TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30002663
Length (bp)1854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30002663) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30002663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30002663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30002663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002663SMESG000018404.1 SMED_30483_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002663SMESG000018404.1 SMED_30483_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30002663SMESG000018404.1 SmedASXL_012058SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002663SMESG000018404.1 dd_Smed_v4_4392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002663SMESG000018404.1 Contig39069newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002663SMESG000018404.1 Contig39069uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 185.652 bits (470), Expect = 1.288e-50
Identity = 146/555 (26.31%), Postives = 242/555 (43.60%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNH-SETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQ---MTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTN---QSLHEE----------------------LQLVKGINKDLLKI-----------------------VEKLQKQLTENESIILN----------IKSEMEKQKQLIASPSINNEN--------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F  +             +   +KC  C  V   P QTECG RFC +C+   +++S+  C  C   I ++K  +D   ++EI   +I C NE   C E  +L  L  H    C +    C    C++    K    H+ + C+ R  TC  C+ Q   +    HE          D  C   +  CP +CS     +  +  HL EC N+   C F   GC  + T  +I  H    + QH   L      L  + + L++     N   QSLH +                      L L + I+    K+                       VE LQ ++TE ES+  +          ++S++ +  Q+++   I   +        +    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKV+L ++   S+R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   33 VPEQGGYKEKFVKT-------------VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE----------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 185.652 bits (470), Expect = 1.288e-50
Identity = 146/555 (26.31%), Postives = 242/555 (43.60%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNH-SETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQ---MTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTN---QSLHEE----------------------LQLVKGINKDLLKI-----------------------VEKLQKQLTENESIILN----------IKSEMEKQKQLIASPSINNEN--------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F  +             +   +KC  C  V   P QTECG RFC +C+   +++S+  C  C   I ++K  +D   ++EI   +I C NE   C E  +L  L  H    C +    C    C++    K    H+ + C+ R  TC  C+ Q   +    HE          D  C   +  CP +CS     +  +  HL EC N+   C F   GC  + T  +I  H    + QH   L      L  + + L++     N   QSLH +                      L L + I+    K+                       VE LQ ++TE ES+  +          ++S++ +  Q+++   I   +        +    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKV+L ++   S+R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   33 VPEQGGYKEKFVKT-------------VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE----------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 181.03 bits (458), Expect = 5.425e-49
Identity = 138/526 (26.24%), Postives = 249/526 (47.34%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLE---STNQSLHEEL------------------------------------------QLVKGIN--------KDLLKIVEKLQKQLT---ENESIILNIKSEMEKQKQLI---ASPSINNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKVQTS 1748
            +L   +KC+ C +V   P QT CG RFC +CI +    N+   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++  QC  + C++    K  ++H++  C+ R   C  C++ +      IN +N E   +NLC ++   CP  C+   K+++K     HL  CP ++ +CPF + GC        + +H      +H   ++ + VQL  + ++L  SLE   S  Q L E +                                          QL++ +N        + L++ V+ +++++T    N+  +  ++ E  K    I    +    NE +  L+     NG+L+W + + + K  +A  G+ V I S+ FY+ R GYR+  + Y NGDG G+  +LS+YF++++GE+D  + WPFRQ+V+L +L  +S ++NI    KPD N + + +P    N+ +G P F+  S L  + + Y+   ++ L + V  +
Sbjct:   38 RLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVV----INLQNHE---ENLCPEYPVFCPNNCA---KIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLL-DQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLT 552          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 181.03 bits (458), Expect = 5.425e-49
Identity = 138/526 (26.24%), Postives = 249/526 (47.34%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLE---STNQSLHEEL------------------------------------------QLVKGIN--------KDLLKIVEKLQKQLT---ENESIILNIKSEMEKQKQLI---ASPSINNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKVQTS 1748
            +L   +KC+ C +V   P QT CG RFC +CI +    N+   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++  QC  + C++    K  ++H++  C+ R   C  C++ +      IN +N E   +NLC ++   CP  C+   K+++K     HL  CP ++ +CPF + GC        + +H      +H   ++ + VQL  + ++L  SLE   S  Q L E +                                          QL++ +N        + L++ V+ +++++T    N+  +  ++ E  K    I    +    NE +  L+     NG+L+W + + + K  +A  G+ V I S+ FY+ R GYR+  + Y NGDG G+  +LS+YF++++GE+D  + WPFRQ+V+L +L  +S ++NI    KPD N + + +P    N+ +G P F+  S L  + + Y+   ++ L + V  +
Sbjct:   38 RLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVV----INLQNHE---ENLCPEYPVFCPNNCA---KIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLL-DQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLT 552          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 181.03 bits (458), Expect = 5.425e-49
Identity = 138/526 (26.24%), Postives = 249/526 (47.34%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLE---STNQSLHEEL------------------------------------------QLVKGIN--------KDLLKIVEKLQKQLT---ENESIILNIKSEMEKQKQLI---ASPSINNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKVQTS 1748
            +L   +KC+ C +V   P QT CG RFC +CI +    N+   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++  QC  + C++    K  ++H++  C+ R   C  C++ +      IN +N E   +NLC ++   CP  C+   K+++K     HL  CP ++ +CPF + GC        + +H      +H   ++ + VQL  + ++L  SLE   S  Q L E +                                          QL++ +N        + L++ V+ +++++T    N+  +  ++ E  K    I    +    NE +  L+     NG+L+W + + + K  +A  G+ V I S+ FY+ R GYR+  + Y NGDG G+  +LS+YF++++GE+D  + WPFRQ+V+L +L  +S ++NI    KPD N + + +P    N+ +G P F+  S L  + + Y+   ++ L + V  +
Sbjct:   38 RLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVV----INLQNHE---ENLCPEYPVFCPNNCA---KIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLL-DQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLT 552          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 135.191 bits (339), Expect = 7.291e-34
Identity = 111/454 (24.45%), Postives = 181/454 (39.87%), Query Frame = 3
Query:  357 SRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMK-QCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDK--VVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSS---KSARQNITLNMKP---DNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            S+S+ F      L  +  C +C+    +PI+  C   +C  C EN   N    C  C   I       D+A +K+I    + C  E   C     L  L +H   C ++   +C+ C + +     E+H  + CE     C  C + +  +D E + +         C + I  CP +C   D+  + I+ H   CPN    CPF   GCT       I +HL  E  +H  +L  EI  L+     ++  + S N                                          ++Q +++++     E    +   +L+W I+ ++Q+ ++AKSG    I S PF S R GY+M       GDG    K +S+Y ++++GE+D  + WPF + + +S+L        R NIT  + P     N     +P    N   G   F  L+ L
Sbjct:    3 SQSVMFKGG---LPADCTCPICEQALRDPIKLNCDHHYCRQCFEN--ENRTPGCAACQTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAK-CELNRAVCSFCNKTIRDSDRERHPKT--------CPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFN------------------------------------------DRQTRILSA----AETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL 396          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 66.2402 bits (160), Expect = 1.660e-11
Identity = 56/209 (26.79%), Postives = 89/209 (42.58%), Query Frame = 3
Query:  930 PNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILS 1556
            P++ I+CPF   GC  +   +E+ +H+  +   H   L   +  +RT+ N          QS + +            K V  LQ  ++  ES       E    +     P I             + +++  + K H +       I S+PFYS   GY+M     P GDG    +Y SV+  +++GE+DD + WPFR  V+ SILS
Sbjct:   80 PDNWIDCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLLCQSLNPIRTKIN--------IQQSAYVD------------KYVGMLQ-YMSIAESAF-----EKYGSQHTFRIPKIG------------LTVVKATKNKSHRS-------IYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILS 243          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 114.39 bits (285), Expect = 1.216e-26
Identity = 97/391 (24.81%), Postives = 179/391 (45.78%), Query Frame = 3
Query:  597 IKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCD-DCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCP--QRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEI-VQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL--SSKSARQNITLNMKPDNNVACYGKPINNSN-VGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
             +CPN+   +I  +    +   TC  R  +C+ CQ  +     E+H N  C +  V C+  C Q++      + H++ +      C K +  C   QR  + D   + +H  +CP + + CP        R     I +              GE+   LR E  +L  S      S  E     KG  + L      L+     + S+++ + S   +Q Q++ S    ++  IN   G L+W I +   K+ +A+  + ++++S PFY+ + GY+++  ++ NG+G G++ ++SVY  ++ GEYD  + WPF   ++ ++    ++S +  +  +  PD     + +P N  + +G G P FI   ELL S  ++ G ++ L +KV  S
Sbjct:  134 TQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEH-NGSCGQEPVYCEAKCGQRILRGRMTL-HKSKD------CAKRLRRCAHCQREFSAD--TLPLHAAQCPRAPLACP-------QRCDAGPIPR--------------GELEAHLRDECQSLAVSC-----SFKEAGCRFKGPRQML---EAHLESNAAAHLSLMVALSSRQGQQIQMLKS--AVSKLSINYT-GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVDPS 481          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 114.005 bits (284), Expect = 1.677e-26
Identity = 96/390 (24.62%), Postives = 180/390 (46.15%), Query Frame = 3
Query:  600 KCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCD-DCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCP--QRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEI-VQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL--SSKSARQNITLNMKPDNNVACYGKPINNSN-VGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +CPN+   +I  +    +   TC  R  +C+ CQ  +     E+H N  C +  V C+  C Q++      + H++ +      C K +  C   QR  + D   + +H  +CP + + CP        R     I +              GE+   LR E  +L     + + S  E     KG  + L      L+     + S+++ + S   +Q Q++ S    ++  IN   G L+W I +   K+ +A+  + ++++S PFY+ + GY+++  ++ NG+G G++ ++SVY  ++ GEYD  + WPF   ++ ++    ++S +  +  +  PD     + +P N  + +G G P FI   ELL S  ++ G ++ L +KV  S
