Unconventional myosin-XV

Overview
NameUnconventional myosin-XV
Smed IDSMED30002656
Length (bp)7783
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Unconventional myosin-XV (SMED30002656) t-SNE clustered cells

Violin plots show distribution of expression levels for Unconventional myosin-XV (SMED30002656) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Unconventional myosin-XV (SMED30002656) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Unconventional myosin-XV (SMED30002656) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002656

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002656SMESG000061386.1 dd_Smed_v4_7193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002656SMESG000061386.1 dd_Smed_v4_7193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002656SMESG000061386.1 dd_Smed_v4_7193_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002656SMESG000061386.1 dd_Smed_v6_7193_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002656SMESG000061386.1 dd_Smed_v4_7193_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002656SMESG000061386.1 dd_Smed_v4_7193_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Unconventional myosin-XV vs. Ensembl Human
Match: MYO15A (myosin XVA [Source:HGNC Symbol;Acc:HGNC:7594])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 409/1155 (35.41%), Postives = 621/1155 (53.77%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFR-------KKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTG--RAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKS---PELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQ---IPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
             + G+++MT L +L + ++LSNL+IR+ + LIYTYIGSIL+S+NPY   GIY  + +  Y  + + + PPHLF +    + KM+   +NQ I+ISGESG+GKTE+ K +L+Y A ++   +EV Q           +IL++TPLLESFGNA+T+RNDNSSRFGK+VEIF + G I G+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG +SED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L++  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF+W++T+VN       L+  RQ  +            SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E I W  I + DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++        +A +F         +R  ++ + T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D+VM Q++Y+G+LETV+IRK GFP+++ F  F+ R+  LV     K  L      C+ ++ +   V    + +G +KLFLKE   + LE   + + N +A+ +QR  R ++  R           +QS  RG++ R+R +++   +VK ++ V   ++R+R+L+   E+            + Q    L   +  +S+        ++   +G+      L++P ELA LL    G            QV Q    R   L       LP DI+ + +  F+        F   + PL  P     +  +H  ++++  KLILR M     P  H    N +  ++  K    PEL+ EIL Q+  +             +H      R W LL   LS   PSP    Y+LKFVSD         CQ +L+Q       Q     R  P T LE  A  + +   L+V   +    S  ++S++ GE++A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1220 GEDGVEDMTQLEDLQETTVLSNLKIRFERNLIYTYIGSILVSVNPYQMFGIYGPEQVQQYNGRALGENPPHLFAVANLAFAKMLDAKQNQCIIISGESGSGKTEATKLILRYLAAMNQK-REVMQQ---------IKILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSWLITRVNA------LVSPRQDTL------------SIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQIDWQEITFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFMRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQGFIDRYCCLVAL---KHDLPANGDMCVSVLSRLCKVMPNMYRVGVSKLFLKEHLYQLLESMREHVLNLAALTLQRCLRGFFIKRRFRSLRHKIILLQSRARGYLARQRYQQMRRSLVKFRSLVHAYVSRRRYLKLRAEW------------RCQVEGALLWEQEELSK--------REVVAVGH------LEVPAELAGLLQAVAGL--------GLAQVPQVAPVRTPRLQAEPRVTLPLDINNYPMAKFVQCHFKEPAFGMLTVPLRTPL--TQLPAEHHAEAVSIFKLILRFM---GDPHLHGARENIFGNYIVQKGLAVPELRDEILAQLANQVW----------HNHNAHNAERGWLLLAACLSGFAPSPCFNKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTLPPTQLEWTATYEKASMALDVGCFNGDQFSCPVHSWSTGEEVAGDILRHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2292          

HSP 2 Score: 56.225 bits (134), Expect = 1.305e-6
Identity = 61/281 (21.71%), Postives = 118/281 (41.99%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIH-NFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVK--SRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQL 7007
            +L + + P++E++++ S++ + + A ++    +  + D    GQ+ D     NL+ K+   +  + +E + QV KQI  N S K  S    W  L I+  +   ++ + P L   L  + +      Q +A    +N +   +FG R ELP   E   ++ G         +P        I       DV++ IC  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+
Sbjct: 3047 MLCFTKTPLQESLIELSDSSLSKMATDMFLAVMRFMGDAPLKGQS-DLDVLCNLL-KLCGDHEVMRDECYCQVVKQITDNTSSKQDSCQRGWRLLYIVTAYHSCSEVLHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMALTRPEAFNEY--VIFVVTNRGQHVCP----LSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFENEL--YVTMHYNQV 3317          

HSP 3 Score: 55.4546 bits (132), Expect = 1.919e-6
Identity = 41/184 (22.28%), Postives = 89/184 (48.37%), Query Frame = 3
Query: 5133 PRTNLNNAKTEIV-PVPLPRNLSHNGKSGIPI-TLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLK--CELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQ 5672
            P T ++     +V PV      S    S +P  +L+P + ++ T+   L  L +  +Y YQ  PW   L++E++ P +  +  +   ++F QI+ D +   C+R   +E+ ++ ++        +++   + T ++ + +  T +   E+YFSR +      T  VG     +++SH G++ ++
Sbjct: 2628 PGTQVSREAVALVKPVTSAPRPSMAPTSALPSRSLEPPEELTQTR---LHRLINPNFYGYQDAPWKIFLRKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRISEDERLRMKALFAQ---NQLDTQKPLVTESVKRAVVSTARDTWEVYFSRIFP----ATGSVGTGVQLLAVSHVGIKLLR 2801          
BLAST of Unconventional myosin-XV vs. Ensembl Human
Match: MYO15A (myosin XVA [Source:HGNC Symbol;Acc:HGNC:7594])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 409/1155 (35.41%), Postives = 621/1155 (53.77%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFR-------KKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTG--RAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKS---PELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQ---IPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
             + G+++MT L +L + ++LSNL+IR+ + LIYTYIGSIL+S+NPY   GIY  + +  Y  + + + PPHLF +    + KM+   +NQ I+ISGESG+GKTE+ K +L+Y A ++   +EV Q           +IL++TPLLESFGNA+T+RNDNSSRFGK+VEIF + G I G+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG +SED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L++  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF+W++T+VN       L+  RQ  +            SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E I W  I + DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++        +A +F         +R  ++ + T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D+VM Q++Y+G+LETV+IRK GFP+++ F  F+ R+  LV     K  L      C+ ++ +   V    + +G +KLFLKE   + LE   + + N +A+ +QR  R ++  R           +QS  RG++ R+R +++   +VK ++ V   ++R+R+L+   E+            + Q    L   +  +S+        ++   +G+      L++P ELA LL    G            QV Q    R   L       LP DI+ + +  F+        F   + PL  P     +  +H  ++++  KLILR M     P  H    N +  ++  K    PEL+ EIL Q+  +             +H      R W LL   LS   PSP    Y+LKFVSD         CQ +L+Q       Q     R  P T LE  A  + +   L+V   +    S  ++S++ GE++A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1220 GEDGVEDMTQLEDLQETTVLSNLKIRFERNLIYTYIGSILVSVNPYQMFGIYGPEQVQQYNGRALGENPPHLFAVANLAFAKMLDAKQNQCIIISGESGSGKTEATKLILRYLAAMNQK-REVMQQ---------VQILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSWLITRVNA------LVSPRQDTL------------SIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQIDWQEITFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFMRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQGFIDRYCCLVAL---KHDLPANGDMCVSVLSRLCKVMPNMYRVGVSKLFLKEHLYQLLESMREHVLNLAALTLQRCLRGFFIKRRFRSLRHKIILLQSRARGYLARQRYQQMRRSLVKFRSLVHAYVSRRRYLKLRAEW------------RCQVEGALLWEQEELSK--------REVVAVGH------LEVPAELAGLLQAVAGL--------GLAQVPQVAPVRTPRLQAEPRVTLPLDINNYPMAKFVQCHFKEPAFGMLTVPLRTPL--TQLPAEHHAEAVSIFKLILRFM---GDPHLHGARENIFGNYIVQKGLAVPELRDEILAQLANQVW----------HNHNAHNAERGWLLLAACLSGFAPSPCFNKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTLPPTQLEWTATYEKASMALDVGCFNGDQFSCPVHSWSTGEEVAGDILRHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2292          

HSP 2 Score: 56.225 bits (134), Expect = 1.305e-6
Identity = 61/281 (21.71%), Postives = 118/281 (41.99%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIH-NFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVK--SRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQL 7007
            +L + + P++E++++ S++ + + A ++    +  + D    GQ+ D     NL+ K+   +  + +E + QV KQI  N S K  S    W  L I+  +   ++ + P L   L  + +      Q +A    +N +   +FG R ELP   E   ++ G         +P        I       DV++ IC  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+
Sbjct: 3047 MLCFTKTPLQESLIELSDSSLSKMATDMFLAVMRFMGDAPLKGQS-DLDVLCNLL-KLCGDHEVMRDECYCQVVKQITDNTSSKQDSCQRGWRLLYIVTAYHSCSEVLHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMALTRPEAFNEY--VIFVVTNRGQHVCP----LSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFENEL--YVTMHYNQV 3317          

