH            +LL++GA      ++G T L  A + G IE  K
Sbjct:  377 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK 584          

HSP 9 Score: 73.559 bits (179), Expect = 5.808e-14
Identity = 49/158 (31.01%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G   +V+ L   GA ++ + KD  T LH  +    A  V++LL  GA        G T L  A  +G  E      + G S
Sbjct:  402 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGAS 559          

HSP 10 Score: 72.4034 bits (176), Expect = 1.540e-13
Identity = 48/161 (29.81%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G +++V+LLL+  A  +A   +G+TP+  A  +GH     +L   GA ++   K G TPLH           K+LL   A P    + GLT L  A       V     D G S
Sbjct:  465 NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 625          

HSP 11 Score: 70.0922 bits (170), Expect = 9.065e-13
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL++GA   I  E G T L  A ++G  +V+
Sbjct:   54 GNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVV 191          

HSP 12 Score: 68.5514 bits (166), Expect = 2.549e-12
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            +V   LLN    +D+  +   T LH  +  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  251 NVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 429          

HSP 13 Score: 65.4698 bits (158), Expect = 3.006e-11
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + +    +A  LL  GA  +     G  P+H++   G+ K+V  LLE  AK N+   +G+TP+  AA +GH  I+ +L    A  N    +G T L
Sbjct:  680 DLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTAL 802          

HSP 14 Score: 58.9214 bits (141), Expect = 3.405e-9
Identity = 38/124 (30.65%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA + R   V   LLN+  ++D   K G+T LH     G  ++ S LL   A  N +   G  P+H +   GH+ ++ +LL++ A  N    NG T ++ A   G++++V  L+
Sbjct:  696 NKNGLTPLHLAAQEDRVG-VAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 818          

HSP 15 Score: 50.0618 bits (118), Expect = 2.640e-6
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  484 NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N    NG   +  A+ +GHV +V  L   GA ++   K G T LH  + +     V+ L+ NGA+   +++ G T L  A ++  +EV++   + G S
Sbjct:   70 NICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGAS 167          
BLAST of SMED30002664 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 108.612 bits (270), Expect = 1.054e-25
Identity = 69/189 (36.51%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI   LL KGA  +     G  P+HL+V  GH +   LLLE+ A  +A    G+TP+  AA  G +   K+L  K A  +  GK GLTPLH      +     +LLD+GA P    + G T L  A +K  +E+     +FG
Sbjct:  440 GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFG 628          

HSP 2 Score: 88.5817 bits (218), Expect = 5.851e-19
Identity = 64/223 (28.70%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC-YHNLCMACY 870
            G   L  A+     +    LL +   L    K G+T LH  +  G  E A  LL K A P+     G  P+H++    + +V  LLL++ A P+A   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A ++  + V +   + G   +       H + G   + + C Y N+ M  +
Sbjct:  506 GYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDA------HTKTGYTPLHVACHYGNMKMVSF 722          

HSP 3 Score: 84.7297 bits (208), Expect = 1.285e-17
Identity = 57/169 (33.73%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + +  LL + + +D       TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +  A  V+ LL NGA   I+ +   TAL  A   G  E+++
Sbjct:  322 NCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQ 490          

HSP 4 Score: 80.1073 bits (196), Expect = 4.259e-16
Identity = 50/151 (33.11%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL  +A  N    NG TP+  AA +  V + ++L + GA+++   K G TPLH      +   V  LL+N A    + + G T L  A ++G   +I
Sbjct:  603 KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHII 753          

HSP 5 Score: 77.411 bits (189), Expect = 3.922e-15
Identity = 65/216 (30.09%), Postives = 95/216 (43.98%), Query Frame = 1
Query:  124 LAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNE--------RGLTALECAEEKGAIEV 747
            L K  DY  LKT      IN CN  + G N L  A      +V+  LL     +D   K G TALH  S  G  ++  +L+  GAN N +   G  P++++    H +VV+ LLE+ A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++         G T L  A   G I V
Sbjct:   20 LEKALDY--LKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINV 224          

HSP 6 Score: 76.6406 bits (187), Expect = 5.867e-15
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            L  A      +++  LL+    +D K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL++    +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  246 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 432          

HSP 7 Score: 75.485 bits (184), Expect = 1.464e-14
Identity = 60/209 (28.71%), Postives = 88/209 (42.11%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G + VV+ LL+  AK +    +  T +  A+  G   IV++L  KGA  +     G TPLH            +LL++GA      ++G T L  A + G IE  K
Sbjct:  349 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK 556          

HSP 8 Score: 73.559 bits (179), Expect = 5.866e-14
Identity = 49/158 (31.01%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G   +V+ L   GA ++ + KD  T LH  +    A  V++LL  GA        G T L  A  +G  E      + G S
Sbjct:  374 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGAS 531          

HSP 9 Score: 72.4034 bits (176), Expect = 1.555e-13
Identity = 48/161 (29.81%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G +++V+LLL+  A  +A   +G+TP+  A  +GH     +L   GA ++   K G TPLH           K+LL   A P    + GLT L  A       V     D G S
Sbjct:  437 NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 597          

HSP 10 Score: 70.0922 bits (170), Expect = 9.153e-13
Identity = 44/138 (31.88%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  337 GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            G  E A   L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL++GA   I  E G T L  A ++G  +V+
Sbjct:   18 GNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVV 155          

HSP 11 Score: 69.3218 bits (168), Expect = 1.549e-12
Identity = 52/204 (25.49%), Postives = 89/204 (43.63%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            SK++   +   G   L  A      +V   LLN    +D+  +   T LH  +  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  198 SKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 401          

HSP 12 Score: 65.4698 bits (158), Expect = 3.034e-11
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + +    +A  LL  GA  +     G  P+H++   G+ K+V  LLE  AK N+   +G+TP+  AA +GH  I+ +L    A  N    +G T L
Sbjct:  652 DLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTAL 774          

HSP 13 Score: 58.9214 bits (141), Expect = 3.435e-9
Identity = 38/124 (30.65%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA + R   V   LLN+  ++D   K G+T LH     G  ++ S LL   A  N +   G  P+H +   GH+ ++ +LL++ A  N    NG T ++ A   G++++V  L+
Sbjct:  668 NKNGLTPLHLAAQEDRVG-VAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 790          
BLAST of SMED30002664 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 108.612 bits (270), Expect = 1.140e-25
Identity = 69/189 (36.51%), Postives = 93/189 (49.21%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + DV+ +LL N   +D K K   TALH  S  G  EI   LL KGA  +     G  P+HL+V  GH +   LLLE+ A  +A    G+TP+  AA  G +   K+L  K A  +  GK GLTPLH      +     +LLD+GA P    + G T L  A +K  +E+     +FG
Sbjct:  420 GETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFG 608          

HSP 2 Score: 88.5817 bits (218), Expect = 6.300e-19
Identity = 64/223 (28.70%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC-YHNLCMACY 870
            G   L  A+     +    LL +   L    K G+T LH  +  G  E A  LL K A P+     G  P+H++    + +V  LLL++ A P+A   NG+TP+  AA K  + I   L   GA+ N   + G++PLH      S   V +LL   A+  + N+ GLT L  A ++  + V +   + G   +       H + G   + + C Y N+ M  +
Sbjct:  486 GYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDA------HTKTGYTPLHVACHYGNMKMVSF 702          

HSP 3 Score: 84.7297 bits (208), Expect = 1.383e-17
Identity = 57/169 (33.73%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + +  LL + + +D       TALH  +  G +++A  ++ K ANPN +   G  P+H++      KV++LLL++ A   A   +G TPI  AA  GH  IVK L   GA  N     G T LH    +  A  V+ LL NGA   I+ +   TAL  A   G  E+++
Sbjct:  302 NCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQ 470          

HSP 4 Score: 80.1073 bits (196), Expect = 4.573e-16
Identity = 50/151 (33.11%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            K G+T LH  +     EI + LL  GA  N     G  P+HL+   G   +V LLL  +A  N    NG TP+  AA +  V + ++L + GA+++   K G TPLH      +   V  LL+N A    + + G T L  A ++G   +I
Sbjct:  583 KNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHII 733          

HSP 5 Score: 76.6406 bits (187), Expect = 6.067e-15
Identity = 62/209 (29.67%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  145 DGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNE--------RGLTALECAEEKGAIEV 747
            D LKT      IN CN  + G N L  A      +V+  LL     +D   K G TALH  S  G  ++  +L+  GAN N +   G  P++++    H +VV+ LLE+ A  +    +G+TP+A A  +GH  +V +L       + +GK  L  LH            +LL N  +  + ++         G T L  A   G I V
Sbjct:    5 DYLKTGVD---INICN--QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINV 204          

HSP 6 Score: 76.6406 bits (187), Expect = 6.293e-15
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            L  A      +++  LL+    +D K K G T LH  +  G  ++   LL +GA    +   G  P+H++    H   V+LLL++    +   N+  T +  AA  GH  + K++  K A+ N +  +G TPLH          +++LL +GA      E GLT +  A   G   ++K  +  G S
Sbjct:  226 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGAS 412          

HSP 7 Score: 75.485 bits (184), Expect = 1.570e-14
Identity = 60/209 (28.71%), Postives = 88/209 (42.11%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            A CG Y   K      K N       G   L  A    +  V+  LL +   L    + G T +H  +  G   I  +L   GA+PN  +  GE  +H++   G + VV+ LL+  AK +    +  T +  A+  G   IV++L  KGA  +     G TPLH            +LL++GA      ++G T L  A + G IE  K
Sbjct:  329 AHCGHYKVAKVIVD-KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK 536          

HSP 8 Score: 73.559 bits (179), Expect = 6.283e-14
Identity = 49/158 (31.01%), Postives = 69/158 (43.67%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH        ++   LL  GA+       G  PIH++ + GH  +VK L  + A PN T   G T +  AA  G   +V+ L   GA ++ + KD  T LH  +    A  V++LL  GA        G T L  A  +G  E      + G S
Sbjct:  354 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGAS 511          

HSP 9 Score: 72.4034 bits (176), Expect = 1.665e-13
Identity = 48/161 (29.81%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  295 NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            N  G TALH  +  G  ++   LL  GA  +++    +  +H++   G +++V+LLL+  A  +A   +G+TP+  A  +GH     +L   GA ++   K G TPLH           K+LL   A P    + GLT L  A       V     D G S
Sbjct:  417 NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGAS 577          

HSP 10 Score: 69.707 bits (169), Expect = 1.163e-12
Identity = 43/135 (31.85%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  346 EIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            E A   L  G + N+ +  G   +HL+   GH +VV  LL+  A  +A    G T +  A+  G   +V+ L + GA++N Q ++G TPL+          V+ LL++GA   I  E G T L  A ++G  +V+
Sbjct:    1 EKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVV 135          

HSP 11 Score: 69.3218 bits (168), Expect = 1.656e-12
Identity = 52/204 (25.49%), Postives = 89/204 (43.63%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            SK++   +   G   L  A      +V   LLN    +D+  +   T LH  +  G   +   LL +GA  + +   G  P+H    +GH +VV++LL+  A   +   NG +P+  A    H+  V++L      ++    D LT LH           K+++D  A+P  +   G T L  A +K  ++V++     G S +
Sbjct:  178 SKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQ 381          