Sbjct:  126 QCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEH-NGSCGQEPVYCEAKCGQRILRGRMTL-HKSKD------CAKRLRRCAHCQREFSAD--TLPLHAAQCPRAPLACP-------QRCDAGPIPR--------------GELEAHLRDECQSL-----AVSCSFKEAGCRFKGPRQML---EAHLESNAAAHLSLMVALSSRQGQQIQMLKS--AVSKLSINYT-GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKVDPS 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 59.3066 bits (142), Expect = 6.292e-9
Identity = 62/253 (24.51%), Postives = 119/253 (47.04%), Query Frame = 3
Query: 1002 KHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSE-------LLTSLDYLHGTSIKLAIKV 1739
            K  +IE F  Q   + E ++ +  N++   S ++T   L  E++ VK I  +  +  +KL + L +    I +++++M  Q+++    S+ N      + G L+W I++  +K+ ++K  + + + S  F +   GY +RL IY NG G  K + +     ++ GEYD  + WP R +  + I      R   T       NVA     +    V     +FI+ ++       ++TS +YL   S+ + ++V
Sbjct:  249 KFFQIEEFLQQ---INEDIKTKLGNSDYVTSKQAT---LDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLETQMAMQQRI---ASVQN------IRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIII------RDQCT-------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 59.3066 bits (142), Expect = 6.878e-9
Identity = 62/293 (21.16%), Postives = 124/293 (42.32%), Query Frame = 3
Query:  891 GDKVVIKMHLKECP------NSQINCPFSNVGC--TTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLH---------EELQLVKGINKDLLKIVEK----LQKQLTENESIILNIKSEME-KQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRM--RLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSA--RQNITLNMKPDNNVACYGKPINN-SNVGAGQPEFIKLSELL 1688
               + +  HL  CP        +  CPF+ + C    R   N++ +HL+ +   H   LM +  Q         H   ++  ++             Q   G+++ +++ + +    L+++  E E+ + N++ ++   ++Q    P  +N        G +VW IE +   +   ++    Q+ S   Y+   GY+   RL I P      K   LS++  ++Q E D  + WPF+ ++ L ++    A   Q+ T+  KP+  +  + KP    S  G G  E+  +S ++
Sbjct:  180 ASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKAD-MPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSN--------GTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLNIQPR-----KPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPE--ILAFHKPREAISTRGFGFLEYANISNII 456          

HSP 2 Score: 55.0694 bits (131), Expect = 1.412e-7
Identity = 33/102 (32.35%), Postives = 49/102 (48.04%), Query Frame = 3
Query:  393 LSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCP--NCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQ 686
            L   ++C++C +   EP+ T CG RFC +C+  ++  +N  CP  N  L    + F  D    +EI   K  CPN    C  +    EL  H  +C YR +Q
Sbjct:   98 LDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFP-DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQ 198          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074273)

HSP 1 Score: 58.9214 bits (141), Expect = 8.519e-9
Identity = 62/253 (24.51%), Postives = 119/253 (47.04%), Query Frame = 3
Query: 1002 KHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSE-------LLTSLDYLHGTSIKLAIKV 1739
            K  +IE F  Q   + E ++ +  N++   S ++T   L  E++ VK I  +  +  +KL + L +    I +++++M  Q+++    S+ N      + G L+W I++  +K+ ++K  + + + S  F +   GY +RL IY NG G  K + +     ++ GEYD  + WP R +  + I      R   T       NVA     +    V     +FI+ ++       ++TS +YL   S+ + ++V
Sbjct:  227 KFFQIEEFLQQ---INEDIKTKLGNSDYVTSKQAT---LDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLETQMAMQQRI---ASVQN------IRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIII------RDQCT-------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 450          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 185.267 bits (469), Expect = 1.423e-50
Identity = 127/521 (24.38%), Postives = 239/521 (45.87%), Query Frame = 3
Query:  411 CSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQCDL--CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEI--------NKHLEIESFQHQTF------LMGEIVQ---------------------LRTENNNLKHSLESTN-----------------------QSLHEELQLVKGINKDLLKIVEKLQKQLTENES---IILNIKSEMEKQKQLIASPSIN-NENQINL-------VNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            C  C+ V   P QTECG RFC +CI   ++  N  CP   L +  +K  RD    +EI   K+ C +E+  C E   L+++  H   C Y    C L  C++    K   +H++  C+ R VTC+ C  +M   + +  H+      + +C  +   CP  CS     +  +  H  +CP +Q+ C F   GC+ +    E+        ++HL + + ++ T       +  E+++                     +R +N  L+  L S                         +++ EE++ ++G  + +  +V  L      + S    + +++ ++ +   L++   +   E  + L        NG L+W I + +++  +A     + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F++++GEYD  + WPF+QKV+L ++    AR+++    KPD + + + +P    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   56 CETCRLVLCNPRQTECGHRFCESCINELLSKPNPVCPADLLPLFEDKIFRDVCCNREIMALKVYCRSEKNGCKEQMCLQQVMEHLVICPYFEVPCPLGKCKEKMMRKDMPEHLSRKCKHREVTCEFCSLKMALTELQ-KHK------ETVCPAFPVACPNHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMNIASGCPLFVAQT-VLENGTYIKDDTIFIKVTVDTS 568          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 179.489 bits (454), Expect = 7.185e-49
Identity = 131/494 (26.52%), Postives = 214/494 (43.32%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVI-----KMHLKECPNSQINCPFSNVGCTTRATVNEINK--HLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHE--ELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQK------------------------------------QLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            ++C  CK++  +P Q +CG RFC  C +   ++    C  C  E         +N      D A  +EI +   KCPNE C     LK+ +N H   C +   +C+ CQ L     K++H    CE R + C  C+  +T N  EI         D +C K+    P +C +  K  I     + H K C  S+  C F  +GC  RA V+   +  H +    +H   ++  +  +R          E     L+   E     G +         +QK++T  E+I+  +  E+E+                                      QL  S     E Q    +G  +W I    ++  DA +G    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++G+YD  + WPF QKV+L +L  ++ R++I    +PD +   + +PI+  N+ +G P F  L++L     YL   +I
Sbjct:   43 YQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCK--VTFNFKEIKAH------DEICQKF----PMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGC--RAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTI 521          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 179.489 bits (454), Expect = 7.185e-49
Identity = 131/494 (26.52%), Postives = 214/494 (43.32%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVI-----KMHLKECPNSQINCPFSNVGCTTRATVNEINK--HLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHE--ELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQK------------------------------------QLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            ++C  CK++  +P Q +CG RFC  C +   ++    C  C  E         +N      D A  +EI +   KCPNE C     LK+ +N H   C +   +C+ CQ L     K++H    CE R + C  C+  +T N  EI         D +C K+    P +C +  K  I     + H K C  S+  C F  +GC  RA V+   +  H +    +H   ++  +  +R          E     L+   E     G +         +QK++T  E+I+  +  E+E+                                      QL  S     E Q    +G  +W I    ++  DA +G    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++G+YD  + WPF QKV+L +L  ++ R++I    +PD +   + +PI+  N+ +G P F  L++L     YL   +I
Sbjct:   43 YQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCK--VTFNFKEIKAH------DEICQKF----PMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGC--RAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTI 521          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 179.489 bits (454), Expect = 8.543e-49
Identity = 131/494 (26.52%), Postives = 214/494 (43.32%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVI-----KMHLKECPNSQINCPFSNVGCTTRATVNEINK--HLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHE--ELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQK------------------------------------QLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            ++C  CK++  +P Q +CG RFC  C +   ++    C  C  E         +N      D A  +EI +   KCPNE C     LK+ +N H   C +   +C+ CQ L     K++H    CE R + C  C+  +T N  EI         D +C K+    P +C +  K  I     + H K C  S+  C F  +GC  RA V+   +  H +    +H   ++  +  +R          E     L+   E     G +         +QK++T  E+I+  +  E+E+                                      QL  S     E Q    +G  +W I    ++  DA +G    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++G+YD  + WPF QKV+L +L  ++ R++I    +PD +   + +PI+  N+ +G P F  L++L     YL   +I
Sbjct:   56 YQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCK--VTFNFKEIKAH------DEICQKF----PMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGC--RAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTI 534          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 153.68 bits (387), Expect = 4.021e-40
Identity = 127/510 (24.90%), Postives = 211/510 (41.37%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQ-TECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKC--PNERCDEIFLLKELKNHSETCQYRMKQC-DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNI-----------------------------------------EMGIDNL------CDKWIDVCPQRCS--NGDKVVIKMHLKE-CPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL----SSKSARQNITLNMKPDNNVACYGKP------INNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQ 1742
            F+C LC     EP+Q + CG RFC  C++ +++     CP   L ++  K   D  +E++I    I+C    E C     +K+L++H  TC + +  C + C      +   +H+   C +R V C+ C  + T   +E NH+ I                                         E   D +      C ++   CP +C   N  +  +  H+KE C ++ + CPF   GC  R     I +HLE  +  H T +   + + R E                                              IL ++ EME+        S+++       +G L+W + +  +K+ +AK  N  +  S PFY+ R GY++++  + NG+G G+  +LS+Y  ++ GEYD+ + WPF  KV+ SIL     S S  Q+IT    PD N   + KP      ++ S +G G P+FI   E +   +Y+   SI L   ++
Sbjct:   16 FQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYE-NHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCSLVGRQRQE----------------------------------------------ILELRREMEEL-------SVSH-------DGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEE-IKKRNYIRDNSIFLKASIE 463          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 185.267 bits (469), Expect = 1.564e-50