HSP 3 Score: 55.4546 bits (132), Expect = 1.919e-6
Identity = 41/184 (22.28%), Postives = 89/184 (48.37%), Query Frame = 3
Query: 5133 PRTNLNNAKTEIV-PVPLPRNLSHNGKSGIPI-TLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLK--CELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQ 5672
            P T ++     +V PV      S    S +P  +L+P + ++ T+   L  L +  +Y YQ  PW   L++E++ P +  +  +   ++F QI+ D +   C+R   +E+ ++ ++        +++   + T ++ + +  T +   E+YFSR +      T  VG     +++SH G++ ++
Sbjct: 2628 PGTQVSREAVALVKPVTSAPRPSMAPTSALPSRSLEPPEELTQTR---LHRLINPNFYGYQDAPWKIFLRKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRISEDERLRMKALFAQ---NQLDTQKPLVTESVKRAVVSTARDTWEVYFSRIFP----ATGSVGTGVQLLAVSHVGIKLLR 2801          
BLAST of Unconventional myosin-XV vs. Ensembl Human
Match: MYO7B (myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607])

HSP 1 Score: 548.895 bits (1413), Expect = 5.572e-159
Identity = 309/798 (38.72%), Postives = 465/798 (58.27%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKFM----EEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGL----NQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNV-----------IENCEVVEIATIFRKKRELQTKNPTAKA----RTPAVMGD-FQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIR---KASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQ-IARK 2441
            S QG+D+M  L +L++  ++ NL IRY Q  IYTY GSIL+++NP+  L +Y  + +  Y ++ + ++PPH+F I    Y  M R+  +Q  +ISGESGAGKTE+ K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I+F+ +G I G+RI  +LLEKSR+    P ER YHIFY +L+G+ + +K         +Y YL      + +  NDA +     S    L  + SE  DV +++L+A+LHLGN+ FM    E  + S ++ET     V K+L+V    L+ CL   T     +     LN  Q+ + RD   K +Y  LF WIV K+N  +     Q+   VRR                +I +LDI+GFENF +NS EQLCIN+ANE LQQFF ++VF +EQEEY+ E ISW YI Y DN+P +DLL+ KP  II +L++E   PQG+D++ L K ++VH  N  + +PK  H  +F I HFAG + Y   GFLEKNRDVL  +IL +           I N E+ E        R+ +  N   K+    + P+ +G  F+ SL  L+  +  CQP+FIRC+KPN  K+ L F++++ + Q++Y+G++ETV IRKSGFPI+  F  F  RF +L+   +R   +  L+        + ++     +K ++ GKTK+FL++     LE Q   + +R+A+ IQ+  R Y   +  + Q +AA  +Q+  RG+ +RR  + + +G  +LQA  R Q +AR+
Sbjct:   63 SVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQLYYSRHMGELPPHVFAIANNCYFSMKRNKRDQCCIISGESGAGKTETTKLILQFLATISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKSRVCRQAPEERNYHIFYCMLMGVSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAHIRSAMKILQFSDSESWDV-IKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLEVQHQELRDCLIKHTILIRGEFVTRSLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFTPPAQDPKNVRR----------------AIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSENISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHANNKAFLQPKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTLVYSSKNKFLREIFNLELAETKLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLQGKLRQMTLGITDVWLR----TDKDWKAGKTKIFLRDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYRKEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFERLQAIARSQPLARQ 828          
BLAST of Unconventional myosin-XV vs. Ensembl Human
Match: MYO7B (myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607])

HSP 1 Score: 548.895 bits (1413), Expect = 5.572e-159
Identity = 309/798 (38.72%), Postives = 465/798 (58.27%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKFM----EEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGL----NQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNV-----------IENCEVVEIATIFRKKRELQTKNPTAKA----RTPAVMGD-FQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIR---KASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQ-IARK 2441
            S QG+D+M  L +L++  ++ NL IRY Q  IYTY GSIL+++NP+  L +Y  + +  Y ++ + ++PPH+F I    Y  M R+  +Q  +ISGESGAGKTE+ K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I+F+ +G I G+RI  +LLEKSR+    P ER YHIFY +L+G+ + +K         +Y YL      + +  NDA +     S    L  + SE  DV +++L+A+LHLGN+ FM    E  + S ++ET     V K+L+V    L+ CL   T     +     LN  Q+ + RD   K +Y  LF WIV K+N  +     Q+   VRR                +I +LDI+GFENF +NS EQLCIN+ANE LQQFF ++VF +EQEEY+ E ISW YI Y DN+P +DLL+ KP  II +L++E   PQG+D++ L K ++VH  N  + +PK  H  +F I HFAG + Y   GFLEKNRDVL  +IL +           I N E+ E        R+ +  N   K+    + P+ +G  F+ SL  L+  +  CQP+FIRC+KPN  K+ L F++++ + Q++Y+G++ETV IRKSGFPI+  F  F  RF +L+   +R   +  L+        + ++     +K ++ GKTK+FL++     LE Q   + +R+A+ IQ+  R Y   +  + Q +AA  +Q+  RG+ +RR  + + +G  +LQA  R Q +AR+
Sbjct:   63 SVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQLYYSRHMGELPPHVFAIANNCYFSMKRNKRDQCCIISGESGAGKTETTKLILQFLATISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKSRVCRQAPEERNYHIFYCMLMGVSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAHIRSAMKILQFSDSESWDV-IKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLEVQHQELRDCLIKHTILIRGEFVTRSLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFTPPAQDPKNVRR----------------AIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSENISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHANNKAFLQPKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTLVYSSKNKFLREIFNLELAETKLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLQGKLRQMTLGITDVWLR----TDKDWKAGKTKIFLRDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYRKEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFERLQAIARSQPLARQ 828          
BLAST of Unconventional myosin-XV vs. Ensembl Human
Match: MYO7A (myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606])

HSP 1 Score: 528.48 bits (1360), Expect = 7.166e-159
Identity = 298/829 (35.95%), Postives = 469/829 (56.57%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKE---------------DFARHLEKQVQIIRNRS--------AVIIQRKWRA------YWKIRLVIIQNQAATK-----------------IQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEF 2468
            S  G+++M  L +L++  +L NL IRY   LIYTY GSIL+++NPY  L IY  ++I  Y NK I +MPPH+F I +  Y  M R++ +Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++TP+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+      ER YH+FY +L G+    K +       DY+YL      T + R D+       S    L  T +E+ +++ ++L+A+LHLGN+++     E  +   ++ + ++   + +L+V+   L  CLT +T  T  +   +PL++EQ+++ RD   K +Y  LF WIV K+N  + +       Q V +        + RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQEEY  E I W +I + DNQ  +D+++ KP  II ++++E   P+G+D + L+K ++ H  N NY  PK  H  QF I+HFAG + Y   GFLEKNRD L  +I+ ++ +     I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++ + + Q++Y+G++ET++IR++G+PI+  F  F+ R+ +L+          D +  C ++     G  +  +++GKTK+FLK+               D    L+K ++  ++RS        A +IQR WR       Y  +RL  ++ QA  +                  Q+  R ++ R+  R     ++ +QA+ R  IAR+   R   E+
Sbjct:   63 SVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQYTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQALDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYANIRSAMKVLMFTDTENWEIS-KLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPDLMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPP----SQDVKN--------SRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYIPPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAET---RKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAEAVLGTHDD-WQIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARGMIARRLHQRLRAEY 863          
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 550.821 bits (1418), Expect = 3.734e-160
Identity = 298/767 (38.85%), Postives = 469/767 (61.15%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFF-DNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEE----QETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S QG+++M  L +  + ++L NL IRY +KLIY Y GSILI++NPY ++ IY    I  Y+ K I ++PPH+F I +  YT M R+ +NQ ++ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY+++ F ++G+I G++I  YLLEKSRIV  +  ER YHIFY +L GL    KS+       DY YL   K  T + R+DAA+L E  S    L +  +++    ++L+++LH+GNI+F +      E+  + +   +  ++K+L++ + +L   +T K+  T ++  IS LN +Q+++ RD L+K +Y +LF  IV +VN  + +                 + S   SI +LDI+GFENF  NS EQLCIN+ANETLQQFF  +VF++EQ+EY +E I+W +I + DNQ  +DL++ +P  I+ ++++E   P+G+D + L K H+ HG+N+ Y +PK      F + HFAGN+ Y+  GFLEKNRD    ++  +I + ++  +A +F        +  T+  +   V   F+ SL  L++++    P+FIRC+KPN  K AL  ++D+V+ Q++Y+G++ET+KIR+SG+PI+  +  F+ R+ +LV+      +  D   A  K+     G  N  ++LGKTK+FLK+     LE++   I    A++IQ+  R +   +    Q QAA  IQ+  RGF  R+R R++  G  +LQA +R
Sbjct:   60 SVQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLATISGQHSWIEQ-----------QVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSREEKSELELGTAADYYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTNDNMESVDVADPSTLVRIAKLLQLHEQNLLDAITTKSLVTREERVISRLNGQQAVDARDALAKAIYGKLFIHIVRRVNDAIYK----------------PSQSRRTSIGILDIFGFENFESNSFEQLCINFANETLQQFFVHHVFKMEQKEYDEEHINWRHIKFVDNQATVDLIAQRPLNILSLIDEESIFPKGTDKTMLLKLHSTHGRNELYLQPKSELQRAFGVTHFAGNVFYNTRGFLEKNRDSFSADLSVLISSSKMPFLARLFD-----DIEYDTSSRKKVTVGNQFRRSLEQLMSQLTQTHPFFIRCIKPNEMKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAAKKICHMILGT-NADYQLGKTKVFLKDKHDLVLEQEYYRILKDKAIVIQKNVRRWLVRKDFEKQRQAAVTIQTAWRGFDQRKRYRQIISGFSRLQAVLR 793          
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Match: hum-1 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q19901])