HSP 12 Score: 65.4698 bits (158), Expect = 3.235e-11
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            D++  LL    +++  NK G T LH  + +    +A  LL  GA  +     G  P+H++   G+ K+V  LLE  AK N+   +G+TP+  AA +GH  I+ +L    A  N    +G T L
Sbjct:  632 DLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTAL 754          

HSP 13 Score: 58.9214 bits (141), Expect = 3.646e-9
Identity = 38/124 (30.65%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            N  G   L  AA + R   V   LLN+  ++D   K G+T LH     G  ++ S LL   A  N +   G  P+H +   GH+ ++ +LL++ A  N    NG T ++ A   G++++V  L+
Sbjct:  648 NKNGLTPLHLAAQEDRVG-VAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLR 770          
BLAST of SMED30002664 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 105.145 bits (261), Expect = 1.919e-24
Identity = 59/177 (33.33%), Postives = 90/177 (50.85%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V  FLL N   +D K K   T+LH  +  G  E+   LL   ANPN     G  P+H++   GH++ V++LL+ +A+       G+TP+  AA  G V + ++L  +GA+ N  GK+GLTPLH      +   V +L+  G  P      G T L  A ++  +EV  +   +G S
Sbjct:  423 EVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGAS 599          

HSP 2 Score: 93.2041 bits (230), Expect = 1.802e-20
Identity = 65/229 (28.38%), Postives = 107/229 (46.72%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSA--------KPNATQ----------------------------NNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            N  G N L  A+ +     V+  L N ++ L+   K G TALH  +  G  ++ ++L+  GAN N +   G  P++++    H +VVK LLE  A        KP+A                                G+TP+  AA   ++ + ++L ++GA++NF  K+G+TPLH  +   + + V++LLD GA    + +  LT L CA   G + +I+   D G
Sbjct:   40 NQNGLNGLHLASKEGHVKMVLELLHNGVV-LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQG 267          

HSP 3 Score: 85.8853 bits (211), Expect = 4.414e-18
Identity = 64/241 (26.56%), Postives = 104/241 (43.15%), Query Frame = 1
Query:  175 KINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC-YHNLCMACYHNRSSCNI 894
            K N  +    G+  L  A        +  LL+         K G+T LH  +  G  ++A  LL +GANPN     G  P+H++V + +  VV LL+     P++   NG+TP+  A+ +  V +   L   GA  N +   G+TPLH       A  V +L+   A+  + N+ GLT L    ++G + +       G S           R+G   + + C Y N+ M  +  +   N+
Sbjct:  465 KANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAAT------RMGYTPLHVACHYGNIKMVKFLLQQQANV 699          

HSP 4 Score: 85.8853 bits (211), Expect = 5.071e-18
Identity = 67/221 (30.32%), Postives = 97/221 (43.89%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            MT  GF    +A    Y  +  A  L +     N  G N L  L  A+     DV+  L++         + G+T LH  S     E+AS LL  GA+ N     G  P+HL+   G + +V LL+   A  N    +G TP+   A +GHV I  IL  +GA +    + G TPLH      +   VK LL   A+   +   G T L  A ++G  +++
Sbjct:  504 MTKKGFTPLHVA--AKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIV 722          

HSP 5 Score: 85.5001 bits (210), Expect = 5.772e-18
Identity = 54/148 (36.49%), Postives = 75/148 (50.68%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            T LH  +  G   +A  LL KGA PN R   G  P+H++    H +V+ LLL++SA   A   +G TP+  A+  GH+ IVKIL  KGA  N       TPLH  + +      + LL N A    + +   T+L CA   G  E++K
Sbjct:  312 TPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVK 459          

HSP 6 Score: 85.1149 bits (209), Expect = 8.911e-18
Identity = 65/209 (31.10%), Postives = 89/209 (42.58%), Query Frame = 1
Query:  229 IDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKV---------------------------------VKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            I  +KN   V+  LL +   L+   + G T LH  S  G   I   LL KGA+PN  +   E P+H++   GH +V                                 VKLLLE+ A PN+T   G TP+  AA +GH   V+IL    A      K G TPLH           ++LL+ GA+P    + GLT L  A     ++V+
Sbjct:  349 IACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVV 557          

HSP 7 Score: 82.8037 bits (203), Expect = 5.052e-17
Identity = 55/168 (32.74%), Postives = 81/168 (48.21%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            +V   LLN   ++++  K G T LH  S  G   +   LL +GA  + +      P+H +  NGH +++++LL+  A   A   NG +PI  AA   H+  V+ L    A+I+    D LTPLH           K+LLD GA P  R   G T L  A +K  + V+
Sbjct:  192 NVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVM 359          

HSP 8 Score: 82.0333 bits (201), Expect = 8.387e-17
Identity = 69/230 (30.00%), Postives = 102/230 (44.35%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIY--FLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +T++GF    +A    Y+ L  A  L       N    N +    I SR+ +VI    LL+    +D K K   T LH  + +G   I   LL +GA    +   G  PIH++    H   V+ LL+Y+A+ +    +  TP+  AA  GH  + K+L  KGA  N +  +G TPLH          + +LL + A      E GLT L  A   G + ++K     G S
Sbjct:  174 ITATGFTPLHIA--AHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGAS 401          

HSP 9 Score: 71.2478 bits (173), Expect = 3.125e-13
Identity = 56/230 (24.35%), Postives = 94/230 (40.87%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGAD------------------------------------INFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE-KPINECN--HCRIGNASIRL 837
            + N ID++  N+ G   LH  S +G  ++  +LL  G         G   +H++   G  +VV  L+ Y A  NA    G+TP+  AA + H+ +VK L   GA+                                     +F    G TPLH     ++    ++LL+ GA+     + G+T L  A  +G + +++   D G + + K  +E    HC   N  +R+
Sbjct:   30 IKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRI 259          

HSP 10 Score: 71.2478 bits (173), Expect = 3.125e-13
Identity = 46/139 (33.09%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPL 615
            +G   L  AA + R  D++  L++   +++  NK G T LH V+ +G   IA  L+ +GA+       G  P+H++   G+ K+VK LL+  A  N     G+TP+  AA +GH  IV +L   GA  N    +G + L
Sbjct:  606 QGVTPLHLAAQEGRA-DMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSAL 743          

HSP 11 Score: 70.0922 bits (170), Expect = 9.384e-13
Identity = 44/154 (28.57%), Postives = 70/154 (45.45%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            G+T LH         +   LL   A+       G  P+H++ + GH  +VK+LL+  A PNA+     TP+  A+  GH  + + L    A ++ + KD  T LH          VK+LL++ A+P      G T L  A  +G  + ++   D
Sbjct:  343 GFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLD 496          

HSP 12 Score: 60.4622 bits (145), Expect = 1.066e-9
Identity = 29/89 (32.58%), Postives = 51/89 (57.30%), Query Frame = 1
Query:  298 KIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            ++G+T LH     G  ++   LL + AN N +   G  P+H +   GH+ +V LLL++ A+PN    NG + +A A   G+++++ +LK
Sbjct:  671 RMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVLK 759          

HSP 13 Score: 54.299 bits (129), Expect = 1.223e-7
Identity = 41/138 (29.71%), Postives = 62/138 (44.93%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            T+  + +  G  + A   +  G + N  +  G   +HL+   GH K+V  LL        T   G T +  AA  G   +V  L + GA++N Q + G TPL+          VK LL+NGA+  I  E   +A+  A
Sbjct:   12 TSFLRAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLA 149          
BLAST of SMED30002664 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 98.5969 bits (244), Expect = 5.023e-24
Identity = 60/211 (28.44%), Postives = 102/211 (48.34%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAE 726
            ++ S  ++  LA  G ++ LK      +      D+     L  A  +   +++ FLL+   ++D K+   WT LH  +  G  EI   L++KGA  N  +  G  P+H +      ++  LLLE  A PNAT     TP+  A++KG+  ++++L  + A  N Q  +G T LH     +     K+L+++GA   I N+   T L+ A+
Sbjct:    3 VSVSNLEVCNLAYTGKFEELKKCVLSDRAQASRTDQDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASIYIENKEEKTPLQIAK 213          

HSP 2 Score: 77.7962 bits (190), Expect = 2.085e-16
Identity = 51/156 (32.69%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            TALH     G   I   LL  GA  +++D+    P+H++   G  ++V+ L+   A+ N+   NG TP+ YAASK    I  +L   GAD N   K   TPLH  +   +   +++LL   A   I++  G TAL  A ++  +E  K   + G S
Sbjct:   42 TALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGAS 197          

HSP 3 Score: 72.4034 bits (176), Expect = 1.426e-14
Identity = 50/166 (30.12%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  346 EIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC 843
            E+   +L+  A  +  D      +H +   GH+ +V+ LL+  A+ +   +  WTP+  AAS G   IV+ L SKGA +N   ++G TPLH+           +LL+NGADP   ++   T L  A  KG   +I+       S     +E      GN ++ L C
Sbjct:   21 ELKKCVLSDRAQASRTDQDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSE------GNTALHLAC 180          
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 1.330e-23
Identity = 65/167 (38.92%), Postives = 92/167 (55.09%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALE--CAEEKGAI 741
            D +  LL+N+   +  ++ G TALH  + +G  E+ + L++KGAN N  D      +H + + GH++VVK+LL   A  N     G+TP+  AA+ GHVT+V++L S  A++N     G T LH    +     V  LLD GAD   RNERG TAL    A   GAI
Sbjct:   31 DALIPLLSNV---NVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAI 194          

HSP 2 Score: 78.9518 bits (193), Expect = 1.741e-16
Identity = 55/169 (32.54%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  265 LNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +  D++ ++K   T LH  S +   + A  L+   +N NV D  G   +H + +NG+ ++V LL+   A  NA        + +A   GH  +VK+L S GAD+N++ K G TPLH    S     V++LL   A+    N  G TAL  A   G   V+    D G
Sbjct:    1 LRHAADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAG 169          

HSP 3 Score: 74.3294 bits (181), Expect = 6.502e-15
Identity = 56/195 (28.72%), Postives = 87/195 (44.62%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLA-KGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEK 786
            GN  L  A  + ++ V+  LL+   D  ++N+ G+TALH  +      I  +LL    A+ N +   G+ P+H++  +G     + L++   + +     G TP+  AA  GH  ++  L S GAD   +G  G+ PLH    S  +   + LL  G D    +E G T L  A   G  E I      G    K
Sbjct:  146 GNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGK 340          

HSP 4 Score: 67.0106 bits (162), Expect = 1.584e-12
Identity = 50/171 (29.24%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  169 LSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSK-SAMGVKILLDNGAD 678
            LS +N   +D  G   L  A  +   +++  L++   +++  +K    A+H     G  E+   LL+ GA+ N +D  G  P+H +  +GH  VV+LLL   A+ N     G T +  A   G   +V  L   GAD   + + G T LHF   S   A+ +++L+++ AD
Sbjct:   37 LSNVNV--SDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHAD 205          

HSP 5 Score: 60.8474 bits (146), Expect = 1.559e-10
Identity = 41/162 (25.31%), Postives = 74/162 (45.68%), Query Frame = 1
Query:  193 NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGAD 678
            N+ G   L FAA  +     +  L+N+  D++ ++  G + LH  +  G +  +  L+  G   +  D  G  P+H++   GH  ++  L+   A      ++G  P+  AA  G     + L + G D++   + G T LH      +A  + +LL +GAD
Sbjct:  176 NERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHMTAIHGRFTRSQTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGAD 337          