Identity = 142/550 (25.82%), Postives = 247/550 (44.91%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSET-CQYRMKQCDL--CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQH-------QTFLMGEIVQLRTENNNLKHSLESTNQSL---------HEE---------LQLVKGIN------KDLLKIVEKLQKQLTENESIILNIKSEMEKQKQL-------------IASPSINNENQINLV--------------------NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F              + +   +KC  C+ V   P QTECG RFC  C+   +++++  C  C+  I ++K  +D    +E+   ++ C NE   C E+  L  L  H ++ CQ+    C    C++    K    H+ + C+ R   C  C+ Q+   + +  H +++      C   +  CP  CS     +  +  HL EC N+   C F   GCT + T  +I  H    + QH         +L  ++  L+ E++    S++  +  +         H+E         +QL + I       KDL K +  L++   E + +  N +S   +  QL             +    IN  +Q+  V                    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKVSL ++    +R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   28 VPEQGGYKERFL-------------KPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQ-KHEDVD------CPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 556          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 179.104 bits (453), Expect = 1.655e-48
Identity = 137/499 (27.45%), Postives = 230/499 (46.09%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNC--DLE-INRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLR------TENNNLK-----------------------------HSLEST-------NQSLHEELQLVKGINKD--------LLKIVEKLQKQLTENESI---ILNIKSEMEKQKQLIASPSI---NNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            QL   +KC+ C  V   P QT CG RFC  CI N I  S +  P C  D+E I  ++  +D   ++E+ N  + C N   CD   +L   + H   C Y M  C  D C      K  + H+   C+ R   C  C+Q M+ N HE N++ I                          +  HL ECP +++ C FSN GC       ++ +H +     H  +++   ++L        +N +LK                             +SL ST       ++S+  E Q+++ ++K+        +L  +E  +++L+  E+    I N+  + +K   L+++  +   +NE +  LV     NG+L+W I +  +K  +A  G  V I S+ FY+   GYR+  + Y NGDG GK  +LS+YF++++GE+D  ++WPF+QKV+L +L     + +IT   + D N + + +P +  N+ +G P F   ++L
Sbjct:   37 QLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSET--PQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFN-HENNYKKIFFSFQ---------------------LDKHLCECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQL 511          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 177.178 bits (448), Expect = 8.264e-48
Identity = 138/496 (27.82%), Postives = 228/496 (45.97%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNC--DLE-INRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM----HLKECPNSQINCPFSNVGCTTRATVNEINKH-LEIESFQHQTFLMG---------------------------EIVQLRTENNNLKHSLEST-------NQSLHEELQLVKGINKD--------LLKIVEKLQKQLTENESI---ILNIKSEMEKQKQLIASPSI---NNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            QL   +KC+ C  V   P QT CG RFC  CI N I  S +  P C  D+E I  ++  +D   ++E+ N  + C N   CD   +L   + H   C Y M  C  D C      K  + H+   C+ R   C  C+Q M+                 LC   +D      +N  K+        HL ECP +++ C FSN GC      + ++ H L + +F   + ++G                           +  Q    N N   SL ST       ++S+  E Q+++ ++K+        +L  +E  +++L+  E+    I N+  + +K   L+++  +   +NE +  LV     NG+L+W I +  +K  +A  G  V I S+ FY+   GYR+  + Y NGDG GK  +LS+YF++++GE+D  ++WPF+QKV+L +L     + +IT   + D N + + +P +  N+ +G P F   ++L
Sbjct:   37 QLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSET--PQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMS-----------------LCLACLDYMFSCRNNYKKIFFSFQLDKHLCECPEAELQCTFSNYGCNVMVLYHSLSVHFLYLCTFTSVSQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGN---SLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQL 510          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 162.54 bits (410), Expect = 1.320e-42
Identity = 132/530 (24.91%), Postives = 237/530 (44.72%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSET-CQYRMKQCDL--CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLE--IESFQHQT--------FLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGIN---KDLLKIVEKLQKQLTENESIILNIKSEMEKQKQL-------------IASPSINNENQINLV--------------------NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F              + +   +KC  C+ V   P QTECG RFC  C+   +++++  C  C+  I ++K  +D    +E+   ++ C NE   C E+  L  L  H ++ CQ+    C    C++    K    H+ + C+ R   C  C+ Q+   + +  H +++      C   +  CP  CS     V  +   E  N QI    ++        + E + +LE  +   Q+++         L  ++     E    K  L +    + +  ++++G     KDL K +  L++   E + +  N +S   +  QL             +    IN  +Q+  V                    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKVSL ++    +R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   28 VPEQGGYKERFL-------------KPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQ-KHEDVD------CPSVVISCPHMCS-----VKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 154.066 bits (388), Expect = 5.563e-40
Identity = 117/451 (25.94%), Postives = 207/451 (45.90%), Query Frame = 3
Query:  537 INRNKFI---RDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCS-NGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLR------TENNNLK-----------------------------HSLEST-------NQSLHEELQLVKGINKD--------LLKIVEKLQKQLTENESI---ILNIKSEMEKQKQLIASPSI---NNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            I+ N F    +D   ++E+ N  + C N   CD   +L   + H   C Y M  C  D C      K  + H+   C+ R   C  C+Q M S        N+ + +   C  +   CP  C     +  +  HL ECP +++ C FSN GC       ++ +H +     H  +++   ++L        +N +LK                             +SL ST       ++S+  E Q+++ ++K+        +L  +E  +++L+  E+    I N+  + +K   L+++  +   +NE +  LV     NG+L+W I +  +K  +A  G  V I S+ FY+   GYR+  + Y NGDG GK  +LS+YF++++GE+D  ++WPF+QKV+L +L     + +IT   + D N + + +P +  N+ +G P F   ++L
Sbjct:   17 ISHNNFFQIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMAS-------INLTIHVGLYCQLYPVPCPNACPVTCPRAELDKHLCECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQL 460          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 186.037 bits (471), Expect = 5.655e-51
Identity = 144/552 (26.09%), Postives = 244/552 (44.20%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSET-CQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTN---QSLHEE----------------------LQLVKGINKDLLKI-----------------------VEKLQKQLTENESIILN----------IKSEMEKQKQLIASPSINNEN--------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F  +             +   +KC  C+ V   P QTECG RFC +C+   +++S+  C  C   I ++K  +D   ++EI   ++ C NE   C E   L  L  H +  CQ+    C    C++    K    H+ + C+ R  TC  C+ Q       +    ++   D  C   +  CP +CS     +  +  HL EC N+   C F   GC  + T  +I  H    + QH   L      L  + + L++     N   QSLH +                      L L + I+    K+                       VE LQ ++TE ES+  +          ++S++ +  Q+++   I   +        +    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKV+L ++   S+R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   32 VPEQGGYKEKFVKT-------------VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQ-------VPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-50
Identity = 133/518 (25.68%), Postives = 227/518 (43.82%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER-CDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSN---DHEINHRNIEMGIDNLCDKWIDVCPQRCSNG-DKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGIN-------------------------------KDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIAS---------PSINNENQINL-------------------VNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKV 1739
            QL   +KC+ C +V   P QT CG RFC  CI +    NS   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++   C  + C++    K  ++H++  C  R   C  C++ +      DHE          +N C  +   CP RC     +  +  HL  CP ++ +CPF + GCT +     + +H       H   ++ +  QL    N L  SLE   +    +  +    N                               + LL+IV +   +L +  S++  + S  ++  QL AS          +  ++  IN+                    +G+L+W + + R K  +A  G+ V + S+PFY+ R GYR+  + Y NGDG GK  +LS+YF++++GE+D  + WPFRQ+V+L +L     + +I    K D N + + +P    N+ +G P F+  S L  S + Y+   ++ L + V
Sbjct:   38 QLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHE----------ENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRL-DLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 183.341 bits (464), Expect = 4.042e-50
Identity = 133/518 (25.68%), Postives = 227/518 (43.82%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER-CDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSN---DHEINHRNIEMGIDNLCDKWIDVCPQRCSNG-DKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGIN-------------------------------KDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIAS---------PSINNENQINL-------------------VNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKV 1739
            QL   +KC+ C +V   P QT CG RFC  CI +    NS   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++   C  + C++    K  ++H++  C  R   C  C++ +      DHE          +N C  +   CP RC     +  +  HL  CP ++ +CPF + GCT +     + +H       H   ++ +  QL    N L  SLE   +    +  +    N                               + LL+IV +   +L +  S++  + S  ++  QL AS          +  ++  IN+                    +G+L+W + + R K  +A  G+ V + S+PFY+ R GYR+  + Y NGDG GK  +LS+YF++++GE+D  + WPFRQ+V+L +L     + +I    K D N + + +P    N+ +G P F+  S L  S + Y+   ++ L + V
Sbjct:   38 QLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHE----------ENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRL-DLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 174.481 bits (441), Expect = 3.121e-47
Identity = 112/477 (23.48%), Postives = 222/477 (46.54%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKH---SLESTNQSLHEELQLVKGI----NKDLLKIV---EKLQKQLTENESIILNIKSEMEKQKQLIASPSIN--------NENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            +L   + CS CKN+   P Q +CG R+C  C+ + +++   +C  C  E         +  +    D A  +E+ +    CPN+ C     LKE ++ H   C + + +C  C+ L +   KE H  + C +R ++C  C+   +  D E+++         +C K+    P  C    K  I       H++ C   ++ C F  VGC+       +  H      +H   L+   ++ +     L      L    Q L +++   + I    N+++ ++    E   +Q   ++  I  + +++++ ++ I    +         +E +++  +G  +W I +  +K  +A +G    I S  FY+ R GY+M L++Y NGDG G+  +LS++F++++G  D  + WPF QKV+L +L   + R+++    +PD   + + +P+++ N+ +G P F  +S++     Y+   +I
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY--------EVCPKF----PLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAI 490          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 167.162 bits (422), Expect = 1.286e-44
Identity = 112/484 (23.14%), Postives = 222/484 (45.87%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYI-------NNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKH---SLESTNQSLHEELQLVKGI----NKDLLKIV---EKLQKQLTENESIILNIKSEMEKQKQLIASPSIN--------NENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            +L   + CS CKN+   P Q +CG R+C  C+ + +       ++   +C  C  E         +  +    D A  +E+ +    CPN+ C     LKE ++ H   C + + +C  C+ L +   KE H  + C +R ++C  C+   +  D E+++         +C K+    P  C    K  I       H++ C   ++ C F  VGC+       +  H      +H   L+   ++ +     L      L    Q L +++   + I    N+++ ++    E   +Q   ++  I  + +++++ ++ I    +         +E +++  +G  +W I +  +K  +A +G    I S  FY+ R GY+M L++Y NGDG G+  +LS++F++++G  D  + WPF QKV+L +L   + R+++    +PD   + + +P+++ N+ +G P F  +S++     Y+   +I