HSP 1 Score: 416.001 bits (1068), Expect = 7.489e-122
Identity = 253/761 (33.25%), Postives = 415/761 (54.53%), Query Frame = 3
Query:  126 KLHLSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTE----TVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAK-PNGIIQILNDECSIPQGS----DVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIR-NRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRR 2375
            K+++   G+D+M  L +L++QS++ NL+ R     I+TYIG +LIS+NP+ ++  + +K ++ YQ     +  PH++ + +  Y  M+ DNE+Q ++ISGESGAGKT + K ++ Y + +SGG ++V+         I   IL S PLLE+FGN+ T+RN NSSRFGKYVEI F   G   G +++N+LLEKSR+V+ N  +R +H+FY++  G D   +S +    ++ Y+YLN S  F   D +D    +  +     +G+  +D    +RI++ VLH+GNI F EE   + +   + +   + +L +    ++  LT +  E    T K+     LN EQ+   RD   K +Y+ LF+++V KVN  +N     +  QS  D        NF S+ +LDIYGFE F +N  EQ CIN+ NE LQQ F     + EQEEY +EGI W  I Y DN+ + DL+  K P GI+ +L+D C+   G     D   L         + ++     +    F+I H+AG+++Y+V GF ++NRDVL  +++ +++      I  +F      +    +A  R        ++   TL+  +  C P ++RC+KPN TK    + +  V  Q++Y G+ E +++R++GF  +  F  F  R Y +V+ +       DQQ AC  +       KN+ +++GKTK+F+K   +  L ++ +  + +  A +IQ+ WR +   +  I Q + A     ++ G  +RRR
Sbjct:    8 KVNVQHVGVDDMVLLPKLTEQSIVENLKKRLQANSIFTYIGPVLISVNPFKQMPYFTEKEMLLYQGAAQYENAPHIYALADNMYRNMLIDNESQCVIISGESGAGKTVNAKFIMNYISRISGGGQKVQH--------IKDVILQSNPLLEAFGNSATVRNWNSSRFGKYVEIVFSRGGEPIGGKLSNFLLEKSRVVHQNEGDRNFHVFYQLCAGADKNLRSTFGIGELQYYNYLNMSGVFKADDTDDGKEFESTLHAMKVVGVNDQDQLEVLRIVATVLHIGNITFTEENNFAAVSGKDYLEYPAFLLGLTSADIEAKLTGRKMESKWGTQKEEIDMKLNVEQASYTRDAWVKAIYARLFDYLVKKVNDAMN-----ITSQSTSD--------NF-SVGILDIYGFEIFNNNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVREGIKWTEIDYFDNKIVCDLIETKRPPGIMSLLDDTCAQNHGQREGVDRQLLTTLSKSFAGHPHFGPGSDS----FVIKHYAGDVTYNVDGFCDRNRDVLYPDLILLMQKSSRPFIQALFP-----ENVAASAGKRPTTFSTKIRTQANTLVESLMKCSPHYVRCIKPNETKRPNDWEESRVKHQVEYLGLRENIRVRRAGFAYRRAFDKFAQR-YAIVSPQTWPCFQGDQQRACEIICDSVHMEKNQ-YQMGKTKIFVKNPESLFLLEETRERKFDGYARVIQKAWRQFSARKQHIKQKEQAA---DLMYGKKERRR 732          
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 427.172 bits (1097), Expect = 2.852e-121
Identity = 266/792 (33.59%), Postives = 430/792 (54.29%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQ-KLIYTYIGSILISINPYTELG-IYDKKYIVSYQN--KLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEI-FFDNGN-ICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKML----KVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNF-----RSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVH--GKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF------RKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIR--KLHIGIVKLQAFVRMQIARKRF 2447
            G D++T L  L + ++L NLQ+R+ +   IYTY G +L++INPY +   IY ++ I  Y+   K  ++M PH+F + E  +  M    ++Q I++SGESGAGKT S K +++Y A V+       +  +  ++ I  R+L S P++ES GNA+TIRNDNSSRFGK+++I F + G  I G+ +  YLLEKSR+V   P ER YHIFY++    +       +    + YSYL    +  I   +D A+ +  +     LG   + +    R+L+ +L LGN+ F E  E S  V   +   +S++     K+ +  L+  LT +    V +    PL K +++  RD L+K LYS LF W+V K+N  LN+ + +              G+N      R I +LDIYGFE F  NS EQ  INYANE LQQ FN++VF+LEQEEY +E I W  + + DNQP IDL+   P G+I +L+++C    GSD  +L++  N     +N     P K     FI+ HFA +++YS  GF+EKNRD + +++L+V+   +   I T+              +  P  +     V   F+ SL  L++ + + +P ++RC+KPN +K +  F     + Q++  G+LETV+I  +GFP +  +  F  R+ ++ TKE      K +Q A L      + ++   + +GKTK+FL+      LE+        +A +IQ+ W+ +   R      ++   +Q+ ++ F+  RRI+  ++H  ++ +Q+ VR  + R+++
Sbjct:   80 GKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAAS-----KTRNGGTTSIEARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQLCAARNHQVLKDLHLGPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHF-ENGEGSSAVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEALNEKDKL-------------DGTNQKKRPDRFIGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIEG-PVGMINLLDEQCKRLNGSDADWLSQLQNSTELKRNPQLAFP-KVRSNDFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVIGSTAPTSVSSSSSSSTPGKRTIKKTVASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDKPKQFAELACQ---QCLEEGKYAVGKTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKY 847          
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 427.172 bits (1097), Expect = 3.431e-121
Identity = 266/792 (33.59%), Postives = 430/792 (54.29%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQ-KLIYTYIGSILISINPYTELG-IYDKKYIVSYQN--KLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEI-FFDNGN-ICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKML----KVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNF-----RSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVH--GKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF------RKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIR--KLHIGIVKLQAFVRMQIARKRF 2447
            G D++T L  L + ++L NLQ+R+ +   IYTY G +L++INPY +   IY ++ I  Y+   K  ++M PH+F + E  +  M    ++Q I++SGESGAGKT S K +++Y A V+       +  +  ++ I  R+L S P++ES GNA+TIRNDNSSRFGK+++I F + G  I G+ +  YLLEKSR+V   P ER YHIFY++    +       +    + YSYL    +  I   +D A+ +  +     LG   + +    R+L+ +L LGN+ F E  E S  V   +   +S++     K+ +  L+  LT +    V +    PL K +++  RD L+K LYS LF W+V K+N  LN+ + +              G+N      R I +LDIYGFE F  NS EQ  INYANE LQQ FN++VF+LEQEEY +E I W  + + DNQP IDL+   P G+I +L+++C    GSD  +L++  N     +N     P K     FI+ HFA +++YS  GF+EKNRD + +++L+V+   +   I T+              +  P  +     V   F+ SL  L++ + + +P ++RC+KPN +K +  F     + Q++  G+LETV+I  +GFP +  +  F  R+ ++ TKE      K +Q A L      + ++   + +GKTK+FL+      LE+        +A +IQ+ W+ +   R      ++   +Q+ ++ F+  RRI+  ++H  ++ +Q+ VR  + R+++
Sbjct:   80 GKDDLTLLSYLHEPAVLHNLQVRFVKGSSIYTYCGIVLVAINPYADCSHIYGEEIIQVYRGAGKSAREMDPHIFAVAEEAHFDMGAFGKSQSIIVSGESGAGKTVSAKFVMRYLASVAAS-----KTRNGGTTSIEARVLASNPIMESIGNAKTIRNDNSSRFGKFIQINFCERGRRIVGAEMKTYLLEKSRLVFQAPGERNYHIFYQLCAARNHQVLKDLHLGPCESYSYLTQGGDSRIPGVDDKADFEALLKALQLLGFDEKQMSDVFRLLAGLLLLGNVHF-ENGEGSSAVSASSCQEISRLCREFWKISESDLRIWLTRREIRAVNEIVTKPLTKNEAVRSRDALTKMLYSHLFGWLVDKINEALNEKDKL-------------DGTNQKKRPDRFIGVLDIYGFETFDVNSFEQFSINYANEKLQQQFNQHVFKLEQEEYIREEIEWVRVDFHDNQPAIDLIEG-PVGMINLLDEQCKRLNGSDADWLSQLQNSTELKRNPQLAFP-KVRSNDFIVRHFAADVTYSTDGFVEKNRDAIGEQLLDVVVASKFPFIRTVIGSTAPTSVSSSSSSSTPGKRTIKKTVASQFRDSLKELMSVLCSTRPHYVRCIKPNDSKISFDFEPKRAIQQLRACGVLETVRISAAGFPSRYPYEEFARRYRVIYTKEAALWRDKPKQFAELACQ---QCLEEGKYAVGKTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKY 847          
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 418.313 bits (1074), Expect = 5.597e-118
Identity = 259/769 (33.68%), Postives = 433/769 (56.31%), Query Frame = 3
Query:  150 IDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKE------VKQNSDQLS------SDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDS---LGLTSEDLDVAMRILSAVLHLGNIKFMEEQET--SYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYP-DNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKR-------ELQTKNPTA------KARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVII--QRKWRAYWKIRLVIIQNQAATKIQSIVR 2354
            I++M+ L  L++ S+L NL+ RY   LIYTY G   + INPY +L IY +  I  ++ K   +MPPH+F I +T Y  M+++ E+Q I+ +GESGAGKTE+ K++++Y A V+G  +        +QN  Q         ++  ++L + P+LE+FGN++T++NDNSSRFGK++ I FD +G I G+ I  YLLEKSR++     ER +HIFY++L G  +  KS+Y  +G+ +Y +L N +  T+ + +D   ++EF S  +S   +G   +++   MR++SAVL LGN++F +E+++  + L +   I  V  +L +    L+        +  ++      N+EQ+    + ++K  Y  LF W+VT++N  L++ +    RQ          G++F  I +LDI GFE F  NS EQ+CINY NE LQQ FN  +F LEQEEY++EGI W +I +  D QP IDL+  KP G++ +L++EC  P+ +D SF+ K    H K+  +  P       F + H+AG + YS   +L KN D L + ++ +++N     +A I++          E+   N TA      K     V    +  LT L+  ++   P F+RC+ PN  K++ K N ++V++Q++  G+LE ++I + GFP ++ F  F  R+ +L    I K  +  +++  ++ MI    +    + +G++K+F +     HLE++  +    +A+I+  Q + R +   RL   + Q ++ I+ I R
Sbjct:   80 IEDMSELTYLNEASVLHNLKDRYYSSLIYTYSGLFCVVINPYKKLPIYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGESGAGKTENTKKVIQYLAHVAGATRNKSLNAAAQQNIVQKPDVRNPIGELEHQLLQANPILEAFGNSKTVKNDNSSRFGKFIRINFDMSGYISGANIEFYLLEKSRVLRQAQDERSFHIFYQILRGCSAKEKSEYLLEGVDNYRFLVN-RGITLPNVDD---VQEFHSTINSMRIMGFADDEISSIMRVVSAVLLLGNLEFTQEKKSDQAMLQDDRVIQKVCHLLGLPVIELQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLFKWLVTRINKSLDRTH----RQ----------GASF--IGILDIAGFEIFDINSFEQICINYTNEKLQQLFNNTMFILEQEEYQREGIEWDFIDFGLDLQPTIDLIE-KPMGVLALLDEECLFPKANDKSFVEKLQKTHNKHPKFIVPDMRSKSHFAVVHYAGRVDYSADQWLMKNMDPLNENVVGLMQNSTDPFVAGIWKDAEFAGICAAEM---NETAFGMRSRKGMFRTVSQLHKEQLTKLMTTLRNTSPHFVRCIIPNHEKKSGKINSNLVLEQLRCNGVLEGIRICRQGFPNRVPFQEFRHRYEILTPDVIPKNFIDGKES--VRKMITALDIDTNLYRIGQSKVFFRTGVLAHLEEERDL--KLTALIMNFQAQCRGFLSRRLYTRRQQQSSAIRIIQR 820          
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Match: Myo10A (gene:FBgn0263705 transcript:FBtr0310333)