HSP 6 Score: 50.0618 bits (118), Expect = 4.069e-7
Identity = 46/188 (24.47%), Postives = 82/188 (43.62%), Query Frame = 1
Query:  262 LLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFL-------------------TFSKSAMGVKI-------------------LLDNGADPLIRNERGLTA 711
            L+ N  ++D  +K G T LH  +  G   + + L++ GA+   R + G +P+HL+  +G S   + LL      +A    G T +  AA+ G+   + +L S GAD+    KD    + F+                   ++++ +   +I                   LL NGA+P +R+++G TA
Sbjct:  232 LIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLG--KKDRYGSIAFVQDSGNSRYSCNVRTIAMRQSYNQHSHDTRICEPLICNASAAALHRCLEHLLQNGAEPALRDKQGYTA 417          

HSP 7 Score: 48.9062 bits (115), Expect = 9.587e-7
Identity = 32/120 (26.67%), Postives = 58/120 (48.33%), Query Frame = 1
Query:  253 IYFLLNNIIDLDYKNKIGWTALHKVSCDG---LWEIAS------KLLAKGANPNVRDNFGEY---PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGA 576
            +  LL N  +   ++K G+TA H  +  G     E+ S      +LL       +RD        P+HL+ ++GH + +++LL +  + +    +G  P+  AA++GH   V+ L + GA
Sbjct:  397 LEHLLQNGAEPALRDKQGYTAAHYAAAFGHRLCLELVSPAPALQQLLDMAGAELLRDPDSRSLVSPLHLAAYHGHHQALEVLLRFVGEADLRDGHGRAPLELAAARGHTECVETLLANGA 516          
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 3.661e-23
Identity = 63/188 (33.51%), Postives = 93/188 (49.47%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAK--GANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFS 762
            G+  L+ A      DV   LL N  D+    K G+T LH  S  G  E+A+ LL K   A+P V    G  P+H++    H KV  LLL+  A P++T  NG+TP+  AA K  + + K+L   GA+ N   + G+ PLH       A  V +LL   A   +  + GLTA+  A ++  + V +  +
Sbjct:  502 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILT 689          

HSP 2 Score: 92.4337 bits (228), Expect = 6.481e-21
Identity = 58/179 (32.40%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDN--GADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V+  LL N    +  N  G T LH  S  G  E+   LL  GA   V+    + P+H++   G +++V+LLL+  + PNA   +G TP+ +A+ +GH  +  +L   GADI+   K G TPLH  +         +LL+    ADP +  + GLT L  A      +V     D G S
Sbjct:  417 NVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGAS 595          

HSP 3 Score: 90.8929 bits (224), Expect = 1.612e-20
Identity = 66/218 (30.28%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDG-------LWEIASKLLAK---GANPNVRDNFGEY-----------------------PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L  A     N+++  LL+    +D K + G T LH  +  G       L E  + +LAK   G +P      GE+                       P+H++   GH +V KLLL+   +PNA   NG+TP+  A  K  + ++++L   GA I+   + GLTP+H  +F      V++LL NGA     N RG T L  A   G +EV+K     G
Sbjct:  242 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSG 459          

HSP 4 Score: 90.8929 bits (224), Expect = 1.737e-20
Identity = 61/191 (31.94%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSK--GADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + +V+  LL +   +  K +   T LH  S  G  EI   LL +G++PN     G  P++ +   GH  V  LLLE  A  +     G+TP+  A+  G + +  +L  K   AD    G++GLTPLH  T         +LLD GA P    + G T L  A +K  +EV K   + G
Sbjct:  436 GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELG 626          

HSP 5 Score: 85.5001 bits (210), Expect = 1.047e-18
Identity = 70/246 (28.46%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF-------SDFGISWEKPINECNHC-----------RIGNASIR-LPCYHNLCMACYHNR 879
            E G   L  A+      V+  LL +    D K K+   ALH  +       A+ LL    N +V    G  P+H++   G+  V  LLL   A  + T  NG TP+  AA +G+  +VK+L  +GA I+ + +DGLTPLH    S     +++LL+  A  L + + GL+ L  A +   +  ++          D  + +  P++   HC           R G  + R L  +  L +AC  NR
Sbjct:  141 EDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNR 382          

HSP 6 Score: 84.7297 bits (208), Expect = 2.362e-18
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            + LDY      T LH  +  G + +A  LL +G  PN R   G  P+H++      KV++LLL++ A  + T  +G TPI  A+  GH+ +V++L   GA  N     G TPLH  + +     VK LL +GA   ++     T L  A   G  E+++     G     P
Sbjct:  333 VTLDY-----LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAP 498          

HSP 7 Score: 83.9593 bits (206), Expect = 3.785e-18
Identity = 52/166 (31.33%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            V+  LL +   +    + G T +H  S  G   +   LL  GA+ N  +  GE P+H++   G  +VVK LL+  A+         TP+  A+  G   IV++L  +G+D N     G TPL+F +         +LL+NGAD     ++G T L  A + G +EV
Sbjct:  385 VMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEV 550          

HSP 8 Score: 83.1889 bits (204), Expect = 6.771e-18
Identity = 56/177 (31.64%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            +V   LLN    +D+  + G T LH  +  G   +   LL +GA  + +   G  P+H +  +GH KV+++LLE  A   A   NG +P+  A    H+  V++L  + A ++    D LTPLH           K+LLD G +P  R   G T L  A +K  I+V++     G S
Sbjct:  219 NVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS 395          

HSP 9 Score: 82.0333 bits (201), Expect = 1.767e-17
Identity = 49/144 (34.03%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            G+T LH        ++   LL  GA+ +     G  PIH++ + GH  VV+LLL+  A  NAT   G TP+  A+  G + +VK L   GA +  + ++  TPLH  +    A  V++LL  G+DP      G T L  A  +G
Sbjct:  370 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREG 513          

HSP 10 Score: 81.2629 bits (199), Expect = 3.247e-17
Identity = 57/202 (28.22%), Postives = 93/202 (46.04%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            IN CN +  G N L  A      DV+  LL    ++D   K+G TALH  +  G  +I   L+  GAN N +   G  P++++    H ++VK LL+  A  +    +G+TP+A A  +GH  +V +L     + + +GK  L  LH            +LL +  +  + ++ G T L  A   G + V     + G + +
Sbjct:   37 INTCNQN--GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLL----LESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVD 232          

HSP 11 Score: 78.5666 bits (192), Expect = 2.669e-16
Identity = 47/152 (30.92%), Postives = 78/152 (51.32%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            +D++  N+ G  ALH  S +G  ++ ++LL + A  +     G   +H++   G + +V++L+E+ A  NA   NG+TP+  AA + H+ IVK L   GA+ +   +DG TPL           V +LL++     +R    L AL  A  K
Sbjct:   35 MDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR----LPALHIAARK 182          

HSP 12 Score: 72.0182 bits (175), Expect = 3.911e-14
Identity = 67/227 (29.52%), Postives = 93/227 (40.97%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNND---EGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            +T  GF    +A    Y  L+ A  L +  Y + D    G N L  L  A       V   LL+         K G+T LH  +     E+   LL  GA  N+    G  P+HL+   GH+ +V LLL   A  +     G T +  AA +  V + +IL    AD+N   K   TPLH  +   +   V  LL N A    +   G T L  A ++G   V+ A 
Sbjct:  531 VTKKGFTPLHIAS--KYGRLEVATLLLE-KYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNAL 754          

HSP 13 Score: 69.3218 bits (168), Expect = 2.645e-13
Identity = 54/180 (30.00%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYH 849
            T+  + + +G  E     L  G + N  +  G   +HL+   GH  VV  LL+  A+ +     G T +  AA  G   IV++L   GA+IN Q ++G TPL+          VK LLDNGA+  +  E G T L  A ++G  +V+      G+  E               +RLP  H
Sbjct:   13 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVV------GLLLESDT---------KGKVRLPALH 177          
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 1.001e-22
Identity = 61/186 (32.80%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFS 762
            G+  L+ A      DV   LL N  D+    K G+T LH  S  G  E+A+ LL K A+ + +   G  P+H++    H KV  LLL+  A P++T  NG+TP+  AA K  + + K+L   GA+ N   + G+ PLH       A  V +LL   A   +  + GLTA+  A ++  + V +  +
Sbjct:  509 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILT 694          

HSP 2 Score: 93.5893 bits (231), Expect = 2.075e-21
Identity = 61/189 (32.28%), Postives = 89/189 (47.09%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + +V+  LL +   +  K +   T LH  S  G  EI   LL +G++PN     G  P++ +   GH  V  LLLE  A  +     G+TP+  A+  G + +  +L  K A  + +GK+GLTPLH  T         +LLD GA P    + G T L  A +K  +EV K   + G
Sbjct:  443 GETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELG 631          

HSP 3 Score: 90.5077 bits (223), Expect = 2.225e-20
Identity = 66/218 (30.28%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDG-------LWEIASKLLAK---GANPNVRDNFGEY-----------------------PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L  A     N+++  LL+    +D K + G T LH  +  G       L E  + +LAK   G +P      GE+                       P+H++   GH +V KLLL+   +PNA   NG+TP+  A  K  + ++++L   GA I+   + GLTP+H  +F      V++LL NGA     N RG T L  A   G +EV+K     G
Sbjct:  249 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSG 466          

HSP 4 Score: 83.9593 bits (206), Expect = 3.469e-18
Identity = 62/202 (30.69%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            SK+      E G   L  A      +V   LLN    +D+  + G T LH  +  G   +   LL +GA  + +   G  P+H +  +GH KV+++LLE  A   A   NG +P+  A    H+  V++L  + A ++    D LTPLH           K+LLD G +P  R   G T L  A +K  I+V++     G S
Sbjct:  201 SKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS 402          

HSP 5 Score: 83.9593 bits (206), Expect = 3.735e-18
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKP 789
            + LDY      T LH  +  G + +A  LL +G  PN R   G  P+H++      KV++LLL++ A  + T  +G TPI  A+  GH+ +V++L   GA  N     G TPLH  + +     VK LL +GA   ++     T L  A   G  E+++     G     P
Sbjct:  340 VTLDY-----LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAP 505          

HSP 6 Score: 83.5741 bits (205), Expect = 4.792e-18
Identity = 52/166 (31.33%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            V+  LL +   +    + G T +H  S  G   +   LL  GA+ N  +  GE P+H++   G  +VVK LL+  A+         TP+  A+  G   IV++L  +G+D N     G TPL+F +         +LL+NGAD     ++G T L  A + G +EV
Sbjct:  392 VMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEV 557          

HSP 7 Score: 81.6481 bits (200), Expect = 2.342e-17
Identity = 49/144 (34.03%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG 735
            G+T LH        ++   LL  GA+ +     G  PIH++ + GH  VV+LLL+  A  NAT   G TP+  A+  G + +VK L   GA +  + ++  TPLH  +    A  V++LL  G+DP      G T L  A  +G
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREG 520          

HSP 8 Score: 78.1814 bits (191), Expect = 3.467e-16
Identity = 47/152 (30.92%), Postives = 78/152 (51.32%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEK 732
            +D++  N+ G  ALH  S +G  ++ ++LL + A  +     G   +H++   G + +V++L+E+ A  NA   NG+TP+  AA + H+ IVK L   GA+ +   +DG TPL           V +LL++     +R    L AL  A  K
Sbjct:   34 MDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR----LPALHIAARK 181          