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY--------EVCPKF----PLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAI 497          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 3.955e-50
Identity = 144/552 (26.09%), Postives = 244/552 (44.20%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSET-CQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTN---QSLHEE----------------------LQLVKGINKDLLKI-----------------------VEKLQKQLTENESIILN----------IKSEMEKQKQLIASPSINNEN--------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F  +             +   +KC  C+ V   P QTECG RFC +C+   +++S+  C  C   I ++K  +D   ++EI   ++ C NE   C E   L  L  H +  CQ+    C    C++    K    H+ + C+ R  TC  C+ Q       +    ++   D  C   +  CP +CS     +  +  HL EC N+   C F   GC  + T  +I  H    + QH   L      L  + + L++     N   QSLH +                      L L + I+    K+                       VE LQ ++TE ES+  +          ++S++ +  Q+++   I   +        +    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKV+L ++   S+R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   32 VPEQGGYKEKFVKT-------------VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQ-------VPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 562          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 6.183e-50
Identity = 146/555 (26.31%), Postives = 242/555 (43.60%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNH-SETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQ---MTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTN---QSLHEE----------------------LQLVKGINKDLLKI-----------------------VEKLQKQLTENESIILN----------IKSEMEKQKQLIASPSINNEN--------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +PE+  Y E F  +             +   +KC  C  V   P QTECG RFC +C+   +++S+  C  C   I ++K  +D   ++EI   +I C NE   C E  +L  L  H    C +    C    C++    K    H+ + C+ R  TC  C+ Q   +    HE          D  C   +  CP +CS     +  +  HL EC N+   C F   GC  + T  +I  H    + QH   L      L  + + L++     N   QSLH +                      L L + I+    K+                       VE LQ ++TE ES+  +          ++S++ +  Q+++   I   +        +    NG L+W I + +++  +A  G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F+I++GEYD  + WPF+QKV+L ++   S+R+++    KPD N + + KP    N+ +G P F+  + +L +  Y+   +I + + V TS
Sbjct:   33 VPEQGGYKEKFVKT-------------VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE----------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQT-VLENGTYIKDDTIFIKVIVDTS 563          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.345e-48
Identity = 129/523 (24.67%), Postives = 226/523 (43.21%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSN---DHEINHRNIEMGIDNLCDKWIDVCPQRCSNG-DKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQK-----------------------------QLTENESIILNIKS-------------EMEKQKQ---LIASPSINNENQINLVNGEL-------------------VWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKV 1739
            QL   +KC+ C +V   P QT CG RFC  CI +    NS   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++   C  + C++    K  ++H++  C  R   C  C++ +      DHE          +N C  +   CP RC     +  +  HL  CP ++ +CPF + GCT +     + +H       H   ++ +  QL    ++L  SLE     + +  + VK   K+L +  +   +                             Q+   +   L+++S             ++E   Q   L+   +  ++  IN+   +L                   +W + + R K  +A  G+ V + S+PFY+ R GYR+  + Y NGDG GK  +LS+YF++++GE+D  + WPFRQ+V+L +L     + +I    K D N + + +P    N+ +G P F+  S L  S + Y+   ++ L + V
Sbjct:   38 QLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHE----------ENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 2.605e-48
Identity = 138/526 (26.24%), Postives = 249/526 (47.34%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYIN-NSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLE---STNQSLHEEL------------------------------------------QLVKGIN--------KDLLKIVEKLQKQLT---ENESIILNIKSEMEKQKQLI---ASPSINNENQINLV-----NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLD-YLHGTSIKLAIKVQTS 1748
            +L   +KC+ C +V   P QT CG RFC +CI +    N+   CP     I   +  +D   ++E+ N  + C N   C+   +L   ++H + C ++  QC  + C++    K  ++H++  C+ R   C  C++ +      IN +N E   +NLC ++   CP  C+   K+++K     HL  CP ++ +CPF + GC        + +H      +H   ++ + VQL  + ++L  SLE   S  Q L E +                                          QL++ +N        + L++ V+ +++++T    N+  +  ++ E  K    I    +    NE +  L+     NG+L+W + + + K  +A  G+ V I S+ FY+ R GYR+  + Y NGDG G+  +LS+YF++++GE+D  + WPFRQ+V+L +L  +S ++NI    KPD N + + +P    N+ +G P F+  S L  + + Y+   ++ L + V  +
Sbjct:   38 RLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVV----INLQNHE---ENLCPEYPVFCPNNCA---KIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLL-DQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLT 552          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.183e-46
Identity = 112/477 (23.48%), Postives = 222/477 (46.54%), Query Frame = 3
Query:  390 QLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKN-HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKH---SLESTNQSLHEELQLVKGI----NKDLLKIV---EKLQKQLTENESIILNIKSEMEKQKQLIASPSIN--------NENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
            +L   + CS CKN+   P Q +CG R+C  C+ + +++   +C  C  E         +  +    D A  +E+ +    CPN+ C     LKE ++ H   C + + +C  C+ L +   KE H  + C +R ++C  C+   +  D E+++         +C K+    P  C    K  I       H++ C   ++ C F  VGC+       +  H      +H   L+   ++ +     L      L    Q L +++   + I    N+++ ++    E   +Q   ++  I  + +++++ ++ I    +         +E +++  +G  +W I +  +K  +A +G    I S  FY+ R GY+M L++Y NGDG G+  +LS++F++++G  D  + WPF QKV+L +L   + R+++    +PD   + + +P+++ N+ +G P F  +S++     Y+   +I
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHY--------EVCPKF----PLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNN-REHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAI 490          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1D122 (TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.262e-101
Identity = 170/469 (36.25%), Postives = 264/469 (56.29%), Query Frame = 3
Query:  342 FRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNC-DLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEME--KQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKV 1739
             ++ QS  +F  +  R LS    C +CK +  EP Q++CGCRFC  CIE +I+     CP C D  I +   IRDKA+EKEI   +++CP E C E  + +E   H   C Y + +C+ C + Y    KE H  E C   +V CDDC ++M   D +  H+N +   ++LC+KW+  CP +C+    V +K H   C      CP  ++GC  +    E+  HL+     HQ  ++ EI  LR +   +K  L    +   ++ + ++ INKD    V++L++++        ++ SE+   K       P  + E  +     ++ W I++IR+KI +AK G   ++ISE FY  RPGY M LK++ NGDGR  +KYLS +F+I +GEYD +I WPF+ +V LSILS+  ++++I + MKP+NN  CYG+P    N+GAGQP+ ++LSE+L    YLH  ++KL + +
Sbjct:    1 MKSVQSVPVFLDDL-RTLS-RCSCGICKQIMFEPTQSQCGCRFCSKCIEEFISKEKRKCPICTDQNIEKVSLIRDKAIEKEIMRMRVQCPQEGCGENIMYREWGGHERACVYGVNECEKCGEEYVRSRKEDHEREECGESVVKCDDCGKEMRREDLKNVHKNYDGDEESLCEKWMCKCPYQCTEEQYVNMKEHASSCRERCTPCPLKDIGCEVKGPQGELKVHLKEAVGLHQILMLKEIKDLREQKEEMKKMLREKEEDHRKKYEELREINKDNETSVKELKEKVDHITKYSESLLSELTTYKSNSHPKEPLTDIEASLR----DVTWSIKDIRKKIQEAKCGGNNELISECFYVFRPGYNMSLKVFLNGDGRATNKYLSTFFVINKGEYDSQISWPFKSRVLLSILSNNLSKEDIVVRMKPNNNDQCYGRPSGRCNLGAGQPDLVELSEILNKDYYLHHGALKLRLTL 463          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 2.879e-96
Identity = 173/476 (36.34%), Postives = 260/476 (54.62%), Query Frame = 3
Query:  321 KYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINR--NKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQ 1742
            KY+     +  + RS  F     Q      C  C  V IEP QT+CGCR C NC+E    +  S CP C+  +N   N    DKA+EKEI    I C N+ C+    +K+L NH ETC+Y  K+C  C + Y  K  ++H    C+  I TC+DC  +++  D E  H+N+   IDN+C KW D+CP +CS    V IK HL  C    + C  + +GC       E+ +H  +E+  H   LM  +  LR E+ +L  S+   N+    E++ +K     LL  +E L+ +L + +S+   +++E       +A  S++   +     GE  W +ENI +K++DAK G   QI+SE FYS  PGYRM LKIYPNGDG     YLSVYF++++G+YDD+I WPF   +S+ +++     ++  LNM+P+ N  CYG+P    N+ AGQP+F+   +L+   D++   +I L + V+
Sbjct:    2 KYSCLAVLKVIKDRSKLFYFECEQQKQRISCVKCHQVLIEPYQTQCGCRLCSNCLEECSKDEESHCPGCNETMNSPSNYSKHDKAIEKEILELNIICTNKGCEYTCKVKDLDNHLETCEYIEKRCTACNESYPRKELKKHEEFTCKMIITTCEDCGLELSKGDLEKKHKNVNELIDNVCSKWRDICPFKCSEDTLVNIKDHLLTCERRPVECSLNEMGCRKVLPREEMREHFNLEANYHTVLLMDALFLLRKEHQDLSVSVSVQNERNSAEIKELKEKLSSLLTEIEDLKTKLKQFQSMYEKLENERN-----LAKCSLSETKE---RYGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGYRMCLKIYPNGDGSAFGNYLSVYFVLMKGKYDDQIQWPFNSIISIRLVNIARRGEDRVLNMRPNINDQCYGRPKEEHNLAAGQPKFVSHLQLVNEDDFIKDGAIILRVNVK 469          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.852e-69
Identity = 144/439 (32.80%), Postives = 222/439 (50.57%), Query Frame = 3
Query:  381 WNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSC----PNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            W   ++ N KC +C+++ ++ IQT+CGCR+C  CI+NY+ N    C     +C   I    +I D+A  KEI   K+KC  E C     LK +K H + C+YR + C LC   Y  K +  H+   C  R V C  C+  +T  ++  +H   E    +LC K+  +CP  C+   KV +  H K C N  + CP     C      +++ +HL   S++H   ++ E+ +L  +N   KH  E  N  L EE QL+K         +E ++  L +N   I                 S+   N+    NG+ +W I++  +   +A  G    I+SE FY+   GY+M +KIYP GDG GK  +LS++F+I++G+YDD + WPF+ KV ++I    S   N++   KPD    CY +P    N+ +G P+FI  SEL
Sbjct:   21 WRFTINDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVIT--SYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFES--RDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQN---KHMEERMN-ILIEENQLLKAT-------LEVMKLDLPKNSGSISR-------------DTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSEL 431          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 6.728e-69
Identity = 140/435 (32.18%), Postives = 230/435 (52.87%), Query Frame = 3
Query:  393 LSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLC-QQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEK---QKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            +S N KC +C  + +E +QT+CGCR+C  C++ Y     + C   D   +    I D AV +EI    +KC    C+   LLK++ +H ++C ++   C  C ++L + + KE H  + C  R+V+C  C ++M  ++    H N+    + LC K +  CP +C NG +V +  H K C    + C FS +GC    T  ++ KH   ES QH   LM EI+ ++ + + LK                +K +  ++LKI      + ++ +S IL+    +EK         S   ++E +    NG  +W IE   +   +A+ GN++ I S+ FY+   GY+M +KIYP GDG GK  +LSV+F +++GE+DD + WPF+ KV+L+IL  K+   + +   KPD    CY +P ++ N+ +G P+FI  S+L