HSP 1 Score: 616.69 bits (1589), Expect = 6.535e-179
Identity = 398/1164 (34.19%), Postives = 600/1164 (51.55%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTEL-GIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ-----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCE---VVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRF-YLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHK-DDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAET--LPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSD----CIGVDQANTCQEKLLQFASSGH--PQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            L   G+++MT L +L + SLL NL++RY + LIYT+ GSILI++NPY      Y  +    Y  + +  +PPHLF IG   +  +      QV+VISGESG+GKTES K +++Y A V  G           S+ I  +IL++ PLLE+FGNA+T RNDNSSRFGKY+E++F +G I G++IT YLLEKSRIV   P ER YH+FYE+L GL    +S+Y       Y YLN         R D  +L+  M     LG++  + +  +R+L+AVLHLGN+ F   Q     E   +     I   + +L +  D L   LT +TTE   +   +PL  +Q+++ RD  +K LY+ LFNW+V+++N+       IV++    D            I++LDI+GFE+  +NS EQLCINYANE LQ +FN++VF+LEQ EY +E + W  +A+ DN P+I LL+ KP GI  +L+DE + P+ +D+SFL KCH  H  ++ Y +P +    +F + H+AG + Y V GFL+KNRD LR ++L ++ +     V E+    R +R+     P        T K RTP V   F  SL  LL  M  C PWF+RC+KPN  K AL+ +   V+ Q++Y G+L+T++IR+ G+P+++ F  F+ R+ +LL +   R    ++   A L+ M +  GV+   ++LG T++FL+E   R LE        R+AV +QR  R     R +  +  AAT++Q+  RG   ++R  +L  G +  Q   R + AR+R  +   +  +     +      Q   +    K  V E               +  +Y  L IP ELAF+  K +G +SP        +V+ T            +LP D+  F    F   + N +  + +  P+T P L     +D    D+L   KLILR    K++    + L   Y+   A  S  L+ EILVQ+  +   LP  S              TR W LLG  L    PS     Y+++FV D     +          +     SSG       R F    LE  A  +G    L +  PD  S +V ++S+T  E+ A+ ++          +GW++ +    ++ D  G +YV+D+I+  EL
Sbjct:   61 LGSSGVEDMTLLDDLHEASLLWNLRLRYDKGLIYTFAGSILIAVNPYKMFPDAYGLEVAKQYAGRPLGSLPPHLFAIGAAAHAAL---PSPQVVVISGESGSGKTESTKLVMQYLAAVVPG-------GGSASAVITEQILEAAPLLEAFGNARTARNDNSSRFGKYLEVYFKSGAIVGAKITQYLLEKSRIVTQAPGERNYHVFYELLGGLSETERSKYGLLEADKYFYLNQGATDCASGRVDWESLQGAM---QVLGVSEGEREGIVRVLAAVLHLGNVYFHRRQLRHGQEGVEVGSDAEIKWAAHLLHISADGLHRALTSRTTEARAERLHTPLGIDQALDARDAFAKALYAGLFNWLVSRINS-------IVQKGGTHD---------AHRISILDIFGFEDLAENSFEQLCINYANENLQLYFNKHVFKLEQAEYARERLEWTPLAWDDNLPVIHLLAKKPVGICHLLDDESNFPRATDLSFLEKCHYNHALSELYARP-RIGAQEFGVTHYAGQVWYCVDGFLDKNRDALRGDVLELLASSRLPLVGELTKQLRAQRDAGKTLPKGSNGRFVTMKPRTPTVAARFADSLQQLLQSMGRCHPWFVRCIKPNQEKHALRMDMPCVLQQLRYLGMLDTIQIRQRGYPVRLRFQHFVERYRHLLPSPLARGTPYRELCRALLEAMPR-TGVEGPDYQLGATRVFLREALHRALESGRTERLRRAAVSVQRHVRGMLVRRQLARRQAAATRLQARWRGQRAQQRYERLRKGALTAQRLWRGRQARRRVQQLRSDHRR----RQEAREAAQRAREAREAKQAVLER--------------SQLSY--LDIPAELAFIYSKLQG-WSPPHGDRHLVKVLGTVPGP---PSSAVQLPEDLGQFSFGKFSSVYCNGLRLQPRREPITAPLLTRAASRDQDFQDALAVFKLILRWSNDKALEGAKEKLLADYIVHKALSSRGLRDEILVQLCNQVHGLPPNSGEA-----------TRLWQLLGQCLCCFQPSAAFSKYLMRFVDDEAPESLRPLLLRQLLRQQGGGTSSGAVGAGACRSFVPAWLEWRAWTRGCDMALPLTLPDEASQTVAVDSWTSCEEAAALAVS---SLGVASRGWTLVLDDGQQLTDSCGLDYVMDLIAEKEL 1155          

HSP 2 Score: 75.8702 bits (185), Expect = 6.267e-13
Identity = 64/259 (24.71%), Postives = 109/259 (42.08%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGN--PSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTW 6944
            +++WQ   +R  +L+  N+ +   A+E  + +L    +I    +   +K    +     +   L +E++ Q+ KQ   N  P   S    W  LSIL  + G +  ++P+L+EHL     +        AA  L N +  ++ G RK +P   E   +  G         +P  + +  N   +  V DVI  +C  L V S+ E  E+SL       A      T  L  + +  D  + LLK  +P  ++ F R  W
Sbjct: 2564 LVKWQGHAIRLPLLRLPND-LAPLALECFDCILRYCGDIPLDPDLTEVKCVYTVLMHCHKYLALRDEVYCQLMKQTTANRSPCPDSSQRAWRLLSILAAYFGCSDALRPYLMEHLTSAASDRRRSCHGTAAVCLTNLRKTARCGGRKNVPSVEEVTAVSAGRSARRQIYRLPGGAERVVNTRCSTVVADVIAELCALLGVESEAEQQEFSLYCIVQGDA-----FTMPLAADEYILDVTTELLKSGQP-FYLIFCRSVW 2815          
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Match: Myo10A (gene:FBgn0263705 transcript:FBtr0346278)