HSP 9 Score: 77.0258 bits (188), Expect = 7.774e-16
Identity = 65/235 (27.66%), Postives = 99/235 (42.13%), Query Frame = 1
Query:  178 INYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL---KSKG----------------------------ADI------NFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            IN CN +  G N L  A      DV+  LL    ++D   K+G TALH  +  G  +I   L+  GAN N +   G  P++++    H ++VK LL+  A  +    +G+TP+A A  +GH  +V +L    +KG                            AD+      N   + G TPLH      +     +LL+ GA        G+T L  A ++G   ++K   D G
Sbjct:   36 INTCNQN--GLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRG 268          

HSP 10 Score: 75.0998 bits (183), Expect = 3.588e-15
Identity = 53/176 (30.11%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  229 IDSR--KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            I SR  K +++  LL    D +     G T L+  S +G  ++AS LL  GA+ +     G  P+H++   G  +V  LLLE  A  +    NG TP+  A    H  +  +L  KGA  +   K+G TPLH           K+LL+ GA+  +  ++G+  L  A ++G  +++
Sbjct:  482 IASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMV 657          

HSP 11 Score: 73.1738 bits (178), Expect = 1.591e-14
Identity = 65/224 (29.02%), Postives = 92/224 (41.07%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            +T  GF    +A    Y  L+ A  L +     + +G N L  L  A       V   LL+         K G+T LH  +     E+   LL  GA  N+    G  P+HL+   GH+ +V LLL   A  +     G T +  AA +  V + +IL    AD+N   K   TPLH  +   +   V  LL N A    +   G T L  A ++G   V+ A 
Sbjct:  538 VTKKGFTPLHIAS--KYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNAL 759          

HSP 12 Score: 68.9366 bits (167), Expect = 3.210e-13
Identity = 54/180 (30.00%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYH 849
            T+  + + +G  E     L  G + N  +  G   +HL+   GH  VV  LL+  A+ +     G T +  AA  G   IV++L   GA+IN Q ++G TPL+          VK LLDNGA+  +  E G T L  A ++G  +V+      G+  E               +RLP  H
Sbjct:   12 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVV------GLLLESDT---------KGKVRLPALH 176          
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 1.436e-21
Identity = 58/189 (30.69%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + +V+  LL N   +D K +   T LH  +  G  EI   LL   A+P+   + G  P+H++   GH  V  +LLE+ A    T   G+TP+  A+  G + +  +L  + A  +  GK+GLTPLH  +   +     +LLD GA P    + G T L  A +K  +E+     ++G
Sbjct:   81 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYG 269          

HSP 2 Score: 85.5001 bits (210), Expect = 1.294e-18
Identity = 61/189 (32.28%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A      DV   LL +   L    K G+T LH  S  G  E+AS LL + A+P+     G  P+H++    + KV  LLL+  A P+AT  NG+TP+  AA K  + I   L   GA+ N   + G+ PLH       A    +LL   AD     + GL+ L  A ++  + V +     G
Sbjct:  147 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHG 335          

HSP 3 Score: 79.337 bits (194), Expect = 1.547e-16
Identity = 67/221 (30.32%), Postives = 93/221 (42.08%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNN---LLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T  GF    +A    Y  ++ A SL    + + D  G N    L  A       V   LL+         K G+T LH  +     EIA+ LL  GA  N     G  P+HL    GH+ V  LLL   A  N    +G +P+  AA +  V + +IL   GA +N   K G TPL       +   V  LL +GAD   + + G T L  A ++G   ++
Sbjct:  177 TKKGFTPLHVAS--KYGKMEVA-SLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIV 394          

HSP 4 Score: 73.559 bits (179), Expect = 1.008e-14
Identity = 47/131 (35.88%), Postives = 66/131 (50.38%), Query Frame = 1
Query:  361 LLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            LL KGANPNVR   G  P+H++      +V++LLL+Y A   A   +G TP+  +A  G++ IV IL   GA  N     G T LH    +     V+ LL NGA    +     T L  A   G +E+++
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQ 131          

HSP 5 Score: 72.7886 bits (177), Expect = 2.312e-14
Identity = 53/175 (30.29%), Postives = 83/175 (47.43%), Query Frame = 1
Query:  229 IDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            I  +KN   V+  LL     ++   + G T +H  +  G   I   LL  GA+PN  +  GE  +H++   G ++VV+ LL   A+ +A      TP+  AA  G + IV++L    A  +    +G TPLH            ILL++GA   +  ++G T L  A + G +EV
Sbjct:   21 IACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEV 195          

HSP 6 Score: 72.4034 bits (176), Expect = 3.095e-14
Identity = 47/169 (27.81%), Postives = 80/169 (47.34%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K +++  LL ++   D     G+T LH  + +G  ++ + LL  GA+  V    G  P+H++   G  +V  LLL+  A P+A   NG TP+  A+   +  +  +L  +GA  +   K+G TPLH             LL+ GA+      +G+  L    ++G  +V
Sbjct:  126 KLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADV 294          

HSP 7 Score: 69.3218 bits (168), Expect = 2.981e-13
Identity = 47/158 (29.75%), Postives = 71/158 (44.94%), Query Frame = 1
Query:  304 GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            G+T LH         +   LL  GA+       G  P+H+S + G+  +V +LL+  A PNAT   G T +  AA  G   +V+ L   GA ++ + ++  TPLH          V++LL + A P      G T L  A  +G  +V     + G S
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGAS 172          

HSP 8 Score: 68.5514 bits (166), Expect = 5.279e-13
Identity = 38/100 (38.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  460 LLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            LL+  A PN    NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F  +   V ILL  GA P   N RG TAL  A   G  EV+++ 
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSL 100          

HSP 9 Score: 65.4698 bits (158), Expect = 4.936e-12
Identity = 48/174 (27.59%), Postives = 81/174 (46.55%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGA---DINFQGKDGLTPLHFLTFSKSAMGVKILLDNG------ADPLIRN--ERGLTALECAEEKG 735
            DV   LL    D+++  K G + LH  + +    +A  L+  GA+ N     G  P+ ++   G+ K+V  LL++ A  N+   NG+TP+  AA +GH  IV +L   GA   D+   G   L     L +      +K++ +        ++P  RN  E     LE ++++G
Sbjct:  293 DVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRNVPETMTEVLEVSDDEG 466          

HSP 10 Score: 57.3806 bits (137), Expect = 2.293e-9
Identity = 39/123 (31.71%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            + G + L  A    K +V   L+ +   ++   K+G+T L  V+C  G  ++ + LL  GA+ N +   G  P+H +   GH+ +V LLL+  A+PN    NG T +A A   G++++V  LK
Sbjct:  310 KSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPL-IVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 431          
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 1.528e-21
Identity = 58/189 (30.69%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A  + + +V+  LL N   +D K +   T LH  +  G  EI   LL   A+P+   + G  P+H++   GH  V  +LLE+ A    T   G+TP+  A+  G + +  +L  + A  +  GK+GLTPLH  +   +     +LLD GA P    + G T L  A +K  +E+     ++G
Sbjct:  171 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYG 359          

HSP 2 Score: 85.5001 bits (210), Expect = 1.374e-18
Identity = 61/189 (32.28%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            G   L  A      DV   LL +   L    K G+T LH  S  G  E+AS LL + A+P+     G  P+H++    + KV  LLL+  A P+AT  NG+TP+  AA K  + I   L   GA+ N   + G+ PLH       A    +LL   AD     + GL+ L  A ++  + V +     G
Sbjct:  237 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHG 425          

HSP 3 Score: 82.4185 bits (202), Expect = 1.527e-17
Identity = 57/159 (35.85%), Postives = 78/159 (49.06%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            I LDY      TALH  +  G +  A  LL KGANPNVR   G  P+H++      +V++LLL+Y A   A   +G TP+  +A  G++ IV IL   GA  N     G T LH    +     V+ LL NGA    +     T L  A   G +E+++
Sbjct:   68 ITLDY-----LTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQ 221          

HSP 4 Score: 79.337 bits (194), Expect = 1.610e-16
Identity = 59/183 (32.24%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEY--PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            L  A  S    V+  LL     +  K K G + LH  +     E    L+   A   V D   +Y   +H++   GH +  K+LL+  A PN    NG+TP+  A  K  + ++++L   GA I    + GLTP+H   F  +   V ILL  GA P   N RG TAL  A   G  EV+++ 
Sbjct:   10 LHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAP--VDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSL 190          

HSP 5 Score: 79.337 bits (194), Expect = 1.640e-16
Identity = 67/221 (30.32%), Postives = 93/221 (42.08%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNN---LLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVI 750
            T  GF    +A    Y  ++ A SL    + + D  G N    L  A       V   LL+         K G+T LH  +     EIA+ LL  GA  N     G  P+HL    GH+ V  LLL   A  N    +G +P+  AA +  V + +IL   GA +N   K G TPL       +   V  LL +GAD   + + G T L  A ++G   ++
Sbjct:  267 TKKGFTPLHVAS--KYGKMEVA-SLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIV 484          

HSP 6 Score: 74.3294 bits (181), Expect = 7.674e-15
Identity = 62/209 (29.67%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  127 AKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKND--VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            A CG Y   +TA  L       N    N      I  +KN   V+  LL     ++   + G T +H  +  G   I   LL  GA+PN  +  GE  +H++   G ++VV+ LL   A+ +A      TP+  AA  G + IV++L    A  +    +G TPLH            ILL++GA   +  ++G T L  A + G +EV
Sbjct:   80 AHCGHY---RTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEV 285          

HSP 7 Score: 72.4034 bits (176), Expect = 3.126e-14
Identity = 44/127 (34.65%), Postives = 63/127 (49.61%), Query Frame = 1
Query:  403 GEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWE 783
            G  P+H +  +GH +VV++LLE  A   A   NG +P+  A    HV  V++L    A ++    D LT LH           K+LLD GA+P +R   G T L  A +K  I V++    +G S E
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIE 132          

HSP 8 Score: 72.4034 bits (176), Expect = 3.271e-14
Identity = 47/169 (27.81%), Postives = 80/169 (47.34%), Query Frame = 1
Query:  241 KNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            K +++  LL ++   D     G+T LH  + +G  ++ + LL  GA+  V    G  P+H++   G  +V  LLL+  A P+A   NG TP+  A+   +  +  +L  +GA  +   K+G TPLH             LL+ GA+      +G+  L    ++G  +V
Sbjct:  216 KLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADV 384          

HSP 9 Score: 64.6994 bits (156), Expect = 9.344e-12
Identity = 39/123 (31.71%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGA---DINFQGKDGL 606
            DV   LL    D+++  K G + LH  + +    +A  L+  GA+ N     G  P+ ++   G+ K+V  LL++ A  N+   NG+TP+  AA +GH  IV +L   GA   D+   G   L
Sbjct:  383 DVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTAL 505          

HSP 10 Score: 57.3806 bits (137), Expect = 2.402e-9
Identity = 39/123 (31.71%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCD-GLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILK 564
            + G + L  A    K +V   L+ +   ++   K+G+T L  V+C  G  ++ + LL  GA+ N +   G  P+H +   GH+ +V LLL+  A+PN    NG T +A A   G++++V  LK
Sbjct:  400 KSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPL-IVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLK 521          
BLAST of SMED30002664 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 66.6254 bits (161), Expect = 1.387e-12
Identity = 47/116 (40.52%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  391 RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKP-NATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKD--GLTPLHFLTFSKSAMG----VKILLDNGADPLIRNERGLTALE 717
            RD+ G   + ++   G   VVK ++E      N   N G T +  AA +GH+ IV++L   GAD+N +  +  G TPL       SA G    VK LL NGADP IRN +GLTA E
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPL----IDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          