Sbjct:   24 ISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLT-DGCGDLGNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELKE-HTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVH--TEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKHNNEESLQHSRLLMKEIITMKNDISELK----------------MKTLEFNILKI------EFSKFQSEILDKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQL 432          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.606e-61
Identity = 129/365 (35.34%), Postives = 197/365 (53.97%), Query Frame = 3
Query:  654 HSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTT-RATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQT 1745
            H E+C  R   C+ C   +  K K  H  + CE R+V CD C   M S D  I H N +   D LC K++ +C   C+   KV +K HLK CPN ++ CPF    C   + T  ++ KHL+ E F H + L+ ++  L ++  +L+  L   NQ L         I K+L +    + K+ +E+   I     E++K+    +  +I+N+N I   N   +W   +   +  DA+SG +V + S+ FY+   GY+M L++YP GDG GK  +LSV+F I++GE+DD + WPF+QKV+LSIL  +S  +  +   KPD   ACY KP +  N+ +G P+FI LS ++ +  Y    +I L I V T
Sbjct:    4 HIESCDLREITCEKCGIKFGAKEKANHDKDKCEMRMVNCDYCGITMKSKDLNIIHLNPDR--DELCSKYVGICSNNCNETRKVNLKDHLKICPNKKLECPFHQFDCKIDKMTKEKLMKHLDEEYFNHTSSLINKVKDLESKIIDLESELH--NQIL---------ITKELFE----MNKKSSESRLKIEKTIEELKKKAPATSIQTIDNKNVI-FRNASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESGSKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAVDT 350          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 178.718 bits (452), Expect = 1.068e-48
Identity = 128/497 (25.75%), Postives = 222/497 (44.67%), Query Frame = 3
Query:  402 NFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELK-NHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIES--FQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQ-----------------------------LVKGINKDLLKIV---EKLQKQLTENESIILNIKSEME--------KQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSI 1721
             ++C  CK V  +P Q +CG RFC  C +   ++    C  C  E         ++  +   D A  +EI     KCPN+ C     LKE +  H   C++   +C+ CQ +     K++H    CE R + C  C+   +  D + +        D +C K+    P +C +  K  I       H K C  S+  C FS +GC  RA V+   +H   +S   +H   ++  +  +R  ++      E +   L+   +                             +V  +N+++ + V   E L +Q   ++  I N+ +++         +  QL  S     E Q    +G  VW I +  ++  DA +G    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++G+YD  + WPF QKV+L +L  ++ R++I    +PD +   + +PI+  N+ +G P F  L++L     YL   +I
Sbjct:   39 KYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYCKVTFSFKDIKAH--------DEICQKF----PMQCKDCGKKKIPREKFAEHSKSCAKSKSACQFSEIGC--RAVVDNGKQHEHEQSSIIEHLRLMLAVLSTVRVRSDGPGEWQEDSGLGLYRGPEDAAPPGAHAAAHNAAGGPGVQQKMTALENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTI 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 166.392 bits (420), Expect = 3.990e-44
Identity = 137/564 (24.29%), Postives = 235/564 (41.67%), Query Frame = 3
Query:  312 MPEKYNYTENFRNSQSRSIFFINW-------NRQLSL------NFKCSLCKNVFIEPIQTECGCRFCYNCIENYI-NNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE-RCDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQ-----QMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKV-VIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLM----------------------GEIVQLRTENNNLKH-------SLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINL--------------------------------VNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 1751
            M  + N    F+ SQ  S    +W        R LS        F C  C  V   P QT CG  FC  CI   + NN  S CP   + I   +  +D   ++E+ N ++ C N   C +   L  L++H ++CQY   QC    C  +   K    H    C  R   C  CQ+     Q+T  DHE             C +    CP +C +  K   +K H  ECP  + +C +   GCT R    ++  H + E F H   L+                      GE+ +     +NLK        ++ +  +S+ E+ +LV  + ++L  + + L+  LT+ E  ++++++ ++  ++ +A      E+   L                                 +G+L+W + +  +K     + N     S PFY+   GY++  ++Y  G+G  +  +LS+Y M+++G++D  + WPFRQ V+L++L     R +++L+  PD     + +P + +N   G P FI  ++L    +  +     L IKV+  T
Sbjct:    1 MAAEENECPKFQFSQQSSGLVRSWELESVLAGRTLSFVVKLDDQFVCPACGGVVFNPHQTGCGHIFCSPCIRVILENNETSKCPFDGILIKPEEVFQDNCCKRELLNLEVFCTNSPACSQTIPLCNLQDHLKSCQYEALQCPNSSCTDILLRKNLPDHQRSHCSYRTELCRYCQKPYPVSQLT--DHE----------KTSCPEAEVQCPNKCIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRNKRGQVKVHEQTE-FNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEE--LVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTALN-----SPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVDT 544          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 159.073 bits (401), Expect = 1.152e-41
Identity = 122/500 (24.40%), Postives = 217/500 (43.40%), Query Frame = 3
Query:  399 LNFKCSLCKNVFIEPIQTECGCRFCYNCIENYI-NNSNSSCPNC----------DLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDL-CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSND-HEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQL----------VKGINKDLLKI------------VEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLV------------------------------------NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            ++F CS C NV  E  QT+CG R+C  C+   + NN +  C  C           + +  + F  D A+ KEI   ++ C N+ C     LK+ ++H   C+Y +  C++ C  +   K    H+ + C     TC  C   +T  +   + + ++                          +K   +E P  +  C FS +GCT +   +++ +H E+ S      L+ E+V  R    ++    E T Q    +L L            G N   L +            +  LQ++L   E+II  +  E+EK +  +     +N N +NL+                                    +G  +W I ++ QK+ +A +G +    S  FY+ R G+++ +++Y  GDG GK  ++S++F+I++G+YD  + WPF+QKV+   L  ++ R+++    +PD   A + +P++  NV +G P F  LS+L
Sbjct:   25 VHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSVTYFSL-------------------------FLKDSKQESPKRKETCVFSEIGCTFKGNPDKVREH-EVSSTSAHLHLLVEVV--RNVQMSVPPPPERTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTF-FLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKL 495          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 155.992 bits (393), Expect = 1.536e-40
Identity = 126/519 (24.28%), Postives = 219/519 (42.20%), Query Frame = 3
Query:  399 LNFKCSLCKNVFIEPIQTECGCRFCYNCIENYI-NNSNSSCPNC----------DLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDL-CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVI-------KMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLV-----------------------KGINKDLLKI------------VEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLV------------------------------------NGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSEL 1685
            ++F CS C NV  E  QT+CG R+C  C+   + NN +  C  C           + +  + F  D A+ KEI   ++ C N+ C     LK+ ++H   C+Y +  C++ C  +   K    H+ + C     TC  C   +T  + +                        CSNG +  +       K   +E P  +  C FS +GCT +   +++ +H E+ S      L+ E+V  R    ++    E T Q    +L L                         G N   L +            +  LQ++L   E+II  +  E+EK +  +     +N N +NL+                                    +G  +W I ++ QK+ +A +G +    S  FY+ R G+++ +++Y  GDG GK  ++S++F+I++G+YD  + WPF+QKV+   L  ++ R+++    +PD   A + +P++  NV +G P F  LS+L
Sbjct:   25 VHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQ---------------------KHSCSNGTEKDLSKAEKRKKDSKQESPKRKETCVFSEIGCTFKGNPDKVREH-EVSSTSAHLHLLVEVV--RNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTF-FLIDQNQREHVVDAFRPDLRSASFQRPVSEMNVASGCPLFFPLSKL 518          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 151.754 bits (382), Expect = 1.890e-39
Identity = 125/510 (24.51%), Postives = 210/510 (41.18%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQ-TECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKC--PNERCDEIFLLKELKNHSETCQYRMKQC-DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNI-----------------------------------------EMGIDNL------CDKWIDVCPQRCS--NGDKVVIKMHLKE-CPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL----SSKSARQNITLNMKPDNNVACYGKP------INNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQ 1742
            F+C LC     EP+Q + CG RFC  C++ +++     CP   L ++  K   D  +E++I    I+C    E C     +K+L+ H  TC + +  C + C      +   +H+   C +R V C+ C  + T    E NH+ I                                         E   D +      C ++   CP +C   N  +  +  H+KE C ++ + CPF + GC  R     I +HLE  +  H T +   + + R E                                              I+ ++ EME+        S+++       +G L+W + +  +K+ +AK  N  +  S PFY+ R GY++++  + NG+G G+  +LS+Y  ++ GEYD+ + WPF  KV+ SIL     S S  Q+IT    PD N   + KP      ++ S +G G P+FI   E +   +Y+   +I L   ++
Sbjct:   16 FQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFE-NHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTMMCSLVGRQRQE----------------------------------------------IIELRREMEEL-------SVSH-------DGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDE-IRKRNYIRDNAIFLKASIE 463          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.356e-33
Identity = 108/435 (24.83%), Postives = 195/435 (44.83%), Query Frame = 3
Query:  513 SCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKE-LKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDH----EINHRNIEMGIDNLCDKWI------DVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEI-ESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKI--------VEKLQKQLTENESIILNIK---SEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            SC  C+ ++   +  + K  E     + I CPN +C+E  + +E L +H   C Y+  +C   Q   ++K   Q + E             +   +  H         N+E+ +  L  +        D+   R    +K +I +      N  + C         R    +  + L + ES Q  T         R +++ L+  L+ T  +LHE    V  I +    +        +  L   L+ +++ +       +EM+ + Q++ + S N         G+LVW I +  ++  DA SG  + + S+PFY+   GYRM  + Y NGDG G+  +LS++F++++GEYD  + WPFRQ+V+L++L   +AR+ ++   KPD   + + +P ++ N+ +G P F+     L S  YL   +I + + V T 
Sbjct:   77 SCRYCNQQVPLAE--KRKHYETRCPRYPIPCPN-KCEEQSIAREELVSHLGICPYKQAECFFSQFGCKYKGTLQGLKE------------HESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLC------VVQRMLAVQTERLLRLQESMQGTT--------RRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYN---------GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIKVVVDTG 472          

HSP 2 Score: 57.3806 bits (137), Expect = 5.624e-9
Identity = 47/223 (21.08%), Postives = 84/223 (37.67%), Query Frame = 3
Query:  588 NHKIKCPNERCDEIFLLKELKNH-SETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTC-DDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQ 1250
            +  + CP+  C E  L  EL NH +  C +R + C  C Q      K +H    C R  + C + C++Q  + +  ++H  I                                 CP  Q  C FS  GC  + T+  + +H    + QH + +      L  + + L+  L     S       V+ + K+L+ + +   K    NES++  ++  +  Q +