HSP 1 Score: 616.69 bits (1589), Expect = 6.535e-179
Identity = 398/1164 (34.19%), Postives = 600/1164 (51.55%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTEL-GIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ-----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCE---VVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRF-YLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHK-DDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAET--LPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSD----CIGVDQANTCQEKLLQFASSGH--PQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            L   G+++MT L +L + SLL NL++RY + LIYT+ GSILI++NPY      Y  +    Y  + +  +PPHLF IG   +  +      QV+VISGESG+GKTES K +++Y A V  G           S+ I  +IL++ PLLE+FGNA+T RNDNSSRFGKY+E++F +G I G++IT YLLEKSRIV   P ER YH+FYE+L GL    +S+Y       Y YLN         R D  +L+  M     LG++  + +  +R+L+AVLHLGN+ F   Q     E   +     I   + +L +  D L   LT +TTE   +   +PL  +Q+++ RD  +K LY+ LFNW+V+++N+       IV++    D            I++LDI+GFE+  +NS EQLCINYANE LQ +FN++VF+LEQ EY +E + W  +A+ DN P+I LL+ KP GI  +L+DE + P+ +D+SFL KCH  H  ++ Y +P +    +F + H+AG + Y V GFL+KNRD LR ++L ++ +     V E+    R +R+     P        T K RTP V   F  SL  LL  M  C PWF+RC+KPN  K AL+ +   V+ Q++Y G+L+T++IR+ G+P+++ F  F+ R+ +LL +   R    ++   A L+ M +  GV+   ++LG T++FL+E   R LE        R+AV +QR  R     R +  +  AAT++Q+  RG   ++R  +L  G +  Q   R + AR+R  +   +  +     +      Q   +    K  V E               +  +Y  L IP ELAF+  K +G +SP        +V+ T            +LP D+  F    F   + N +  + +  P+T P L     +D    D+L   KLILR    K++    + L   Y+   A  S  L+ EILVQ+  +   LP  S              TR W LLG  L    PS     Y+++FV D     +          +     SSG       R F    LE  A  +G    L +  PD  S +V ++S+T  E+ A+ ++          +GW++ +    ++ D  G +YV+D+I+  EL
Sbjct:   61 LGSSGVEDMTLLDDLHEASLLWNLRLRYDKGLIYTFAGSILIAVNPYKMFPDAYGLEVAKQYAGRPLGSLPPHLFAIGAAAHAAL---PSPQVVVISGESGSGKTESTKLVMQYLAAVVPG-------GGSASAVITEQILEAAPLLEAFGNARTARNDNSSRFGKYLEVYFKSGAIVGAKITQYLLEKSRIVTQAPGERNYHVFYELLGGLSETERSKYGLLEADKYFYLNQGATDCASGRVDWESLQGAM---QVLGVSEGEREGIVRVLAAVLHLGNVYFHRRQLRHGQEGVEVGSDAEIKWAAHLLHISADGLHRALTSRTTEARAERLHTPLGIDQALDARDAFAKALYAGLFNWLVSRINS-------IVQKGGTHD---------AHRISILDIFGFEDLAENSFEQLCINYANENLQLYFNKHVFKLEQAEYARERLEWTPLAWDDNLPVIHLLAKKPVGICHLLDDESNFPRATDLSFLEKCHYNHALSELYARP-RIGAQEFGVTHYAGQVWYCVDGFLDKNRDALRGDVLELLASSRLPLVGELTKQLRAQRDAGKTLPKGSNGRFVTMKPRTPTVAARFADSLQQLLQSMGRCHPWFVRCIKPNQEKHALRMDMPCVLQQLRYLGMLDTIQIRQRGYPVRLRFQHFVERYRHLLPSPLARGTPYRELCRALLEAMPR-TGVEGPDYQLGATRVFLREALHRALESGRTERLRRAAVSVQRHVRGMLVRRQLARRQAAATRLQARWRGQRAQQRYERLRKGALTAQRLWRGRQARRRVQQLRSDHRR----RQEAREAAQRAREAREAKQAVLER--------------SQLSY--LDIPAELAFIYSKLQG-WSPPHGDRHLVKVLGTVPGP---PSSAVQLPEDLGQFSFGKFSSVYCNGLRLQPRREPITAPLLTRAASRDQDFQDALAVFKLILRWSNDKALEGAKEKLLADYIVHKALSSRGLRDEILVQLCNQVHGLPPNSGEA-----------TRLWQLLGQCLCCFQPSAAFSKYLMRFVDDEAPESLRPLLLRQLLRQQGGGTSSGAVGAGACRSFVPAWLEWRAWTRGCDMALPLTLPDEASQTVAVDSWTSCEEAAALAVS---SLGVASRGWTLVLDDGQQLTDSCGLDYVMDLIAEKEL 1155          

HSP 2 Score: 75.8702 bits (185), Expect = 6.267e-13
Identity = 64/259 (24.71%), Postives = 109/259 (42.08%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGN--PSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTW 6944
            +++WQ   +R  +L+  N+ +   A+E  + +L    +I    +   +K    +     +   L +E++ Q+ KQ   N  P   S    W  LSIL  + G +  ++P+L+EHL     +        AA  L N +  ++ G RK +P   E   +  G         +P  + +  N   +  V DVI  +C  L V S+ E  E+SL       A      T  L  + +  D  + LLK  +P  ++ F R  W
Sbjct: 2564 LVKWQGHAIRLPLLRLPND-LAPLALECFDCILRYCGDIPLDPDLTEVKCVYTVLMHCHKYLALRDEVYCQLMKQTTANRSPCPDSSQRAWRLLSILAAYFGCSDALRPYLMEHLTSAASDRRRSCHGTAAVCLTNLRKTARCGGRKNVPSVEEVTAVSAGRSARRQIYRLPGGAERVVNTRCSTVVADVIAELCALLGVESEAEQQEFSLYCIVQGDA-----FTMPLAADEYILDVTTELLKSGQP-FYLIFCRSVW 2815          
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Match: Myo10A (gene:FBgn0263705 transcript:FBtr0310334)

HSP 1 Score: 615.92 bits (1587), Expect = 1.116e-178
Identity = 398/1164 (34.19%), Postives = 600/1164 (51.55%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTEL-GIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ-----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCE---VVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRF-YLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHK-DDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAET--LPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSD----CIGVDQANTCQEKLLQFASSGH--PQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            L   G+++MT L +L + SLL NL++RY + LIYT+ GSILI++NPY      Y  +    Y  + +  +PPHLF IG   +  +      QV+VISGESG+GKTES K +++Y A V  G           S+ I  +IL++ PLLE+FGNA+T RNDNSSRFGKY+E++F +G I G++IT YLLEKSRIV   P ER YH+FYE+L GL    +S+Y       Y YLN         R D  +L+  M     LG++  + +  +R+L+AVLHLGN+ F   Q     E   +     I   + +L +  D L   LT +TTE   +   +PL  +Q+++ RD  +K LY+ LFNW+V+++N+       IV++    D            I++LDI+GFE+  +NS EQLCINYANE LQ +FN++VF+LEQ EY +E + W  +A+ DN P+I LL+ KP GI  +L+DE + P+ +D+SFL KCH  H  ++ Y +P +    +F + H+AG + Y V GFL+KNRD LR ++L ++ +     V E+    R +R+     P        T K RTP V   F  SL  LL  M  C PWF+RC+KPN  K AL+ +   V+ Q++Y G+L+T++IR+ G+P+++ F  F+ R+ +LL +   R    ++   A L+ M +  GV+   ++LG T++FL+E   R LE        R+AV +QR  R     R +  +  AAT++Q+  RG   ++R  +L  G +  Q   R + AR+R  +   +  +     +      Q   +    K  V E               +  +Y  L IP ELAF+  K +G +SP        +V+ T            +LP D+  F    F   + N +  + +  P+T P L     +D    D+L   KLILR    K++    + L   Y+   A  S  L+ EILVQ+  +   LP  S              TR W LLG  L    PS     Y+++FV D     +          +     SSG       R F    LE  A  +G    L +  PD  S +V ++S+T  E+ A+ ++          +GW++ +    ++ D  G +YV+D+I+  EL
Sbjct:  152 LGSSGVEDMTLLDDLHEASLLWNLRLRYDKGLIYTFAGSILIAVNPYKMFPDAYGLEVAKQYAGRPLGSLPPHLFAIGAAAHAAL---PSPQVVVISGESGSGKTESTKLVMQYLAAVVPG-------GGSASAVITEQILEAAPLLEAFGNARTARNDNSSRFGKYLEVYFKSGAIVGAKITQYLLEKSRIVTQAPGERNYHVFYELLGGLSETERSKYGLLEADKYFYLNQGATDCASGRVDWESLQGAM---QVLGVSEGEREGIVRVLAAVLHLGNVYFHRRQLRHGQEGVEVGSDAEIKWAAHLLHISADGLHRALTSRTTEARAERLHTPLGIDQALDARDAFAKALYAGLFNWLVSRINS-------IVQKGGTHD---------AHRISILDIFGFEDLAENSFEQLCINYANENLQLYFNKHVFKLEQAEYARERLEWTPLAWDDNLPVIHLLAKKPVGICHLLDDESNFPRATDLSFLEKCHYNHALSELYARP-RIGAQEFGVTHYAGQVWYCVDGFLDKNRDALRGDVLELLASSRLPLVGELTKQLRAQRDAGKTLPKGSNGRFVTMKPRTPTVAARFADSLQQLLQSMGRCHPWFVRCIKPNQEKHALRMDMPCVLQQLRYLGMLDTIQIRQRGYPVRLRFQHFVERYRHLLPSPLARGTPYRELCRALLEAMPR-TGVEGPDYQLGATRVFLREALHRALESGRTERLRRAAVSVQRHVRGMLVRRQLARRQAAATRLQARWRGQRAQQRYERLRKGALTAQRLWRGRQARRRVQQLRSDHRR----RQEAREAAQRAREAREAKQAVLER--------------SQLSY--LDIPAELAFIYSKLQG-WSPPHGDRHLVKVLGTVPGP---PSSAVQLPEDLGQFSFGKFSSVYCNGLRLQPRREPITAPLLTRAASRDQDFQDALAVFKLILRWSNDKALEGAKEKLLADYIVHKALSSRGLRDEILVQLCNQVHGLPPNSGEA-----------TRLWQLLGQCLCCFQPSAAFSKYLMRFVDDEAPESLRPLLLRQLLRQQGGGTSSGAVGAGACRSFVPAWLEWRAWTRGCDMALPLTLPDEASQTVAVDSWTSCEEAAALAVS---SLGVASRGWTLVLDDGQQLTDSCGLDYVMDLIAEKEL 1246          