HSP 2 Score: 59.3066 bits (142), Expect = 3.207e-10
Identity = 37/111 (33.33%), Postives = 64/111 (57.66%), Query Frame = 1
Query:  289 YKNKIGWTALHKVSCD-GLWEIASKLLAKGA-NPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPN--ATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLT 609
            Y++  G T L +++CD G +++  K++ +G  + N +DN G   +H +   GH ++V+LL+E  A  N  + +  G TP+  A++ GH+ +VK L   GAD   +   GLT
Sbjct:  325 YRDSGGRTRL-QIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434          
BLAST of SMED30002664 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 55.4546 bits (132), Expect = 5.839e-9
Identity = 55/204 (26.96%), Postives = 94/204 (46.08%), Query Frame = 1
Query:  175 KINYCNND----EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYK-NKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQN------NGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            K+   NND    E    L +A+I++R + V+ FL++   D++ +   +  T LH  +  G   I   LL  GA+P + D+ G   +HLSV N  + ++ L + ++       +       G T + +AA +G    V  L   GA I     +G TPLH+ T       +K L+ +GAD   + + G      A+E   +  ++
Sbjct:   96 KLLEVNNDGDSTEHITGLHWASINNRLS-VVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV-NSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          
BLAST of SMED30002664 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 54.299 bits (129), Expect = 1.533e-8
Identity = 32/99 (32.32%), Postives = 57/99 (57.58%), Query Frame = 1
Query:  292 KNKIGWTALHKVS-CDGLWEIASKLLAKGANPNVRDNFGEY-PIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADI 582
            KN  G   LH V+   G  ++   L+  GA+PN  D F ++ PI  +V +GHS+V+  LL+++A+ +   +NG +P+ YA  + HV ++  L  +  ++
Sbjct:  553 KNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          

HSP 2 Score: 46.595 bits (109), Expect = 4.438e-6
Identity = 21/63 (33.33%), Postives = 34/63 (53.97%), Query Frame = 1
Query:  436 GHSKVVKLLLEYSAKPNATQN-NGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF 621
            G  ++++LL+ Y A PN     N WTPI YA   GH  ++  L    A ++ +  +G +PL +
Sbjct:  569 GDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFY 631          
BLAST of SMED30002664 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 49.6766 bits (117), Expect = 2.814e-7
Identity = 51/168 (30.36%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPN--VRDNFGEYPIHLSVWNGHSKVVKLLLEYSAK-PNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNER 699
            GN L+   +  R  D    LL NI   D +N  GW++LH  S  G + I   L+  G + +  ++   G   +HL++  GH + + LLL+   +  N    NG  PI  A    +   + +L   GAD+     +G TPLH      S   +K+LL+ G   L  N R
Sbjct:   16 GNLLIVKRLLRRNPD----LLTNI---DSEN--GWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVR 174          
BLAST of SMED30002664 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 47.7506 bits (112), Expect = 5.465e-7
Identity = 47/159 (29.56%), Postives = 74/159 (46.54%), Query Frame = 1
Query:  157 TAFSLSKINYCN----NDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKI---GWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLL--LEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSK-GADINFQGKDG 603
            T+F LSK+   N     D+ G      A      +V+  L +  +  D  NKI   G T LH       +E++  L+  GA+  ++D F + P+H +   G  K+++LL  L  SA  N     GWTP+ +A ++GH     +L  K GA+ +     G
Sbjct:   52 TSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDL-NKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAV-NWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 2 Score: 46.595 bits (109), Expect = 1.292e-6
Identity = 37/139 (26.62%), Postives = 63/139 (45.32%), Query Frame = 1
Query:  391 RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNA---TQNNGWTPIAYAASKGHVTIVKILKSK--GADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG---ISWE 783
            +D  G  P+H SV     ++   LL      N      ++GWTP   A S G++ +VK L  +    D+N     G+T LH     K     + L++NGA   I+++     L  A   G++++I+     G   ++W+
Sbjct:   32 KDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQ 170          
BLAST of SMED30002664 vs. Ensembl Nematostella
Match: EDO34162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ64])

HSP 1 Score: 75.485 bits (184), Expect = 3.751e-17
Identity = 38/104 (36.54%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  445 KVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKA 756
            +VVK  +   A P A  N GWTP+  A ++G + +VK+L   GAD+N    DG+ PLH          +++LL  GADP++    G TA  CA+E     ++K 
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLAQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNTAYACAKEPKTKRLLKG 104          

HSP 2 Score: 64.3142 bits (155), Expect = 4.421e-13
Identity = 30/78 (38.46%), Postives = 48/78 (61.54%), Query Frame = 1
Query:  346 EIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGAD 579
            E+  + + +GA+P  +DN G  P+H +   G  +VVK+L +Y A  NA  N+G  P+  AA  GHV ++++L + GAD
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLAQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          

HSP 3 Score: 53.9138 bits (128), Expect = 2.059e-9
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 1
Query:  280 DLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASK 534
            D   K+  GWT LH+    G  E+   L   GA+ N   N G  P+H +   GH +V++LLL Y A P      G T  AYA +K
Sbjct:   12 DPTAKDNAGWTPLHEACARGKLEVVKVLAQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNT--AYACAK 94          
BLAST of SMED30002664 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 74.3294 bits (181), Expect = 9.442e-17
Identity = 37/95 (38.95%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  445 KVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE 729
            +VVK  +   A P A  N GWTP+  A ++G + +VK+L   GAD+N    DG+ PLH          +++LL  GADP++    G TA  CA+E
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNTAYACAKE 95          

HSP 2 Score: 65.0846 bits (157), Expect = 1.707e-13
Identity = 30/78 (38.46%), Postives = 49/78 (62.82%), Query Frame = 1
Query:  346 EIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGAD 579
            E+  + + +GA+P  +DN G  P+H +   G  +VVK+L++Y A  NA  N+G  P+  AA  GHV ++++L + GAD
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          

HSP 3 Score: 54.6842 bits (130), Expect = 8.360e-10
Identity = 32/85 (37.65%), Postives = 43/85 (50.59%), Query Frame = 1
Query:  280 DLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASK 534
            D   K+  GWT LH+    G  E+   L+  GA+ N   N G  P+H +   GH +V++LLL Y A P      G T  AYA +K
Sbjct:   12 DPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNT--AYACAK 94          
BLAST of SMED30002664 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 79.337 bits (194), Expect = 1.685e-16
Identity = 63/209 (30.14%), Postives = 94/209 (44.98%), Query Frame = 1
Query:  202 GGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKG-ANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNA 825
            GG+N L   +          LL+N   +D KN    T +H  +  G       LL +  A  N  D     P+HL+  +GH+ VVK LL      +A     WTP+  AA++G V +  IL  + A ++   K   TPLH  +       VK+LL   A+  + +  G   L+ A E    EV  A  D  + W++ +   N C++GNA
Sbjct:  253 GGSNKLILVLRISSQ----LLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH-VDWKQAMR--NRCKLGNA 454          

HSP 2 Score: 51.2174 bits (121), Expect = 3.210e-7
Identity = 36/138 (26.09%), Postives = 62/138 (44.93%), Query Frame = 1
Query:  190 NNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDG 603
             NDE    + +AA   R   V   L  +   ++ ++    T LH  +  G   +  +LL +G   + R+     P+  +   G  +V  +LL+  A  + T     TP+  A+ +GHV +VK+L S+ A+I      G
Sbjct:  279 KNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAG 416          
BLAST of SMED30002664 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 71.2478 bits (173), Expect = 3.306e-15
Identity = 45/134 (33.58%), Postives = 68/134 (50.75%), Query Frame = 1
Query:  361 LLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQN---NGWTPIAYAASKGHVT-IVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN-ERGLTALECAEEKGAIEV 747
            LL  GA  NV   +G  PIH +  NGH++ V++LL Y +  NA         TP+ YAA  GH+   V++L  +G D+    +DG   +H  + +     +  LLD G D   +  ER LTA+  A  +G + +
Sbjct:   16 LLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTM 149          

HSP 2 Score: 59.6918 bits (143), Expect = 4.579e-11
Identity = 42/136 (30.88%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  415 IHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQ-GKD--GLTPLHFLTFSKSAMG-----VKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINE 798
            +H +   G+ K ++LLL+  AK N  Q  GW PI  AA  GH   V++L   G+  N + GK    +TPLH+     + MG     V++L++ G D       G   +  A + G ++V+    D G+  E    E
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHY----AARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYE 132          
BLAST of SMED30002664 vs. Ensembl Nematostella
Match: EDO47126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNE2])

HSP 1 Score: 69.707 bits (169), Expect = 2.621e-13
Identity = 55/186 (29.57%), Postives = 87/186 (46.77%), Query Frame = 1
Query:  250 VIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKV--------VKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKG---AIEVIKAFSDFGI 774
            V+   ++  I +D     GWTAL   +  G  E+   LL++GAN N   +   Y + ++V +    V         +LLLE  A+      +  TP+ YAA +G V++ K L  KGA ++ Q   G T L +         V++LLD  ADP + +  G    + A  KG     E+++A S  G+
Sbjct:  157 VVQKSIDEGIPVDVVLSSGWTALMHAANSGNTELVKNLLSQGANANFHKDM--YTVLMAVCDAAPSVEEEKAFQCCELLLENGARTGVYDRHRITPLMYAARQGRVSLCKKLIEKGAQVDKQDVRGWTALSWAASEGHGRLVRVLLDYKADPQLYSSDGQAPCDIAYSKGHDTIAEILEAASSGGL 340          
BLAST of SMED30002664 vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 103.99 bits (258), Expect = 4.308e-26
Identity = 60/208 (28.85%), Postives = 102/208 (49.04%), Query Frame = 1
Query:  103 SGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAE 726
            S  ++   A  G +D LK      K   C  D+     L  A  +   +++ FLL+  ++++ ++   WT LH  +  G  +I   L++KGA  N  +  G  P+H +      ++  +LLE  A PNAT    WTP+  A++KG+  ++++L  + A  N Q   G TPLH     +     K+L+++GA   I N+   T L+ A+
Sbjct:    6 SNVEVCNYAYTGQFDKLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIAK 213          

HSP 2 Score: 76.6406 bits (187), Expect = 4.757e-16
Identity = 52/156 (33.33%), Postives = 75/156 (48.08%), Query Frame = 1
Query:  310 TALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGIS 777
            TALH     G   I   LL  G   N++D+    P+H++   G   +VK L+   A+ N+   NG TP+ YAASK    I  +L   GAD N   K   TPLH  +   +   +++LL   A   I++ +G T L  A E+  +E  K   + G S
Sbjct:   42 TALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGAS 197          
BLAST of SMED30002664 vs. Ensembl Medaka
Match: ENSORLT00000018863.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 105.916 bits (263), Expect = 9.406e-25
Identity = 63/185 (34.05%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +A      +V+  LL N  +L++++  GWTAL   +  G  ++A  LL KGANPN+   +  YPI  +   GH+++V LLL++ AK N +   G TP+ +AA KGH   V  L + GAD++ +G + +T L           VK LL    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   83 LISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAG 267          