Sbjct:   44 HEAVNCPHAGCTERLLRGELVNHVALGCHFRTESCRYCNQQVPLAEKRKHYETRCPRYPIPCPNKCEEQSIAREELVSHLGI---------------------------------CPYKQAECFFSQFGCKYKGTLQGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASK----NESVLCVVQRMLAVQTE 229          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.647e-30
Identity = 86/369 (23.31%), Postives = 159/369 (43.09%), Query Frame = 3
Query:  747 CERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGD--KVVIKMHLKECPNSQINCPFSNVGCTTR-ATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLE----------------------------STNQSLHEELQLVKGINKDL--LKIVEKLQKQLTENESIILNIKSEMEKQKQLIAS---PSINNEN-------------------------QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFI 1670
            C  R   C  C   +T +  E +H+         C ++   CP  C      +  +  H+  C  S   C F  +GCT +  T   + +H E     H T ++    +L  +   L+ S+E                            S N  L   L+++   N+ L  L + ++  ++  +  ++  ++ +  E+ + L A+   P    E                          +    +G+LVW I +  ++  +A SG  + + S+PFY+   GY+M  + Y NGDG G+  +LS++F++++GEYD  + WPFR++V+LS+L   +AR++++    PD     + +P  + NV +G P F+
Sbjct:   29 CPHRAEFCKYCSAAVTCSLLERHHKEE-------CAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFV 390          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 120.939 bits (302), Expect = 4.163e-29
Identity = 106/503 (21.07%), Postives = 210/503 (41.75%), Query Frame = 3
Query:  369 FFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENY--INNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLK-ECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLR---------------------------TENNNLKHSLESTNQSLHE--------ELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSIN-NENQINLVNGELVWIIENIRQKI---------HDAKSGNQVQII-SEPFYSIRPGYRMRLKI-------YPNGDG------RGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSS-KSARQNITLNMKPDNNVACYGKP-INNSNVGAGQPEFIKLSEL 1685
            +  ++   L   ++C +C     EP+QT CG RFC  CI +   + ++   CP  +  ++  +   D   ++EI +  ++CPN+ C     L+ L+ H   C+Y    C  C+     +   +H  + C RRIVTC  C ++M   D + NH       + +C   +  C        +  +  HL+ +C  +Q+ C FS +GC  +   + +  H+   +  H   L   +  LR                           T   +++ +  S +Q   +        EL  ++ I + L + V     Q+ E  +   N +  + +  +L+ S      E++  L  G   W +E   + +          D    +   ++ S  FY+  PGYR+ L++        P G         G+  +L+++  ++QG+YD  + WPF+ ++ +S++   +    ++T  M  D  ++ + +P ++ +  G G   F+ ++ L
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSK-NH-------EQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTL 545          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 1.238e-22
Identity = 97/419 (23.15%), Postives = 177/419 (42.24%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEIN-----RNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELK-NHSETCQYRMKQCDLCQQLYQFKFKE--QHMNELCERRIVTCDDCQQQMTSND---HEINHRNIEMGIDNLC-------DKWIDVCPQRCSNGDKVVIKMHLKE--CPNSQINCPFSNVGCTTRATVNEINKH----LEIE-SFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEK---------LQKQLTENESIILNIK------SEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQ--VQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQK 1535
            F C  C+ +  + +QT CG RFC  CI   I + + SC +  +  N       +F  D A+ +E+    ++C +E C+    L E    H E C + +  C L          E  +H+ + C  R V C  C Q +       H+++ R+       LC       DKW                  H +E  C  ++  CP+S +GC  R     ++ H    +E+  +  +  F       ++   +N+KH   +   +   +L  +    +++ K VE+          Q  +  +E+  L  K      S+ E ++ ++       E +    NG  +W I+++  ++ +A +G +   QI S  F++ R GYR+RL++  +G+      ++S Y M+  G YD  + WP++ K
Sbjct:    3 FACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQLHCRSRRTRECKLCGQKSIPEDKW-----------------QHHEERRCMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 166.007 bits (419), Expect = 1.699e-44
Identity = 128/524 (24.43%), Postives = 226/524 (43.13%), Query Frame = 3
Query:  393 LSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQC--DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNL--CDKWIDVCPQRCSNG--DKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLM--------------GEIVQLRTENNNLKHSLESTNQSL---HEELQLVKGI-----------NKDLLKIVEKLQKQ-----LTENESIILNIKSEMEKQKQLIASPSI------------NNENQINL-------------------VNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            L   ++C +C N    P+QT CG RFC  C+E  +    S CP    E+  +   +D    +EI      CPN +  C+ +  L+ L+ H   C+Y+  QC    CQ+    +  E H+ E CE +   C  C Q++ +   E          D+L  C+K   VCP   + G     ++      C  +++ C F+  GC  + T   +  H   ++  H   L+               ++ Q+  E    +  +    ++L   ++ L+  +G             ++L ++ E++Q Q     + E +  +  I++E  +     + P               NE+Q+ L                    +G  +W I+   ++  +  SG    I S PFY  R GY+   ++YPNGDG GK  +LS++F++++GE+D  + WPFRQKV+  +L       +I    +PD   + + +P +N N+ +G P FI  + L T   Y+   ++ + I V T+
Sbjct:   15 LDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGP-SKCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHL-ERCEFKPSDCQYCLQRIPAASME----------DHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRV-HDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRA-YVRDDTMFIKIAVDTT 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 152.525 bits (384), Expect = 3.372e-40
Identity = 106/457 (23.19%), Postives = 213/457 (46.61%), Query Frame = 3
Query:  411 CSLCKNVFIEPIQ-TECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQCD-LCQQLYQFKFKEQHMNELCERRIVTC---DDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHL-KECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILS---SKSARQNITLNMKPD---NNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKV 1739
            C +C+++F+ P+Q  ECG R C +C +    +    CP C  +++      D+A E ++     +C N    C       ++  H   C+Y    CD  C   +Q +FK++H+++ C ++I++C   DD   +    +H  +   I +   N CDK + +         +  +  H+ KECP +++ C F ++GC  R +  ++ KH++ E   H   + G +++ + + +N     E                                E+E+I+  + S +   +++  S              +++W IE+  +K+ +AK+GN   + S  F + + GYR+   +  NGDG+GK  ++SV+  +++G +D  + WPF  +V+  +L+   +   R+++  ++KP+   +N    G+P    N   G  +FIK  E + S +++   ++ L + V
Sbjct:   55 CPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDVDQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDDRHLRENKKEHLEDCLLIPLPCPNKCDKTLTI--------PRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFE--------------------------------EHETIMKQVDSRVGDLEKIAHS--------------QIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEE-IESGNFIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 147.132 bits (370), Expect = 3.508e-38
Identity = 127/481 (26.40%), Postives = 209/481 (43.45%), Query Frame = 3
Query:  411 CSLCKNVFIEPIQTECGCRFCYNCIENYINNSN-SSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDL--CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLH-------EELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQ-----KQL-IASPSI-NNENQI---------NLVNGELVWIIENIRQKIHDA---------KSGNQVQ----------IISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVA----CYGKPINNSNVGAGQPEFIKLSELLTSLDYL 1706
            C++C  V  EP+ T CG  +C  CIE + N     +CP  + ++  ++   DK  ++ + + ++KC N  C     L++ + H + C ++  +C L  C         E+H N  C  R++ C  C       D E                                   H  +CP + + C FS +GCT +   +  ++H E     H       I   + + ++L   L+   Q L        +E+  ++  + + ++  +   + L++   I  N   E ++Q     K+L IAS +I  N +QI            +G  VW I N + K   A         K GN             ++S PFY+ R GY+MRLK YPNG G GK  +LS+   I++GEYD  + WPFR+K++LS+++     ++ T+ + PD+        + +PI N NVG G   FI   E L S DY+
Sbjct:   30 CAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTN-TCGWRLLHCKPCNLSYPKKDEETVQ--------------------------------HKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKELDKVRQELQTKSCDHMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTIHENKEQLDTLKKELGIASETIRKNRDQIAKLSTACKTQYTDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERPIENENVGCGYSCFISHME-LNSGDYI 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 138.658 bits (348), Expect = 3.046e-35
Identity = 120/467 (25.70%), Postives = 216/467 (46.25%), Query Frame = 3
Query:  411 CSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNE--RCDEIFLLKELKNHSETCQYRMKQC---DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEIN----KHLE-----IESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINK--DLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSI---NNENQINLVNGE-----LVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKV 1739
            C+ C+ +  + +QT CG R+C  CI   ++     C  C   I + +  RDK  ++EI    + C N+   C     L+  +NH   C++    C   +  ++L   K  E   NE C+ R  TC  C+Q +     + +H       +  C  +   CP +CS   K +I++ +   P ++        GC     V E +    K LE     I     Q+  + E +      + L+       +    E+ +V+  +   +L + V +L  +L E++ II  ++ ++E   Q     ++   + E ++N + G      L+W I N+  K  +A SG      S  F++   GY+M  +IY NGDG G++ ++S++F+I++GE+D  + WPFRQKV+L +L   +  +++    +PD + + + +P    N+ +G P F    E LT   Y+   ++ L I V
Sbjct:   24 CAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCDVCGSTITKPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNE-CQYREETCSYCEQPVVVARMKEHH-------EKTCPSYPVNCP-KCS---KELIRVEVHSTPFTREPRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNV-EHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCS-HEQLTQHAYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 137.117 bits (344), Expect = 6.917e-35
Identity = 113/463 (24.41%), Postives = 207/463 (44.71%), Query Frame = 3
Query:  393 LSLNFKCSLCKNVFIEPIQTE-CGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQCD-LCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEM---GIDNLCDKWIDVCPQRCSNGDKVVIKMHLK-ECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL---SSKSARQNITLNMKPD---NNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKV 1739
            L   + C  C+ +   P+Q + CG R C  C    +++S + CP C  E+N N    DKA  +EI    +KC N    C     + E  +H E C Y    C+  C   +Q +F  +H+++ C  +++TC  C ++    D + +  N  +      N CDK + +   RC       +  H++ +CP +++ C +  +GC  R T  E     E     ++T ++  +                                    K+V  L     +N+ +I+    ++ +   LI        +   + + +L+W IE+  +K+ +AK+GN   + S  F + + GYR+   +  NGDG+GK  ++SV+  +++G +D  + WPF  +V+  +L      + R++I  ++KP+   +N    G+P    N   G  +F K  E++ S +Y+   +I L I V
Sbjct:   39 LQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSS-ARCPGCMDELNENIPDIDKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCDEKHLRKDKKGHLENCPLLPCPCPNKCDKKLTI--HRCE------LDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAHV------------------------------------KMVADLA---LKNKELIMRFSEKLSEHGTLIEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIV-SRNYIKEDTIFLKISV 452          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 182.185 bits (461), Expect = 4.529e-50