HSP 2 Score: 75.8702 bits (185), Expect = 6.289e-13
Identity = 64/259 (24.71%), Postives = 109/259 (42.08%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGN--PSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTW 6944
            +++WQ   +R  +L+  N+ +   A+E  + +L    +I    +   +K    +     +   L +E++ Q+ KQ   N  P   S    W  LSIL  + G +  ++P+L+EHL     +        AA  L N +  ++ G RK +P   E   +  G         +P  + +  N   +  V DVI  +C  L V S+ E  E+SL       A      T  L  + +  D  + LLK  +P  ++ F R  W
Sbjct: 2655 LVKWQGHAIRLPLLRLPND-LAPLALECFDCILRYCGDIPLDPDLTEVKCVYTVLMHCHKYLALRDEVYCQLMKQTTANRSPCPDSSQRAWRLLSILAAYFGCSDALRPYLMEHLTSAASDRRRSCHGTAAVCLTNLRKTARCGGRKNVPSVEEVTAVSAGRSARRQIYRLPGGAERVVNTRCSTVVADVIAELCALLGVESEAEQQEFSLYCIVQGDA-----FTMPLAADEYILDVTTELLKSGQP-FYLIFCRSVW 2906          
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0080724)

HSP 1 Score: 550.051 bits (1416), Expect = 1.687e-159
Identity = 299/785 (38.09%), Postives = 463/785 (58.98%), Query Frame = 3
Query:  129 LHLSD-QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF--LRAH 2459
            +H S  QG+++M +L +L +  +L NL IRY + LIYTY GSIL+++NPY  L IY    I  Y+ + I ++PPH+F IG+  Y  M R  ++Q IVISGESGAGKTES K +L+Y A +SG    ++Q           +IL++ P+LE+FGNA+TIRNDNSSRFGKY++I F  NG I G++I  YLLEKSRIV+ N  ER YH+FY +L GL +  KS+       DY YL      T + R+DAA   +  S    L  + +++   +++L+A+LH GNIK+    ++  + + + E  N+  V+ +L +    L   LT +T     +  +S L+++QS++ RD   K +Y  +F  IV K+NT +                    G++  +I +LDI+GFENF  NS EQ CINYANE LQQFF +++F+LEQEEY  E I+W +I + DNQ  +DL++ K   I+ ++++E   P+G+D + L K H  HG + NY KPK      F ++HFAG + Y   GFL+KNRD    ++L+++       +  IF +  E+  +    + RTP +   F+ SL  L+  + +CQP+FIRC+KPN  K+ + F++ +   Q++Y+G++ET++IR++G+PI+  F  F+ R+  L+   +  A   D QAA  ++     G  +  ++LG TK+FLK+     LE++   +  R  +I+QR  R +   R  +    AA  +Q   +G+  R+R R + +G ++LQA +R ++   RF  LR H
Sbjct:   57 MHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQ-----------QILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAI----------------FKPRGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAET---RKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPG-VPPAHRTDCQAATSRICAVVLGKSD--YQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGH 808          
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0343687)

HSP 1 Score: 550.051 bits (1416), Expect = 1.687e-159
Identity = 299/785 (38.09%), Postives = 463/785 (58.98%), Query Frame = 3
Query:  129 LHLSD-QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF--LRAH 2459
            +H S  QG+++M +L +L +  +L NL IRY + LIYTY GSIL+++NPY  L IY    I  Y+ + I ++PPH+F IG+  Y  M R  ++Q IVISGESGAGKTES K +L+Y A +SG    ++Q           +IL++ P+LE+FGNA+TIRNDNSSRFGKY++I F  NG I G++I  YLLEKSRIV+ N  ER YH+FY +L GL +  KS+       DY YL      T + R+DAA   +  S    L  + +++   +++L+A+LH GNIK+    ++  + + + E  N+  V+ +L +    L   LT +T     +  +S L+++QS++ RD   K +Y  +F  IV K+NT +                    G++  +I +LDI+GFENF  NS EQ CINYANE LQQFF +++F+LEQEEY  E I+W +I + DNQ  +DL++ K   I+ ++++E   P+G+D + L K H  HG + NY KPK      F ++HFAG + Y   GFL+KNRD    ++L+++       +  IF +  E+  +    + RTP +   F+ SL  L+  + +CQP+FIRC+KPN  K+ + F++ +   Q++Y+G++ET++IR++G+PI+  F  F+ R+  L+   +  A   D QAA  ++     G  +  ++LG TK+FLK+     LE++   +  R  +I+QR  R +   R  +    AA  +Q   +G+  R+R R + +G ++LQA +R ++   RF  LR H
Sbjct:   57 MHASSVQGVEDMISLGDLHEAGILRNLLIRYKENLIYTYTGSILVAVNPYQILPIYTGDQIKLYKERKIGELPPHIFAIGDNAYAHMKRYRQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQ-----------QILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSANGVIEGAKIEQYLLEKSRIVSQNHSERNYHVFYCILAGLSADEKSRLDLGMAADYKYLTGGNSITCEGRDDAAEFSDIRSAMKVLLFSDQEIWEIIKLLAALLHCGNIKYKATVVDNLDATEIPEHINVERVAGLLGLPIQPLIDALTRRTLFAHGETVVSTLSRDQSVDVRDAFVKGIYGRMFVHIVRKINTAI----------------FKPRGTSRNAIGVLDIFGFENFDQNSFEQFCINYANENLQQFFVQHIFKLEQEEYNHEAINWQHIEFVDNQDALDLIAIKQLNIMALIDEEARFPKGTDQTMLAKLHKTHGSHKNYLKPKSDINTSFGLNHFAGVVFYDTRGFLDKNRDTFSPDLLHLVSQSTNKFLRQIFAQDIEMGAET---RKRTPTLSTQFRKSLDALMKTLSSCQPFFIRCIKPNELKKPMMFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPG-VPPAHRTDCQAATSRICAVVLGKSD--YQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVLSHRFRHLRGH 808          
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Match: myo15aa (myosin XVAa [Source:ZFIN;Acc:ZDB-GENE-080425-2])

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 410/1157 (35.44%), Postives = 612/1157 (52.90%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF-------RKKRELQTKNPTAKARTPA--VMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRF-YLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKL-SIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKL-----ILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSG--HPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L EL + ++L NL+ R+ + LIYTYIGSIL+S+NPY    IY    ++ ++   + + PPHLF I   +YTKMM   ENQ I+ISGESG+GKTE+ K +L+Y A +       KQN       I  +IL++TPLLESFGNA+T+RNDNSSRFGKY+EIF + G I G+  + YLLEKSRIV     ER YHIFYE+L GL S  K  +Y +  + Y YLN   +  I  ++D  + +  +S  + L  ++ED     R+LS++LHLGN+ F     E QE + +V  + I +V+++L++  + L+  +T K TET+++   +PL  E +I+ RD ++K LYS LF+W+  ++N  +   N  +                  SI++LDIYGFE+   NS EQLCINYANE LQ FFNR +F+ EQ+EY +E I W  + + DNQ  IDL++AKP+GI++IL+D+   PQ +D +FL KCH  HG N  Y KPK   P +F I H+AG +SY V  FL+KN D +R+++L++    +   +A +F        ++R    KN T   R  A  V   FQ SL  L+ KM+   P+F+RC+KPN  KE   F+ ++V  Q+ Y+GILETV+IR+ G+PI++ F VFL R+  LL  K+   A+ ++    C+ ++ K   V+   F++G TKLF+KE+    LE +   +R+ +A+ +QR                         R F  R+R     + I++LQA  R  + RKR+++      K  S+ +  ++ K     +    +    E  +      K+  +    N   L IP EL  LL    G              +   +A  +    +  LP DI+ + +   +        F   + PL  P         H DD LT   L     ILR M    +    + L  +Y+      +  L+ EIL QI      +  +      D+ E    R W LL   LS   PS  +  Y+LKFVSD    +     Q KL+Q        P+  R +P + LE  AN+K +   L V   D  S    ++S+T GE+LA   L  R    +  KG SV +    +  + +G +YV+D+I+ +EL
Sbjct: 1831 EDGVEDMTQLEELHEGAVLLNLKKRFERNLIYTYIGSILVSVNPYKMFNIYGTDMVLQHKGHALGENPPHLFAIANASYTKMMDAKENQCIIISGESGSGKTETTKLVLRYLAAI-----HHKQN-------ITQQILEATPLLESFGNAKTVRNDNSSRFGKYMEIFMEEGVISGAITSQYLLEKSRIVFQAKDERNYHIFYEMLAGLPSQQKQSFYLQDAETYYYLNQGGDCVIVGKSDGEDFRRLLSAMEILHFSAEDQSGIFRVLSSILHLGNVFFERYETESQEVASVVSAQEIRVVAELLQISPEGLQKSITFKVTETMREKIYTPLTVESAIDARDAVAKILYSLLFSWLTDRINKQVYPRNEAL------------------SISILDIYGFEDLTFNSFEQLCINYANEYLQFFFNRVIFKEEQDEYNREQIIWEEVPFSDNQACIDLIAAKPHGILRILDDQSGFPQATDHTFLQKCHYHHGNNPLYSKPKMPLP-EFTIKHYAGKVSYQVHKFLDKNYDQVRQDVLDLFIQSKNKMVAYLFMNYAEALNQQRSQIGKNSTVTRRHQASTVAAKFQQSLLELIEKMERANPYFVRCIKPNQNKEPAVFDMELVSAQLCYSGILETVRIRREGYPIRMPFDVFLFRYKSLLGLKQPPPANGEN----CVIMLRKLCPVRPGAFQVGVTKLFMKEEIYFLLESKRDRVRHVAALTLQR-----------------------YTRMFFVRKRYTAFRMKIIRLQAHCRGFLTRKRYVKMRVSLVKFRSLVHMYVDRKRYIRLRYEARRKAEEEQRRIEMELSKREVV----NVTHLVIPAELGALLQAAAGGRE------LHSDCLALVQAPTVQVETQLTLPLDINNYTISKLVQIHFKEPKFGMLTAPLKTPLT-------HVDDDLTHEALDVFVMILRFMGDPHLNGAQENLFGNYIIQKGLTNLNLRDEILCQI------ANQVWRNPNPDNSE----RGWLLLLACLSAFAPSAKVEKYLLKFVSDHAYNEFKAVGQHKLIQAMQKSLYGPETARTYPLSLLEWTANRKKANMVLQVHCFDGTSFLCPVHSWTSGEELAGDILQHR-GVTEAWKGCSVIMKEHGQWAELAGHDYVMDLIADMEL 2901          