HSP 2 Score: 81.2629 bits (199), Expect = 1.700e-16
Identity = 59/185 (31.89%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + G   L  A +    +++   +    ++D  +   WTAL   + +G  E+  +LL   AN   RD  G   +  + + G + V +LLLE  A PN T      PI +AA +GH  IV +L   GA +N   K G TPL +         V  LL NGAD        +TAL  A   G  EV+K
Sbjct:   44 DNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVK 228          

HSP 3 Score: 80.4925 bits (197), Expect = 3.358e-16
Identity = 62/202 (30.69%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   D +  LL N  D+D +     TAL      G  E+  +LL +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K AD++ +G+DG T L++     +A+ V+ +L    D     + G T L  A +   IE+++   D G
Sbjct:  169 AKVN-CSDKYGTTPLIWAA---RKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKG 366          

HSP 4 Score: 65.0846 bits (157), Expect = 3.848e-11
Identity = 53/179 (29.61%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     +V+  LL    +++  +K G TAL   + +G  EI   LL  G   N+ D  GE  +  +V  GH ++V+ LL   A  +    +G T + +A  KG+  +V+ +     D     K+G TPL   T  ++   V++LLD GA     + +G T L  A
Sbjct:  205 DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 5 Score: 59.3066 bits (142), Expect = 2.710e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ +VR   G+  ++ +V  G++ +V+ +L+ +    +    G TP+  A    ++ IV++L  KGA ++   + G TPLH     +S    ++LL N  D   L R N+ G T   ++C  +K  +  I
Sbjct:  241 DKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQI 430          
BLAST of SMED30002664 vs. Ensembl Medaka
Match: ENSORLT00000022722.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 105.916 bits (263), Expect = 9.416e-25
Identity = 63/185 (34.05%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +A      +V+  LL N  +L++++  GWTAL   +  G  ++A  LL KGANPN+   +  YPI  +   GH+++V LLL++ AK N +   G TP+ +AA KGH   V  L + GAD++ +G + +T L           VK LL    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   83 LISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAG 267          

HSP 2 Score: 81.2629 bits (199), Expect = 1.702e-16
Identity = 59/185 (31.89%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + G   L  A +    +++   +    ++D  +   WTAL   + +G  E+  +LL   AN   RD  G   +  + + G + V +LLLE  A PN T      PI +AA +GH  IV +L   GA +N   K G TPL +         V  LL NGAD        +TAL  A   G  EV+K
Sbjct:   44 DNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVK 228          

HSP 3 Score: 80.4925 bits (197), Expect = 3.362e-16
Identity = 62/202 (30.69%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   D +  LL N  D+D +     TAL      G  E+  +LL +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K AD++ +G+DG T L++     +A+ V+ +L    D     + G T L  A +   IE+++   D G
Sbjct:  169 AKVN-CSDKYGTTPLIWAA---RKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKG 366          

HSP 4 Score: 65.0846 bits (157), Expect = 3.851e-11
Identity = 53/179 (29.61%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     +V+  LL    +++  +K G TAL   + +G  EI   LL  G   N+ D  GE  +  +V  GH ++V+ LL   A  +    +G T + +A  KG+  +V+ +     D     K+G TPL   T  ++   V++LLD GA     + +G T L  A
Sbjct:  205 DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 5 Score: 59.3066 bits (142), Expect = 2.712e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ +VR   G+  ++ +V  G++ +V+ +L+ +    +    G TP+  A    ++ IV++L  KGA ++   + G TPLH     +S    ++LL N  D   L R N+ G T   ++C  +K  +  I
Sbjct:  241 DKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQI 430          
BLAST of SMED30002664 vs. Ensembl Medaka
Match: ENSORLT00000018862.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 105.916 bits (263), Expect = 9.425e-25
Identity = 63/185 (34.05%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +A      +V+  LL N  +L++++  GWTAL   +  G  ++A  LL KGANPN+   +  YPI  +   GH+++V LLL++ AK N +   G TP+ +AA KGH   V  L + GAD++ +G + +T L           VK LL    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   83 LISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAG 267          

HSP 2 Score: 81.2629 bits (199), Expect = 1.704e-16
Identity = 59/185 (31.89%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + G   L  A +    +++   +    ++D  +   WTAL   + +G  E+  +LL   AN   RD  G   +  + + G + V +LLLE  A PN T      PI +AA +GH  IV +L   GA +N   K G TPL +         V  LL NGAD        +TAL  A   G  EV+K
Sbjct:   44 DNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVK 228          

HSP 3 Score: 80.4925 bits (197), Expect = 3.365e-16
Identity = 62/202 (30.69%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   D +  LL N  D+D +     TAL      G  E+  +LL +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K AD++ +G+DG T L++     +A+ V+ +L    D     + G T L  A +   IE+++   D G
Sbjct:  169 AKVN-CSDKYGTTPLIWAA---RKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKG 366          

HSP 4 Score: 65.0846 bits (157), Expect = 3.854e-11
Identity = 53/179 (29.61%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     +V+  LL    +++  +K G TAL   + +G  EI   LL  G   N+ D  GE  +  +V  GH ++V+ LL   A  +    +G T + +A  KG+  +V+ +     D     K+G TPL   T  ++   V++LLD GA     + +G T L  A
Sbjct:  205 DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 5 Score: 59.3066 bits (142), Expect = 2.714e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ +VR   G+  ++ +V  G++ +V+ +L+ +    +    G TP+  A    ++ IV++L  KGA ++   + G TPLH     +S    ++LL N  D   L R N+ G T   ++C  +K  +  I
Sbjct:  241 DKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQI 430          
BLAST of SMED30002664 vs. Ensembl Medaka
Match: ENSORLT00000033617.1 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 105.916 bits (263), Expect = 9.443e-25
Identity = 63/185 (34.05%), Postives = 100/185 (54.05%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            L +A      +V+  LL N  +L++++  GWTAL   +  G  ++A  LL KGANPN+   +  YPI  +   GH+++V LLL++ AK N +   G TP+ +AA KGH   V  L + GAD++ +G + +T L           VK LL    +  + ++ G TAL  A ++G  E+++   D G
Sbjct:   83 LISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAG 267          

HSP 2 Score: 81.2629 bits (199), Expect = 1.707e-16
Identity = 59/185 (31.89%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            + G   L  A +    +++   +    ++D  +   WTAL   + +G  E+  +LL   AN   RD  G   +  + + G + V +LLLE  A PN T      PI +AA +GH  IV +L   GA +N   K G TPL +         V  LL NGAD        +TAL  A   G  EV+K
Sbjct:   44 DNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVK 228          

HSP 3 Score: 80.4925 bits (197), Expect = 3.371e-16
Identity = 62/202 (30.69%), Postives = 101/202 (50.00%), Query Frame = 1
Query:  172 SKINYCNNDEGGNNLLFAAIDSRKN--DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            +K+N C++  G   L++AA   RK   D +  LL N  D+D +     TAL      G  E+  +LL +  N N+ D  G   + ++   GH+++V+ LL+     N    NG T +  A   GHV IV+ L +K AD++ +G+DG T L++     +A+ V+ +L    D     + G T L  A +   IE+++   D G
Sbjct:  169 AKVN-CSDKYGTTPLIWAA---RKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKG 366          

HSP 4 Score: 65.0846 bits (157), Expect = 3.860e-11
Identity = 53/179 (29.61%), Postives = 86/179 (48.04%), Query Frame = 1
Query:  193 NDEGGNNL--LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            + EG N++  L  A+     +V+  LL    +++  +K G TAL   + +G  EI   LL  G   N+ D  GE  +  +V  GH ++V+ LL   A  +    +G T + +A  KG+  +V+ +     D     K+G TPL   T  ++   V++LLD GA     + +G T L  A
Sbjct:  205 DQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIA 383          

HSP 5 Score: 59.3066 bits (142), Expect = 2.718e-9
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  196 DEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADP--LIR-NERGLTA--LECAEEKGAIEVI 750
            D+ GN  L  A      +++  LL+    ++  ++ G T L      G  EI   LL K A+ +VR   G+  ++ +V  G++ +V+ +L+ +    +    G TP+  A    ++ IV++L  KGA ++   + G TPLH     +S    ++LL N  D   L R N+ G T   ++C  +K  +  I
Sbjct:  241 DKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCTHQKSILTQI 430          
BLAST of SMED30002664 vs. Planmine SMEST
Match: SMESG000002943.1 (SMESG000002943.1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 265/268 (98.88%), Postives = 268/268 (100.00%), Query Frame = 1
Query:   94 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYHNLCMACYHNRSSCNIC 897
            MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEE+GAI++IKAFSDFGISWEKPINECNHCRIGNASIRLPCYHNLCMACYHNRSSCNIC
Sbjct:    1 MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEERGAIDIIKAFSDFGISWEKPINECNHCRIGNASIRLPCYHNLCMACYHNRSSCNIC 268          
BLAST of SMED30002664 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 102.834 bits (255), Expect = 7.460e-24
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLL-AKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            L  A    ++++   LL +    D K K G+T LH  S  G  ++A +LL +   NPN   + G  P+H++ +  H ++++LLL+  A  N    NG+TP+   A K  + + K+L  +GA++N Q + G TPLH  + + +   +++LLD  AD   + E GLTAL  A EK   ++++  
Sbjct:  589 LHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQL 770          

HSP 2 Score: 86.2705 bits (212), Expect = 3.141e-18
Identity = 67/249 (26.91%), Postives = 109/249 (43.78%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL----------------KSKGADIN--------------FQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            T       + A+ G+ + +K           +N  G N +  AA +  + +V+  L+ N + +D   + G T+LH  S  G  E+ S LL   AN NV+   G  P++++    H  VVK+LLEY A    T ++G+TP+A A  +G+  +V+IL                 +K  D+N               Q   G TPLH      +    K+L++  AD     +  +T L  A + G  E++K
Sbjct:   90 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNR-EVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLK 337          

HSP 3 Score: 84.7297 bits (208), Expect = 8.366e-18
Identity = 59/191 (30.89%), Postives = 96/191 (50.26%), Query Frame = 1
Query:  208 NNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVK-ILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            N L  AA ++++      LL+   + + + +   T LH     G + I  +LL  GA+PN+  +DN+    +H++   G  ++ +LLLE+  KP+A    G+TP+  A+  G V + + +L S   + N  G  GLTPLH  T+      +++LLD  A+     + G T L    +K  IEV K   D G
Sbjct:  520 NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNY--TALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG 708          

HSP 4 Score: 83.9593 bits (206), Expect = 1.751e-17
Identity = 64/224 (28.57%), Postives = 105/224 (46.88%), Query Frame = 1
Query:   97 TSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            T  GF    +A K G     +     +K+N  +    G   L  A      ++I  LL+   +++   K G+T LH V+   + E+   L+ +GAN N +   G  P+HL+   G+ ++++LLL+ +A  N    NG T +  AA K    IV+ L    ADI+ + + G T LH          VK+LL+   D   +   G T+L  A ++G I +++   D
Sbjct:  615 TKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLD 838          

HSP 5 Score: 80.1073 bits (196), Expect = 2.851e-16
Identity = 69/229 (30.13%), Postives = 111/229 (48.47%), Query Frame = 1
Query:   97 TSSGFK-IYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGI 774
            + +GF  +Y  A+    D +K             D+G   L  A +    + V+  LL+N    D ++K+   ALH  +       AS LL   ++ NV  +   G  P+H++    +  V KLL+E +A  N    N  TP+  AA  G   ++K+L S+ A++N   +DGL+P+H    S     + ILL+NGAD   +++ GLTAL+ A +    EV +   + GI
Sbjct:  188 SQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVA-LQQGNDKVVQILLDN----DSRSKVRLPALHIAAKKDDVNAAS-LLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGI 410          