Identity = 130/502 (25.90%), Postives = 223/502 (44.42%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELK-NHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQL---RTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQK------------------------------------QLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +KC  C  V  +P+Q +CG RFC +C     ++    C  C  E         +N ++   D A  +EI +   +C N+ CD    +KE +  H   C++   QC+ CQ L   K K++H +  CE R + C  C  ++T N  +I         D +C K+    P +C +  K  I       H K C  S+  CPFS VGC +     +I++H    + +H   L+  ++ +   R + +      E +   L+       G    +  +   L K+++  E+I+  +  E+E+                                      QL  +  +  E Q    +G  VW I +   +  +A SG    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++ +YD  + WPF QKV+L +L  ++ R++I    +PD     + +P++  N+ +G P F  L++L     YL   +I +   V  S
Sbjct:   28 YKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYC--KVTFNFKDIKAH------DEICQKF----PLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSV--DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLS 514          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 182.185 bits (461), Expect = 5.580e-50
Identity = 130/502 (25.90%), Postives = 223/502 (44.42%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---------INRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELK-NHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKM-----HLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQL---RTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQK------------------------------------QLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            +KC  C  V  +P+Q +CG RFC +C     ++    C  C  E         +N ++   D A  +EI +   +C N+ CD    +KE +  H   C++   QC+ CQ L   K K++H +  CE R + C  C  ++T N  +I         D +C K+    P +C +  K  I       H K C  S+  CPFS VGC +     +I++H    + +H   L+  ++ +   R + +      E +   L+       G    +  +   L K+++  E+I+  +  E+E+                                      QL  +  +  E Q    +G  VW I +   +  +A SG    + S  FYS + GY+M L++Y NGDG G+  +LS++F++++ +YD  + WPF QKV+L +L  ++ R++I    +PD     + +P++  N+ +G P F  L++L     YL   +I +   V  S
Sbjct:   35 YKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYC--KVTFNFKDIKAH------DEICQKF----PLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSV--DLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLL-DQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIVDLS 521          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 176.407 bits (446), Expect = 1.574e-48
Identity = 118/451 (26.16%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  411 CSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE-INRNKFIRDKAVEKEIFNHKIKCPNER--CDEIFLLKELKNHSETCQYRMKQCDL--CQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTS 1748
            C  C+ V  +P QTECG RFCY+CI + ++  N  CP  D+E + ++K  RD    +EI   K+ C +E   C E   L+++ +H   C +    C L  C++    K   +H+   C+ R  TC+ C+ +M   + + +   +                                 CP   ++CP      +   +   ++ H   E        +  + QLR E  +L+ +L++    L     L +G    L   + +    L+ +E  +    ++M+ + Q++ + S          NG L+W I + +++  DA +G  + + S+PFY+   GY+M  ++Y NGDG GK  +LS++F++++GEYD  + WPF+QKV+L ++    +R+++    KPD + + + +P+   N+ +G P F+  S +L S  Y+   +I + + V TS
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPA-DMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETV---------------------------------CPAFPVSCPNHCTSSSLPRSEKLMSSH--TEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLS---ALEQGGRASLETQLNRHDDMLSVHEIRL----ADMDLRFQVLETAS---------YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQS-VLESGTYIKDDTIFIKVTVDTS 445          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 176.407 bits (446), Expect = 2.187e-47
Identity = 125/531 (23.54%), Postives = 238/531 (44.82%), Query Frame = 3
Query:  375 INWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLE---INRNKFIRDKAVEKEIFNHKIKCPNER-CDEIFLLKELKNHSETCQYRMKQCD--LCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSN-GDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQH--------------------QTFLMGEIVQLRT---------------ENNNLKHSLESTNQSLHEELQLVKGINKDLLKI-----------------VEKLQKQLTENESIILNIKSEMEKQKQL-------IASPSINNEN----QINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPI--NNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 1751
            + +  +L   F C +CK V + P Q  CG  +C++C++  + +S  S P C +E   I  ++  +D   ++EI + ++ C N   C  +  L +L+ H ++CQY    C    C +L Q +  ++H+N  C  R  +C  C Q    +        I+  + + C +    CP  CS    +  +  H + CP    +C F   GC+ +    ++  H E     H                    +  L  + VQ  T               ++ + +H + +  ++L  +   +  +  DL ++                 ++ + ++L   E++  +I +  E +K+        +A  ++N ++    ++   +G L+W I++ +++     +G    + S PF++ R GY+M +K Y NGDG G+  +LS+Y +++ G++D  + WPF+Q VSLS+L    AR + + N +PD    C+ +P   + SNV  G P FI L  L    + ++     L +KV+  T
Sbjct:   56 LKFVMKLKEEFICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGPVCPVEKAAITPSEVFQDNCCKREISSLEVYCTNSPLCTSVLALNQLQEHLKSCQYEQLLCSNPGCTELLQRRLLQEHLNATCPHRRESCPHCLQPFQLS-------VIQDHVQSSCPEVKVGCPDGCSTLVPRNRLTEHGESCPEVHTDCSFKMFGCSVKGKRRKVKLHEEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQTDTLLLSDLQEQLGSVLQQSRSQEHIVATAQRTLSRQEDALSSVQLDLQQVSCGMGSGLDELRRFKTSLDGVMQELLAAETLREHIATLEENRKRHSGLLELHVAQLALNKQHLQELELTSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPDPTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVKVKVDT 579          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 148.288 bits (373), Expect = 3.303e-38
Identity = 121/491 (24.64%), Postives = 202/491 (41.14%), Query Frame = 3
Query:  405 FKCSLCKNVFIEPIQ-TECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKC--PNERCDEIFLLKELKNHSETCQYRMKQC-DLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNI-----------------------------------------EMGIDNL------CDKWIDVCPQRCS--NGDKVVIKMHLKE-CPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSIL----SSKSARQNITLNMKPDNNVACYGKP------INNSNVGAGQPEFIKLSEL 1685
            F+C LC     EP+Q + CG RFC  C++ +++     CP   L ++  K   D  +E++I +  I+C    E C     +K+L+ H  TC + +  C + C      +    H+   C +R V C+ C  + T    E NH+ +                                         E   D +      C ++   CP +C   N  +  +  H+K+ C ++ + CPF + GC  R     I +HLE  +  H T +   + + R E                                              IL ++ EME+        S+++       +G L+W + +  +K+ +AK  +  +  S PFY+ R GY++++  + NG+G G+  +LSVY  ++ GEYD+ + WPF  KV+ SIL     S S  Q+IT    PD N   + KP      ++ S +G G P+FI   E+
Sbjct:   16 FQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFE-NHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSRQRQE----------------------------------------------ILELRREMEEL-------SVSH-------DGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEI 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018404.1 (SMESG000018404.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 436/443 (98.42%), Postives = 440/443 (99.32%), Query Frame = 3
Query:  423 KNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 1751
            +NVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNH+IKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCD+CQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQ+NCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIH AKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDG GKDKYLSVYFMIVQGEYDDEI WPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST
Sbjct:    5 QNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHQIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDECQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQVNCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHYAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGTGKDKYLSVYFMIVQGEYDDEIAWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 447          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018409.1 (SMESG000018409.1)

HSP 1 Score: 368.622 bits (945), Expect = 3.843e-121
Identity = 185/467 (39.61%), Postives = 289/467 (61.88%), Query Frame = 3
Query:  354 QSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMG-IDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 1751
            ++R+ +FI   R     F CS C  + I+P QT+CGCRFCY+CI  +  +  + CPNC  EI  N+ I+D+A+++EI N +I+C    CD I   K L +H + C++R++ CD C Q Y  + KE H+ E C   I  C  C  +MT ++++  H NI +  ID LC+     CP  C++     I+ HL +CPN    C    +GC       +++KHL  ++  H T +M  +  L  +N  L+  +   N     E +L+K  N  L K +E L+ ++  NE+ I  IKS++   K+ +    IN++  +++V G  +W + N+RQ+I DAKSG   QI S+PFY  +PGYR  LK+YPNGDG+GKD++LS+YF+I++GEYDDE+ WPF +KV+LS++SS +  QNI++ MKPD+N+ CYG+P+   N+GAGQPEF+ L +L+ S D++H  SI++  ++++ +
Sbjct:   13 ETRTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCGNICPNCQTEI-PNEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLKMCKWRLENCDKCHQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEANDKNGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGG-GINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDS 477          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018435.1 (SMESG000018435.1)

HSP 1 Score: 364.385 bits (934), Expect = 1.866e-119
Identity = 184/465 (39.57%), Postives = 285/465 (61.29%), Query Frame = 3
Query:  360 RSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMG-IDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST 1751
            R+ +FI   R     F CS C  + I+P QT+CGCRFCY+CI  +  +  + CPNC  EI  N+ I+D+A+++EI N +I+C    CD I   K L +H   C++R++ CD C Q Y  + KE H+ E C   I  C  C  +MT ++++  H NI +  ID LC+     CP  C++     I+ HL +CPN    C    +GC       +++KHL  ++  H T +M  +  L  +N  L+  +         E +L+K  N  L K +E L+ ++  NE+ I  IKS++   K+ +    IN++  +++V G  +W + N+RQ+I DAKSG   QI S+PFY  +PGYR  LK+YPNGDG+GKD++LS+YF+I++GEYDDE+ WPF +KV+LS++SS +  QNI++ MKPD+N+ CYG+P+   N+GAGQPEF+ L +L+ S D++H  SI++  ++++ +
Sbjct:   17 RTEYFIKNIRLECPRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFASCENICPNCQTEIP-NEIIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHLRMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCQFVGNQVDMSKHLSDDNVSHMTIVMSGMRNLMRKNGELEQKIVEAKDKDGTETKLLKEENFQLKKQIESLRHEMRINENQIEAIKSDINSYKEQLGG-GINSDEDVSIVEGICIWTVRNVRQRITDAKSGFDTQITSKPFYLRQPGYRFSLKVYPNGDGQGKDRFLSIYFIIIKGEYDDELRWPFIEKVNLSLISSNALVQNISILMKPDSNMICYGRPVKEFNLGAGQPEFVNLGKLIDSDDFIHSGSIRIRFEMRSDS 479          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 261.922 bits (668), Expect = 2.082e-80