HSP 2 Score: 60.8474 bits (146), Expect = 3.005e-8
Identity = 33/126 (26.19%), Postives = 62/126 (49.21%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQ 5672
            +YTY  VPW   L++E++ P +  N  ++  ++F QIV D     CIR    E++K+ S+     + D ++ +         V+      ++YFSR +      +  VG     +S+SH G++ ++
Sbjct: 3272 HYTYTNVPWKIYLRKEVFYPKDSFNHPLILDLLFKQIVHDTFSEACIRITTEERQKMKSIFAEH-SIDASATIQDENVKKKVVVAAKDTWDIYFSRLFP----ASGSVGTGVQVLSVSHRGIKLLK 3392          
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Match: myo15ab (myosin XVAb [Source:ZFIN;Acc:ZDB-GENE-090312-149])

HSP 1 Score: 612.453 bits (1578), Expect = 3.410e-179
Identity = 393/1154 (34.06%), Postives = 592/1154 (51.30%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKART---------PAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAH----PEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNE--NVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGH--PQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            G ++MT + +L++ ++L NL+IR+ Q+LIYTYIGSIL+S+NPY    IY    ++ Y+   + D PPHLF I    YT MM   +NQ I+ISGESG+GKTE+ K +L+Y   +       K+N       I  +IL++TPLLESFGNA+T+RNDNSSRFGK+VEIF + G I G+  + YLLEKSRIV     ER YHIFYE+L GL S  K  +Y +  + Y YLN      I  ++D  + +   S  D L  ++ED     R+LS++LHLGN+ F     E QET+ +V T+ I  V+ +L++  + L+  +T K TE +++   +PL+ E +++ RD ++K LYS LFNW+  ++N  +   N  +                  SI++LDIYGFE+   NS EQLCINYANETLQ FF++ +F+ EQEEY +E I+W  + + DNQ  IDL+SAKP+G+++IL+D+   PQ +D +FL KCH  HG N  Y KPK    P+F ++H+AG ++Y V  FL+KN D +R+E+L++    +   ++ +F K  E+  +   A  R+           V   FQ SL  LL KM+ C P+F+RC+KPN  K  LK N   V                              SR+  L+  +    S  D    C+ ++ K   +    +++G +KLFLKE+  + LE +   + + +A+ +QR  R ++  R  +      T +Q+  +GF+ R+R  ++ I +++ +A +R+ + RKR++R        F K  I  + +                                     N   L IP EL  LL  T G     S       ++Q  R Q      +  LP DI+  ++  ++      + F      LT P  N    +  D K D++    LILR M   ++    + L  +Y+      +P ++ EIL QI  +   +++ R             R W L+   LS   PS  +  Y+LKFVSD         CQ KLLQ     +  P+  R +P + LE  A +K +   L V   D  S    ++S+T GE LA   L  R    +   GWSV +    +  +  G +YVLD++  LEL
Sbjct:   20 GTEDMTQMEQLTEPAVLINLKIRFDQELIYTYIGSILVSVNPYQLFNIYGTDMVLQYEGHAMADNPPHLFAIANVAYTTMMDIKQNQCIIISGESGSGKTEATKLVLRYLTAIHH-----KRN-------ITQQILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEEGVISGAITSQYLLEKSRIVFQAKDERNYHIFYEMLAGLPSHTKRAFYLQEAETYYYLNQGGNCGITGKDDGEDFRRLQSAMDILHFSTEDQSSIFRVLSSILHLGNVFFHRVETEVQETAGVVSTQEIRAVADLLQISPEGLQKAITFKVTEAMREKIYTPLSVESAVDARDAVAKILYSLLFNWLTDRINGRVYPRNEAL------------------SISLLDIYGFESLVFNSFEQLCINYANETLQFFFSKIIFKQEQEEYIREQINWKELTFTDNQACIDLISAKPHGLLRILDDQSCFPQATDNTFLQKCHYHHGNNPLYSKPKMPL-PEFTVYHYAGRVTYQVHKFLDKNFDQVRQEVLDLFMQSQNRTVSNLFIKHSEMLNQQKGAMNRSSTVTRRYQPSTVAAKFQQSLQELLDKMERCNPFFVRCIKPNNNKH-LKVNDQCV------------------------------SRYKALLGMKKPPPSDGDN---CVMMLTKLCPINKGDYQVGVSKLFLKEEVYQLLESKRDRVMHIAALTLQRYVRMFFARRKFLKFRLTMTHLQAHCKGFMARQRFLRMRINLIRHRAMIRLIVNRKRYIRVCLVCVSSFLKERISREVV-------------------------------------NVTQLVIPAELGGLLQATAGGRERHSDC---LALVQAPRIQ---TDPQLTLPLDINNHLMTKYIRTHFRELLFGM----LTAPLENSLTRLEDDLKQDAVDVFILILRFMGDPNLNGAQENLFGNYIIQRGLATPPIRDEILAQIANQVWRNENSRNA----------ERGWLLMAACLSSFAPSEKMEKYLLKFVSDYALNGFKALCQHKLLQAMQKSYLVPEASRTYPPSLLEWTATRKKAHMVLQVHCFDGVSFLCPVHSWTNGEGLAGDVLQHRGVSAESRWGWSVLMKEPAQWVELEGHDYVLDLVCDLEL 1051          

HSP 2 Score: 64.3142 bits (155), Expect = 2.774e-9
Identity = 66/268 (24.63%), Postives = 114/268 (42.54%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLL-LLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVK--SRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLE-ITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLD 6965
            ++++ ++P+ E+++  ++  + R A EI   ++  + D    GQ+   +    L  K+  +   + +E + QV KQI  N S K  S    W  L IL  F   ++ ++PFLL+ L  + ++       +A    +N +   +FG R   P   E   +M G          P        I   +   DVI+ +C  +  L +LE + EY+  VF +T  G      N       Y  +I+   +Q   N    F R+ W  PL  D
Sbjct: 1892 MVKFNKNPILESLIDFTDPNMNRVASEIFLAIMKFMGDHPLRGQSEQFVVCTFL--KLTGEYGLMKDEAYCQVLKQITANTSSKPDSCQKGWRLLYILTAFYRCSEVLKPFLLKFLRDVCRSPEVHFHGIAKTCEQNLRKTFQFGGRSVYPSSMELKAIMAGRSSKRQLFLFPGGIERHLKIKTCSVALDVIEELCYEM-ALQRLEAMDEYT--VFIVTNRGQNVRPLN----KREYILDIATEAEQIDANYSFWFRRVIWAHPLKFD 2150          

HSP 3 Score: 60.4622 bits (145), Expect = 3.562e-8
Identity = 39/146 (26.71%), Postives = 70/146 (47.95%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLK----------CELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRF---VQQNSRSPE 5693
            +YTY  VPW   L++E++ P +  N  ++  +IF QIV D     C+R    E++K+ S+              +  NT   V DE++K           E+YFSR +      +  VG     +++SH+G++    V+ ++ +P+
Sbjct: 1516 HYTYTNVPWKIYLRKEVFYPKDSWNHLLVLDLIFKQIVNDTFTEACVRITKEERQKMKSLFAQ---------YGIEPNT--DVQDESVKKTVIAAARESWEIYFSRLFP----ASGSVGTGVQVLAVSHTGIKLLKTVKSSTAAPD 1646          
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Match: BX324225.1 (myosin VIIAb [Source:NCBI gene;Acc:556141])