HSP 6 Score: 67.781 bits (164), Expect = 3.693e-12
Identity = 63/215 (29.30%), Postives = 88/215 (40.93%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADI----------------------------------NFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G   L  A    + +V   L+N  ID+D       TALH  +  G    A  LL    N N R   G  P+H++     SK+V+LL++Y A  N+T   G TP+  AA  G   IV IL   GA I                                  N + ++  TPLH      +   V+ LL+ GADP +  +   TAL  A ++G  E+
Sbjct:  386 GLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEI 600          

HSP 7 Score: 66.2402 bits (160), Expect = 1.185e-11
Identity = 54/174 (31.03%), Postives = 84/174 (48.28%), Query Frame = 1
Query:  229 IDSRKNDV--IYFLLNNIID-LDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAI 741
            I ++K+DV     L+ +  D +D+++  G+T LH  +      +A  L+ K A+ N        P+H++   G  +++KLL+   A  N+   +G +PI  AA  G   I+ IL   GADI  + K+GLT L   T    A   + L++ G D        LTAL  A   G I
Sbjct:  259 IAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNI 432          

HSP 8 Score: 65.0846 bits (157), Expect = 2.645e-11
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  313 ALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYH 849
            A  + +  G  E   + L     P++ +  G   +HL+   G+ +VV+LL+E     +     G T +  A+  G + +V +L    A+IN + ++G TPL+          VK+LL+ GA+  I  + G T L  A ++G  +V++   D            N  R   + +RLP  H
Sbjct:   95 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLD------------NDSR---SKVRLPALH 258          

HSP 9 Score: 60.4622 bits (145), Expect = 7.616e-10
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL 561
            E G   L  A +  + D++  LL    D+  K ++G+TALH     G  +    LL K  + N + N G   +HL+   GH  +V+LLL+     N     G T +  A  + ++ I + L
Sbjct:  749 ENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 869          

HSP 10 Score: 55.0694 bits (131), Expect = 4.684e-8
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            +V   L+    D+++  K   T LH  +  G  E+   L+++ AN N     G  PIH +  +G   ++ +LLE  A       NG T +  A       + + L +KG D++    D LT LH      +    ++LL N  +   R   G T L  A
Sbjct:  301 NVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIA 459          
BLAST of SMED30002664 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 102.834 bits (255), Expect = 7.614e-24
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLL-AKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            L  A    ++++   LL +    D K K G+T LH  S  G  ++A +LL +   NPN   + G  P+H++ +  H ++++LLL+  A  N    NG+TP+   A K  + + K+L  +GA++N Q + G TPLH  + + +   +++LLD  AD   + E GLTAL  A EK   ++++  
Sbjct:  509 LHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQL 690          

HSP 2 Score: 88.5817 bits (218), Expect = 5.422e-19
Identity = 68/251 (27.09%), Postives = 111/251 (44.22%), Query Frame = 1
Query:   91 SMTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL----------------KSKGADIN--------------FQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            S+T       + A+ G+ + +K           +N  G N +  AA +  + +V+  L+ N + +D   + G T+LH  S  G  E+ S LL   AN NV+   G  P++++    H  VVK+LLEY A    T ++G+TP+A A  +G+  +V+IL                 +K  D+N               Q   G TPLH      +    K+L++  AD     +  +T L  A + G  E++K
Sbjct:    8 SLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNR-EVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLK 257          

HSP 3 Score: 84.7297 bits (208), Expect = 8.860e-18
Identity = 59/191 (30.89%), Postives = 96/191 (50.26%), Query Frame = 1
Query:  208 NNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVK-ILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            N L  AA ++++      LL+   + + + +   T LH     G + I  +LL  GA+PN+  +DN+    +H++   G  ++ +LLLE+  KP+A    G+TP+  A+  G V + + +L S   + N  G  GLTPLH  T+      +++LLD  A+     + G T L    +K  IEV K   D G
Sbjct:  440 NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNY--TALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG 628          

HSP 4 Score: 83.9593 bits (206), Expect = 1.542e-17
Identity = 64/224 (28.57%), Postives = 105/224 (46.88%), Query Frame = 1
Query:   97 TSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            T  GF    +A K G     +     +K+N  +    G   L  A      ++I  LL+   +++   K G+T LH V+   + E+   L+ +GAN N +   G  P+HL+   G+ ++++LLL+ +A  N    NG T +  AA K    IV+ L    ADI+ + + G T LH          VK+LL+   D   +   G T+L  A ++G I +++   D
Sbjct:  535 TKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLD 758          

HSP 5 Score: 80.1073 bits (196), Expect = 2.779e-16
Identity = 69/229 (30.13%), Postives = 111/229 (48.47%), Query Frame = 1
Query:   97 TSSGFK-IYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGI 774
            + +GF  +Y  A+    D +K             D+G   L  A +    + V+  LL+N    D ++K+   ALH  +       AS LL   ++ NV  +   G  P+H++    +  V KLL+E +A  N    N  TP+  AA  G   ++K+L S+ A++N   +DGL+P+H    S     + ILL+NGAD   +++ GLTAL+ A +    EV +   + GI
Sbjct:  108 SQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVA-LQQGNDKVVQILLDN----DSRSKVRLPALHIAAKKDDVNAAS-LLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGI 330          

HSP 6 Score: 67.781 bits (164), Expect = 3.571e-12
Identity = 63/215 (29.30%), Postives = 88/215 (40.93%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADI----------------------------------NFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G   L  A    + +V   L+N  ID+D       TALH  +  G    A  LL    N N R   G  P+H++     SK+V+LL++Y A  N+T   G TP+  AA  G   IV IL   GA I                                  N + ++  TPLH      +   V+ LL+ GADP +  +   TAL  A ++G  E+
Sbjct:  306 GLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEI 520          

HSP 7 Score: 66.2402 bits (160), Expect = 1.178e-11
Identity = 48/154 (31.17%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  280 DLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAI 741
            ++D+++  G+T LH  +      +A  L+ K A+ N        P+H++   G  +++KLL+   A  N+   +G +PI  AA  G   I+ IL   GADI  + K+GLT L   T    A   + L++ G D        LTAL  A   G I
Sbjct:  199 NVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNI 352          

HSP 8 Score: 65.0846 bits (157), Expect = 2.490e-11
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  313 ALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYH 849
            A  + +  G  E   + L     P++ +  G   +HL+   G+ +VV+LL+E     +     G T +  A+  G + +V +L    A+IN + ++G TPL+          VK+LL+ GA+  I  + G T L  A ++G  +V++   D            N  R   + +RLP  H
Sbjct:   15 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLD------------NDSR---SKVRLPALH 178          

HSP 9 Score: 60.8474 bits (146), Expect = 7.369e-10
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL 561
            E G   L  A +  + D++  LL    D+  K ++G+TALH     G  +    LL K  + N + N G   +HL+   GH  +V+LLL+     N     G T +  A  + ++ I + L
Sbjct:  669 ENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 789          

HSP 10 Score: 55.0694 bits (131), Expect = 4.699e-8
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            +V   L+    D+++  K   T LH  +  G  E+   L+++ AN N     G  PIH +  +G   ++ +LLE  A       NG T +  A       + + L +KG D++    D LT LH      +    ++LL N  +   R   G T L  A
Sbjct:  221 NVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIA 379          
BLAST of SMED30002664 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 102.834 bits (255), Expect = 7.804e-24
Identity = 59/182 (32.42%), Postives = 99/182 (54.40%), Query Frame = 1
Query:  217 LFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLL-AKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            L  A    ++++   LL +    D K K G+T LH  S  G  ++A +LL +   NPN   + G  P+H++ +  H ++++LLL+  A  N    NG+TP+   A K  + + K+L  +GA++N Q + G TPLH  + + +   +++LLD  AD   + E GLTAL  A EK   ++++  
Sbjct:  569 LHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQL 750          

HSP 2 Score: 85.8853 bits (211), Expect = 3.504e-18
Identity = 67/249 (26.91%), Postives = 109/249 (43.78%), Query Frame = 1
Query:   97 TSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL----------------KSKGADIN--------------FQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIK 753
            T       + A+ G+ + +K           +N  G N +  AA +  + +V+  L+ N + +D   + G T+LH  S  G  E+ S LL   AN NV+   G  P++++    H  VVK+LLEY A    T ++G+TP+A A  +G+  +V+IL                 +K  D+N               Q   G TPLH      +    K+L++  AD     +  +T L  A + G  E++K
Sbjct:   70 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNR-EVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLK 317          

HSP 3 Score: 84.7297 bits (208), Expect = 8.746e-18
Identity = 59/191 (30.89%), Postives = 96/191 (50.26%), Query Frame = 1
Query:  208 NNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVK-ILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFG 771
            N L  AA ++++      LL+   + + + +   T LH     G + I  +LL  GA+PN+  +DN+    +H++   G  ++ +LLLE+  KP+A    G+TP+  A+  G V + + +L S   + N  G  GLTPLH  T+      +++LLD  A+     + G T L    +K  IEV K   D G
Sbjct:  500 NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNY--TALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG 688          

HSP 4 Score: 83.9593 bits (206), Expect = 1.847e-17
Identity = 64/224 (28.57%), Postives = 105/224 (46.88%), Query Frame = 1
Query:   97 TSSGFKIYQLA-KCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSD 765
            T  GF    +A K G     +     +K+N  +    G   L  A      ++I  LL+   +++   K G+T LH V+   + E+   L+ +GAN N +   G  P+HL+   G+ ++++LLL+ +A  N    NG T +  AA K    IV+ L    ADI+ + + G T LH          VK+LL+   D   +   G T+L  A ++G I +++   D
Sbjct:  595 TKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLD 818          

HSP 5 Score: 80.1073 bits (196), Expect = 3.063e-16
Identity = 69/229 (30.13%), Postives = 111/229 (48.47%), Query Frame = 1
Query:   97 TSSGFK-IYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNV--RDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGI 774
            + +GF  +Y  A+    D +K             D+G   L  A +    + V+  LL+N    D ++K+   ALH  +       AS LL   ++ NV  +   G  P+H++    +  V KLL+E +A  N    N  TP+  AA  G   ++K+L S+ A++N   +DGL+P+H    S     + ILL+NGAD   +++ GLTAL+ A +    EV +   + GI
Sbjct:  168 SQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVA-LQQGNDKVVQILLDN----DSRSKVRLPALHIAAKKDDVNAAS-LLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGI 390          

HSP 6 Score: 67.781 bits (164), Expect = 4.073e-12
Identity = 63/215 (29.30%), Postives = 88/215 (40.93%), Query Frame = 1
Query:  205 GNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADI----------------------------------NFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEV 747
            G   L  A    + +V   L+N  ID+D       TALH  +  G    A  LL    N N R   G  P+H++     SK+V+LL++Y A  N+T   G TP+  AA  G   IV IL   GA I                                  N + ++  TPLH      +   V+ LL+ GADP +  +   TAL  A ++G  E+
Sbjct:  366 GLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEI 580          