Identity = 154/460 (33.48%), Postives = 244/460 (53.04%), Query Frame = 3
Query:  393 LSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNSSCP-------NCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTT-RATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQ-INLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQT 1745
            LS   KC LC+ +     QT CGC+ C NCI++Y+ N    CP       N  L ++ +    D A  KEI + K+KCP + C     L+ +  H  +C++R   C+ CQ   Q K KE H    CE R + C+ C ++M+  D +  H N +   ++ C K+  +CP  C    KV +K HLK C   ++ CPF ++ C   + T   + KHL  E   H + L+ +I             +E+T ++L +EL+  K + K+LL + +K    + + +  I  +K++         +P    EN+ +   N   +W   +   K  DA+SG +V + S+PFY+   GY+M L+IYP GDG GK  +LSV+F I++GE+DD + WPF+QKV+LSI+  ++  ++ +   KPD   ACY KP++  N+ +G P+FI LS ++ +  Y    +I L I V T
Sbjct:   22 LSDRLKCVLCQRILKNAKQTSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDED-INADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHINSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDR--EDFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKI-----------KDMENTIKNLTDELENQKVLTKELLDMNKKSSLSVLKTQETIEKLKTKS------FPTPIQAVENKSVIFRNATFIWKFTDFESKRIDAESGRKVSVTSDPFYTSEFGYKMCLRIYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSIMDQEAGTKHHSDTFKPDARSACYQKPVDECNIASGSPKFILLSLIMNNSLYCKNDTIYLKIAVDT 461          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039089.1 (SMESG000039089.1)

HSP 1 Score: 248.825 bits (634), Expect = 1.591e-75
Identity = 141/473 (29.81%), Postives = 254/473 (53.70%), Query Frame = 3
Query:  327 NYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVFIEPIQTECGCRFCYNCIENYINNSNS-SCPNCDLEINRNKFIRDKAVEKEIFNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQHMNELCERRIVTCDDCQQQMTSNDHEINHR-NIEMGIDNLCDKWIDVCPQRCSNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQTFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQKQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIRQKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFMIVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPINNSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKV 1739
            N  +N +  + R   F      L+ N KC +C  + +  +QT+CGCR+C  CIE+++ NS   S   C   I+    + D A+ KEI    +KC  + C+   +LK++ +H  +C+Y    C+ C+     K    H+ + C +R+V C +C+ +M   ++EI  + ++++  DN+C K +D CP  C     V +  H KEC    + CPF  +GC+   T  +++ H++ E   H   L+ E ++++ E  +L+  L  +++++  EL        ++   +  + +    + S+  +    ++     +A+   +N+ +IN  NG  +W +E+  +   +A+ GN++ + SEPFY+   GY+M +KIYP GDG GK  +LSV+F +++G++DD +VWPF+ KV+L+IL  K+   + +   KPD    CY +P    N+ +G P+FI  ++L     Y+   +I L I V
Sbjct:    7 NLPDNIKRYRKRRFPF-----NLTDNLKCVICSELLLNAMQTDCGCRYCQKCIEDHLVNSRQCSTKGCSTIIST---MPDNAINKEIGKLMVKCLYDGCNHEEMLKDIGDHLNSCEYLTVVCEKCKLEMPGKMLPNHLLKDCVKRVVKCLNCESRM---EYEILMKFHLDLYADNICPKLVDKCPYGCDIVGAVNLLAHRKECVKKPVRCPFVELGCSKVLTNQQLSDHMKTEFPAHIRTLVEEFIKMKKEITSLETKLIESSKTIKLELS---NFQNEISTKISNIDQMSNSSLSLQSSSSLTLQSSASSMANILKSNDEKINYRNGVFIWKVEHFPELKANAERGNRISVTSEPFYTKEFGYKMSMKIYPAGDGVGKSTHLSVFFTLMKGDFDDLLVWPFKNKVTLTILDQKNKTSDYSDTFKPDPRSTCYQQPTEEYNIASGSPKFISFTQLQEY--YMKNDTIFLKIVV 463          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.288e-5026.31TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.288e-5026.31TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF55.425e-4926.24TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF55.425e-4926.24TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF55.425e-4926.24TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-17.291e-3424.45TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-21.660e-1126.79TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.216e-2624.81gene:FBgn0026319 transcript:FBtr0077429[more]
Traf41.677e-2624.62gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like6.292e-924.51gene:FBgn0030748 transcript:FBtr0074275[more]
Traf66.878e-921.16gene:FBgn0265464 transcript:FBtr0071188[more]
Traf-like8.519e-924.51gene:FBgn0030748 transcript:FBtr0074273[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.423e-5024.38TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf2b7.185e-4926.52Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b7.185e-4926.52Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.543e-4926.52Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf4a4.021e-4024.90tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.564e-5025.82slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.655e-4827.45solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a18.264e-4827.82solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh21.320e-4224.91slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a15.563e-4025.94solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf35.655e-5126.09TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf54.042e-5025.68TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf54.042e-5025.68TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf23.121e-4723.48TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.286e-4423.14TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE3.955e-5026.09TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN6.183e-5026.31TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE1.345e-4824.67TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|O00463|TRAF5_HUMAN2.605e-4826.24TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P39429|TRAF2_MOUSE2.183e-4623.48TNF receptor-associated factor 2 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1D1222.262e-10136.25TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DF652.879e-9636.34TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK61.852e-6932.80TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D5JG606.728e-6932.18TNF receptor-associated factor-2-like protein B OS... [more]
D5JG591.606e-6135.34TNF receptor-associated factor-2-like protein A OS... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.068e-4825.75TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf53.990e-4424.29TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf11.152e-4124.40TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf11.536e-4024.28TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf4a1.890e-3924.51TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.11.356e-3324.83pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.647e-3023.31pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf64.163e-2921.07TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.11.238e-2223.15pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494641.699e-4424.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328493.372e-4023.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483943.508e-3826.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.046e-3525.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328516.917e-3524.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b4.529e-5025.90TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b5.580e-5025.90TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf31.574e-4826.16TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000001369.22.187e-4723.54TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf4a3.303e-3824.64TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018404.10.000e+098.42SMESG000018404.1[more]
SMESG000018409.13.843e-12139.61SMESG000018409.1[more]
SMESG000018435.11.866e-11939.57SMESG000018435.1[more]
SMESG000027153.12.082e-8033.48SMESG000027153.1[more]
SMESG000039089.11.591e-7529.81SMESG000039089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002663 ID=SMED30002663|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1854bp
ATTTGTTAAACTGTTTATTGATTTCATTTATTCAACTTAGTTCATAACAA
TTCGTGGATATATTTCACAGTTCGGTCAGTTCAAGAAGAACACTAAAAAC
AATTTATTCATTCCAAAAATACCGCCCCCTAGAAACAACACGATTCAATT
CCAAAAACATCAAAATTTTACCAATAATATCACTTTAAATTTAGATTACC
AATGACGTATTGTTTGATTGTCCAATGAACACCAGGTGAATGTAGGTGGT
TTATTTTTAAATTTTTATATAAATAGCGATATGAATGACGAAATTTACAG
ATTTATTATCCATGCCTGAAAAATATAACTACACAGAAAATTTCCGAAAT
TCTCAGAGCAGATCAATTTTCTTCATCAATTGGAATCGACAATTGTCTCT
GAATTTCAAATGCTCACTTTGCAAAAACGTTTTTATTGAACCGATTCAAA
CTGAATGTGGATGTCGGTTTTGTTACAATTGCATAGAAAATTATATCAAT
AATTCAAATTCAAGTTGTCCGAATTGTGATTTGGAAATAAACAGGAATAA
ATTCATCAGAGACAAAGCGGTTGAAAAGGAAATCTTTAACCATAAAATCA
AGTGTCCTAATGAGAGATGTGATGAGATCTTTTTATTGAAAGAACTGAAA
AATCATTCTGAAACCTGTCAGTATAGGATGAAGCAATGTGATTTGTGTCA
GCAATTGTATCAATTCAAATTCAAAGAACAGCATATGAATGAGCTGTGTG
AGCGACGAATTGTCACATGTGACGATTGTCAGCAGCAAATGACGAGCAAT
GATCATGAAATTAATCACAGAAATATTGAAATGGGAATTGATAATTTGTG
TGATAAATGGATTGATGTTTGCCCACAACGTTGTTCTAATGGTGATAAAG
TTGTCATAAAAATGCATTTAAAAGAGTGTCCAAACAGTCAAATAAATTGT
CCGTTTAGCAATGTTGGATGTACCACTAGGGCAACGGTAAATGAAATCAA
CAAACATTTAGAGATTGAATCTTTTCAACATCAAACCTTTCTGATGGGGG
AAATAGTGCAGTTGAGAACGGAAAATAATAATTTAAAGCATTCACTGGAA
TCGACAAATCAATCATTACATGAGGAACTTCAGTTGGTTAAAGGTATAAA
TAAAGATCTATTAAAGATCGTAGAAAAACTTCAGAAACAATTAACTGAGA
ATGAATCAATTATTCTAAATATCAAGTCGGAAATGGAAAAACAAAAACAA
TTAATTGCTAGCCCTTCAATCAACAATGAAAATCAAATCAATTTAGTCAA
CGGAGAACTGGTTTGGATTATTGAAAATATCAGACAAAAAATCCACGATG
CCAAATCTGGAAATCAAGTCCAGATTATCAGTGAGCCGTTTTACAGCATC
AGACCTGGGTATAGAATGCGCTTAAAAATATACCCCAATGGCGATGGCAG
GGGCAAAGATAAATATTTGTCAGTTTATTTCATGATTGTTCAAGGAGAAT
ATGATGATGAAATAGTGTGGCCGTTTCGACAGAAAGTTTCACTGAGCATT
TTAAGCAGTAAAAGTGCGCGACAGAATATTACGTTAAACATGAAACCAGA
TAATAATGTTGCGTGCTATGGTAAACCGATAAATAATTCAAATGTAGGAG
CAGGTCAGCCTGAATTTATCAAACTATCAGAACTATTGACCAGTTTGGAT
TATTTGCATGGAACCTCAATTAAACTCGCAATCAAAGTCCAAACATCCAC
TTAATTTTTCATTGTTATTTTCTTGAGAGTAAATATCATATATATTTTTA
TTTACAATTTTTTGTTTACAATTTTTTATGAAATATAACATTTTTCAGGT
AAAA
back to top

protein sequence of SMED30002663-orf-1

>SMED30002663-orf-1 ID=SMED30002663-orf-1|Name=SMED30002663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MTKFTDLLSMPEKYNYTENFRNSQSRSIFFINWNRQLSLNFKCSLCKNVF
IEPIQTECGCRFCYNCIENYINNSNSSCPNCDLEINRNKFIRDKAVEKEI
FNHKIKCPNERCDEIFLLKELKNHSETCQYRMKQCDLCQQLYQFKFKEQH
MNELCERRIVTCDDCQQQMTSNDHEINHRNIEMGIDNLCDKWIDVCPQRC
SNGDKVVIKMHLKECPNSQINCPFSNVGCTTRATVNEINKHLEIESFQHQ
TFLMGEIVQLRTENNNLKHSLESTNQSLHEELQLVKGINKDLLKIVEKLQ
KQLTENESIILNIKSEMEKQKQLIASPSINNENQINLVNGELVWIIENIR
QKIHDAKSGNQVQIISEPFYSIRPGYRMRLKIYPNGDGRGKDKYLSVYFM
IVQGEYDDEIVWPFRQKVSLSILSSKSARQNITLNMKPDNNVACYGKPIN
NSNVGAGQPEFIKLSELLTSLDYLHGTSIKLAIKVQTST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0046872metal ion binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0042981regulation of apoptotic process
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR018957Znf_C3HC4_RING-type
IPR001293Znf_TRAF
IPR008974TRAF-like
IPR012227TNF_rcpt-assoc_TRAF_met