HSP 7 Score: 65.855 bits (159), Expect = 1.355e-11
Identity = 54/174 (31.03%), Postives = 84/174 (48.28%), Query Frame = 1
Query:  229 IDSRKNDV--IYFLLNNIID-LDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAI 741
            I ++K+DV     L+ +  D +D+++  G+T LH  +      +A  L+ K A+ N        P+H++   G  +++KLL+   A  N+   +G +PI  AA  G   I+ IL   GADI  + K+GLT L   T    A   + L++ G D        LTAL  A   G I
Sbjct:  239 IAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNI 412          

HSP 8 Score: 65.0846 bits (157), Expect = 2.813e-11
Identity = 47/179 (26.26%), Postives = 81/179 (45.25%), Query Frame = 1
Query:  313 ALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPCYH 849
            A  + +  G  E   + L     P++ +  G   +HL+   G+ +VV+LL+E     +     G T +  A+  G + +V +L    A+IN + ++G TPL+          VK+LL+ GA+  I  + G T L  A ++G  +V++   D            N  R   + +RLP  H
Sbjct:   75 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLD------------NDSR---SKVRLPALH 238          

HSP 9 Score: 60.4622 bits (145), Expect = 7.953e-10
Identity = 35/121 (28.93%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  199 EGGNNLLFAAIDSRKNDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKIL 561
            E G   L  A +  + D++  LL    D+  K ++G+TALH     G  +    LL K  + N + N G   +HL+   GH  +V+LLL+     N     G T +  A  + ++ I + L
Sbjct:  729 ENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 849          

HSP 10 Score: 55.0694 bits (131), Expect = 5.204e-8
Identity = 43/159 (27.04%), Postives = 68/159 (42.77%), Query Frame = 1
Query:  247 DVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECA 723
            +V   L+    D+++  K   T LH  +  G  E+   L+++ AN N     G  PIH +  +G   ++ +LLE  A       NG T +  A       + + L +KG D++    D LT LH      +    ++LL N  +   R   G T L  A
Sbjct:  281 NVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIA 439          
BLAST of SMED30002664 vs. Planmine SMEST
Match: SMESG000019959.1 (SMESG000019959.1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.736e-22
Identity = 52/161 (32.30%), Postives = 84/161 (52.17%), Query Frame = 1
Query:  277 IDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAF 759
            +D    +K G+  +H    DG  E+A  LL +  N       G+ PIH + W GHS++VKLLL+ +        +G  PI YA+ +GH  IVK+L  +  +   + K G+ P+H+ +++  +  VK+LLD   +    NE G   +  A  +G  E++K F
Sbjct:   28 VDKIVDDKYGYFPIHIACRDGFVEVAKLLLDRNCNTICETKSGDRPIHYASWQGHSEIVKLLLDRNCNTECENESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLF 188          

HSP 2 Score: 80.8777 bits (198), Expect = 1.446e-16
Identity = 43/126 (34.13%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  244 NDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHF 621
            ++++  LL+   + + +N+ G   +H  S  G  EI   LL +  N       G  PIH + WNGHS++VKLLL+ +        +G  PI YA+ +GH  IVK+   +   I+ + KDG +PL F
Sbjct:   83 SEIVKLLLDRNCNTECENESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLFLQRKCRIDCKNKDGKSPLDF 208          

HSP 3 Score: 80.8777 bits (198), Expect = 1.630e-16
Identity = 46/159 (28.93%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  292 KNKIGWTALHKVSCDGLWEIASKLLAKGANPNVRDNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHVTIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRNERGLTALECAEEKGAIEVIKAFSDF 768
            + K G   +H  S  G  EI   LL +  N    +  G  PIH + W GHS++VKLLL+ +        +G  PI YA+  GH  IVK+L  +  +   + + G  P+H+ +    +  VK+ L        +N+ G + L+ A+E   ++ +K  ++ 
Sbjct:   66 ETKSGDRPIHYASWQGHSEIVKLLLDRNCNTECENESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLFLQRKCRIDCKNKDGKSPLDFAKEYNRVDCMKLLTNM 224          
The following BLAST results are available for this feature:
BLAST of SMED30002664 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKK11.393e-2331.86ankyrin repeat and kinase domain containing 1 [Sou... [more]
ANK39.797e-2331.75ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK39.803e-2331.75ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.062e-2231.75ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK21.477e-2234.03ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of SMED30002664 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-444.030e-2231.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.030e-2231.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.038e-2231.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.038e-2231.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.047e-2231.74AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30002664 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank6.088e-2032.80gene:FBgn0011747 transcript:FBtr0089172[more]
Ank6.088e-2032.80gene:FBgn0011747 transcript:FBtr0300497[more]
Ank6.088e-2032.80gene:FBgn0011747 transcript:FBtr0089171[more]
Ank6.088e-2032.80gene:FBgn0011747 transcript:FBtr0089173[more]
Ank21.227e-1930.29gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of SMED30002664 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a1.604e-2635.50ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.604e-2635.50ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.11.620e-2635.50ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
BX469921.11.766e-2635.50ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
ank3a1.767e-2635.50ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of SMED30002664 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd101.250e-2531.88proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
rab4b4.039e-2433.50RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b4.041e-2433.50RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b4.044e-2433.50RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b4.059e-2433.50RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank31.133e-2231.22ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.136e-2231.22ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.141e-2231.22ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.152e-2231.22ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.153e-2231.22ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of SMED30002664 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NFD2|ANKK1_HUMAN6.691e-2331.86Ankyrin repeat and protein kinase domain-containin... [more]
sp|Q7T163|KDISB_DANRE1.639e-2234.95Kinase D-interacting substrate of 220 kDa B OS=Dan... [more]
sp|O70511|ANK3_RAT3.374e-2231.75Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN5.102e-2231.75Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q54F46|WARA_DICDI7.587e-2233.85Homeobox protein Wariai OS=Dictyostelium discoideu... [more]
back to top
BLAST of SMED30002664 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T9WJQ39.732e-3837.95ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A1W6JWK54.248e-3547.56Uncharacterized protein OS=Acidianus manzaensis OX... [more]
C3NIT96.892e-3438.86Ankyrin OS=Sulfolobus islandicus (strain Y.N.15.51... [more]
V4JZM17.405e-3135.51Ankyrin repeat OS=uncultured Acidilobus sp. MG OX=... [more]
A0A4Q4WH961.313e-3040.00ANK_REP_REGION domain-containing protein OS=Monosp... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a1.042e-2536.51ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.054e-2536.51ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.140e-2536.51ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank1a1.919e-2433.33ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
psmd105.023e-2428.44proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007954.11.330e-2338.92pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000000095.13.661e-2333.51pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.11.001e-2232.80pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007449.11.436e-2130.69pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.11.528e-2130.69pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS41.387e-1240.52Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR15.839e-926.96Palmitoyl transferase involved in protein palmitoy... [more]
PHO811.533e-832.32Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AVO22.814e-730.36Component of a complex containing the Tor2p kinase... [more]
NAS65.465e-729.56Evolutionarily conserved 19S regulatory particle a... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO341623.751e-1736.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341619.442e-1738.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.685e-1630.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460993.306e-1533.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471262.621e-1329.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002664 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd104.308e-2628.85proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ENSORLT00000018863.29.406e-2534.05kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000022722.29.416e-2534.05kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018862.29.425e-2534.05kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000033617.19.443e-2534.05kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of SMED30002664 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002943.10.000e+098.88SMESG000002943.1[more]
SMESG000026655.17.460e-2432.42SMESG000026655.1[more]
SMESG000026655.17.614e-2432.42SMESG000026655.1[more]
SMESG000026655.17.804e-2432.42SMESG000026655.1[more]
SMESG000019959.13.736e-2232.30SMESG000019959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002664 ID=SMED30002664|Name=SMED30002664|organism=Schmidtea mediterranea sexual|type=transcript|length=978bp
CAATCAGATCGCAGTTATGTAATTAGTTGTCAATCTGTCGCTAGCAAAAT
ATGATATGACCACTTATTAATTCTGTAATAAATCAGATAGTCAATGACCT
CTTCGGGATTTAAAATTTATCAATTGGCTAAGTGTGGAGATTATGATGGC
TTAAAAACAGCCTTTTCTCTCAGTAAAATCAACTATTGCAATAATGATGA
GGGAGGCAACAATTTGCTCTTTGCAGCGATTGATTCGAGAAAGAATGACG
TGATATATTTTTTACTTAACAATATTATTGATCTTGATTATAAAAATAAA
ATTGGGTGGACAGCACTTCACAAAGTTTCCTGCGATGGATTATGGGAAAT
TGCATCGAAATTGTTAGCAAAAGGGGCCAATCCAAATGTTAGAGATAATT
TCGGTGAATATCCAATTCATCTTTCAGTATGGAATGGCCATAGCAAAGTT
GTGAAGCTTTTATTGGAATATTCTGCTAAGCCTAATGCAACACAGAATAA
TGGATGGACTCCAATAGCTTATGCGGCATCAAAAGGTCATGTAACTATCG
TGAAAATATTGAAATCCAAAGGAGCAGATATCAATTTTCAGGGAAAAGAT
GGACTCACTCCTCTACATTTTCTAACATTTTCAAAATCAGCGATGGGTGT
AAAGATTCTCTTAGATAATGGTGCTGATCCACTCATTAGGAATGAAAGAG
GTCTAACAGCACTCGAGTGTGCTGAAGAAAAGGGAGCTATCGAAGTAATC
AAAGCCTTTTCGGATTTCGGTATTTCATGGGAGAAACCTATCAATGAATG
CAACCATTGCAGAATAGGAAATGCCTCCATCAGATTGCCATGCTACCATA
ATTTATGCATGGCCTGCTACCACAATCGCTCATCCTGTAATATTTGTTCA
ACCCTACTCTACAACACCTCTCTTTAATTATTAAATTTTCATTTTATCAA
AATAAAATATTTCTTTATCAAAAAAAAA
back to top

protein sequence of SMED30002664-orf-1

>SMED30002664-orf-1 ID=SMED30002664-orf-1|Name=SMED30002664-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MTSSGFKIYQLAKCGDYDGLKTAFSLSKINYCNNDEGGNNLLFAAIDSRK
NDVIYFLLNNIIDLDYKNKIGWTALHKVSCDGLWEIASKLLAKGANPNVR
DNFGEYPIHLSVWNGHSKVVKLLLEYSAKPNATQNNGWTPIAYAASKGHV
TIVKILKSKGADINFQGKDGLTPLHFLTFSKSAMGVKILLDNGADPLIRN
ERGLTALECAEEKGAIEVIKAFSDFGISWEKPINECNHCRIGNASIRLPC
YHNLCMACYHNRSSCNICSTLLYNTSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR017907Znf_RING_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 37..66
e-value: 29.0
score: 13.6
coord: 136..165
e-value: 2.4E-5
score: 33.8
coord: 169..198
e-value: 0.76
score: 18.8
coord: 103..132
e-value: 4.3E-4
score: 29.6
coord: 70..99
e-value: 0.6
score: 19.2
coord: 202..231
e-value: 280.0
score: 9.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 136..168
score: 12.449
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 103..135
score: 11.247
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 70..102
score: 10.018
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 169..201
score: 10.526
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 3..137
e-value: 1.3E-30
score: 108.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 138..225
e-value: 2.9E-23
score: 83.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 10..226
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 86..165
e-value: 1.8E-15
score: 57.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 36..226
score: 49.234
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 80..158
coord: 141..219
coord: 28..110
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 250..259