HSP 1 Score: 548.125 bits (1411), Expect = 1.207e-158
Identity = 289/767 (37.68%), Postives = 453/767 (59.06%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQE----TSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S  G+++M  L +L++  +L NL IRY  ++IYTY GSIL+++NPY  L IY    I  Y NK I +MPPH+FGI +  Y  M R+ ++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKYV+I F+  G I G++I  YLLEKSR+      ER YHIFY +L G+    K++       DY+YL        + R+D       +S    L  T  +     ++L+A+LH+GN++F    +    T  +V + ++   + +L+VD   +  CLT +T  T  ++  +PL+ EQ ++ RD   K +Y  LF WIV K+N        I R  S  +R++       RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF  +VF+LEQEEY  E I+W  I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK ++ H  N NY  PK +H  QF I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++ + + Q++Y+G++ET++IR++G+PI+  F+ F+ R+ +L+         +D +  C ++++    +++  +++GKTK+FLK+     LE +   +     ++IQ+  R   +    +   +A   IQ I RG+I R+    + +G ++LQA  R
Sbjct:   63 SIHGVEDMIRLGDLNEAGILRNLLIRYNDRVIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNKKIGEMPPHIFGIADNCYFSMQRNKKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKSRVCRQAADERNYHIFYCMLAGMSPDQKTKLGLGRATDYTYLTMGNCTVCEGRDDMKEYSSILSAMKILMFTETEYWEISKLLAAILHMGNLRFEARTQRNLDTCVVVRSPDLANAASLLEVDPQDVMMCLTTRTLITRGESVSTPLSVEQGLDVRDAFVKGIYGRLFVWIVDKINA------TIFRAPSTENRTVR------RSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVHHVFKLEQEEYNLEDINWQDIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNSQHKLNTNYIPPKHSHETQFGIQHFAGVVHYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGMET---RKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNELKKPMMFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDLRGTCQRIVVSVL-LRDDDWQIGKTKIFLKDHHDMLLEMERDKVITDKVILIQKTVRGMKERTKFLKVRRAVMLIQRIWRGYITRKHYAVMRVGFLRLQALYR 802          
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 548.125 bits (1411), Expect = 1.310e-158
Identity = 289/767 (37.68%), Postives = 453/767 (59.06%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQE----TSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S  G+++M  L +L++  +L NL IRY  ++IYTY GSIL+++NPY  L IY    I  Y NK I +MPPH+FGI +  Y  M R+ ++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKYV+I F+  G I G++I  YLLEKSR+      ER YHIFY +L G+    K++       DY+YL        + R+D       +S    L  T  +     ++L+A+LH+GN++F    +    T  +V + ++   + +L+VD   +  CLT +T  T  ++  +PL+ EQ ++ RD   K +Y  LF WIV K+N        I R  S  +R++       RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF  +VF+LEQEEY  E I+W  I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK ++ H  N NY  PK +H  QF I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++ + + Q++Y+G++ET++IR++G+PI+  F+ F+ R+ +L+         +D +  C ++++    +++  +++GKTK+FLK+     LE +   +     ++IQ+  R   +    +   +A   IQ I RG+I R+    + +G ++LQA  R
Sbjct:   63 SIHGVEDMIRLGDLNEAGILRNLLIRYNDRVIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNKKIGEMPPHIFGIADNCYFSMQRNKKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKSRVCRQAADERNYHIFYCMLAGMSPDQKTKLGLGRATDYTYLTMGNCTVCEGRDDMKEYSSILSAMKILMFTETEYWEISKLLAAILHMGNLRFEARTQRNLDTCVVVRSPDLANAASLLEVDPQDVMMCLTTRTLITRGESVSTPLSVEQGLDVRDAFVKGIYGRLFVWIVDKINA------TIFRAPSTENRTVR------RSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVHHVFKLEQEEYNLEDINWQDIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNSQHKLNTNYIPPKHSHETQFGIQHFAGVVHYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGMET---RKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNELKKPMMFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDLRGTCQRIVVSVL-LRDDDWQIGKTKIFLKDHHDMLLEMERDKVITDKVILIQKTVRGMKERTKFLKVRRAVMLIQRIWRGYITRKHYAVMRVGFLRLQALYR 802          
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 547.74 bits (1410), Expect = 1.337e-158
Identity = 290/767 (37.81%), Postives = 453/767 (59.06%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQE----TSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S  G+++M  L +L++  +L NL IRY  ++IYTY GSIL+++NPY  L IY    I  Y NK I +MPPH+FGI +  Y  M R+ ++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKYV+I F+  G I G++I  YLLEKSR+      ER YHIFY +L G+    K++       DY+YL        + R+D       +S    L  T  +     ++L+A+LH+GN++F    +    T  +V + ++   + +L+VD   +  CLT +T  T  ++  +PL+ EQ ++ RD   K +Y  LF WIV K+N        I R  S  +R++       RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF  +VF+LEQEEY  E I+W  I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK ++ H  N NY  PK +H  QF I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++ + + Q++Y+G++ET++IR++G+PI+  F+ F+ R+ +L+  E       D +  C ++++    +++  +++GKTK+FLK+     LE +   +     ++IQ+  R   +    +   +A   IQ I RG+I R+    + +G ++LQA  R
Sbjct:   58 SIHGVEDMIRLGDLNEAGILRNLLIRYNDRVIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNKKIGEMPPHIFGIADNCYFSMQRNKKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYVDIHFNKRGAIEGAKIEQYLLEKSRVCRQAADERNYHIFYCMLAGMSPDQKTKLGLGRATDYTYLTMGNCTVCEGRDDMKEYSSILSAMKILMFTETEYWEISKLLAAILHMGNLRFEARTQRNLDTCVVVRSPDLANAASLLEVDPQDVMMCLTTRTLITRGESVSTPLSVEQGLDVRDAFVKGIYGRLFVWIVDKINA------TIFRAPSTENRTVR------RSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVHHVFKLEQEEYNLEDINWQDIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNSQHKLNTNYIPPKHSHETQFGIQHFAGVVHYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGMET---RKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNELKKPMMFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGE-------DLRGTCQRIVVSVL-LRDDDWQIGKTKIFLKDHHDMLLEMERDKVITDKVILIQKTVRGMKERTKFLKVRRAVMLIQRIWRGYITRKHYAVMRVGFLRLQALYR 790          
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Match: MYO15A (myosin XVA [Source:NCBI gene;Acc:100488159])

HSP 1 Score: 562.762 bits (1449), Expect = 1.289e-161
Identity = 298/752 (39.63%), Postives = 450/752 (59.84%), Query Frame = 3
Query:  252 ILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF---------RKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKF-KGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFID---RRRIRKLHIGI-VKLQAFVRMQIARKRFLR 2453
            IL+S+NPY  L IY   +++ Y+ K + + PPHLF I    YTK+M    NQ I+ISGESG+GKTE+ K +L+Y   V+                + ++IL++TPLLESFGNA+T+RNDNSSRFGK++EI+ + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL S  K  +Y +  + Y YLN      I  ++DA + +  ++  +SL  T ED D   RILS++LHLGN+ F     E QE + +V    I +V+++L++  + L+  +T K TET+++  ++PL  + +++ RD ++K LYS LF+W+  ++      N L+  +Q  +            SIA+LDIYGFE+   NS EQLCINYANE LQ FFN+ +F+ EQEEY +E I W  I++ DNQ  ID++S KP+GI++IL+D+   PQ +D +FL KCH  HG ND Y KPK    P+F I HFAG ++Y V  FL+KN D +R+++L++  N  +  +A +F         +K    ++   T K +   V   FQ SL  L+ KM+ C P+F+RC+KPN+ KE   F  DIV  Q+KY+GILET++IRK GFP++I F  FLSR+  ++       +++     C+ ++ K         + +G +KLF+KE+  + LE +  ++ N++AV +QR  R Y   R   I      ++Q++ RG+++   R  +   H+ +  +L   +R    ++  LR
Sbjct: 1001 ILLSMNPYKMLNIYGTDHVLKYEGKALGENPPHLFAIANVAYTKLMDAKNNQCIIISGESGSGKTEATKLVLRYLVAVNQ------------RRGVTSKILEATPLLESFGNAKTVRNDNSSRFGKFIEIYLEEGVICGAITSQYLLEKSRIVFQAKNERNYHIFYEMLAGLPSQQKQMFYLQDAETYYYLNQGGNCDIPAKSDADDFRRLLNAMESLSFTGEDQDSIFRILSSILHLGNVYFEKYETESQEIASVVSASEIRVVAELLQISPEGLQKAITYKVTETMREKILTPLTVDSAVDARDAIAKILYSLLFSWLTDRI------NKLVYPKQDAL------------SIAILDIYGFEDLSFNSFEQLCINYANEYLQFFFNKIIFKEEQEEYIREQIDWREISFSDNQACIDIISQKPHGILRILDDQSCFPQATDHTFLQKCHYHHGTNDLYCKPKMPL-PEFGIKHFAGKVTYQVHKFLDKNYDQVRQDVLDLFVNSRIKVVANLFFSHAQVLAQQKTMMGKSNTVTRKYKASTVAAKFQQSLLELVEKMERCNPFFVRCIKPNSRKEPSLFESDIVTSQLKYSGILETIRIRKEGFPVRIPFHFFLSRYRCVMD---LGPNVRVDGQICVTVLKKLCPSASPSMYCIGVSKLFMKENVYQQLESKRDLLMNKAAVTLQRYSRGYLTRRRYYILRYRIIQLQAVARGYLELTKREVVNVTHLELPAELAGLLRSTAGKQSILR 1718          

HSP 2 Score: 86.2705 bits (212), Expect = 9.063e-16
Identity = 67/222 (30.18%), Postives = 106/222 (47.75%), Query Frame = 3
Query: 2898 SLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQF--ASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHW 3557
            S    + ILR M    +    + L  +Y+      +  L+ EIL QI         +      ++EE    R W LL   LS   PSP++  Y+LK+VSD         CQ KL+Q    S    +  R FP + LE  A+++ +   +++   D    S  I+S+T GE++A   L  R    +  +GWSVS+    +  + +GQ+YVLD+I  +ELP+ +
Sbjct: 1709 STAGKQSILRFMGDPYLGGTQEMLFGNYIVQKGLSNTGLRDEILAQI------GNQVWRNTNPNNEE----RGWYLLACCLSTFAPSPNLDKYLLKYVSDYAYNGYKPVCQHKLIQAIQKSQQGSETARNFPPSLLEWTASRERANMAIDIHCFDGAKISCPIHSWTDGEEIAGDVLRHR-GVIEGFRGWSVSLKEGGQWTELAGQDYVLDLICNMELPREF 1919          
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Match: MYO7B (unconventional myosin-VIIb [Source:NCBI gene;Acc:100491953])

HSP 1 Score: 537.339 bits (1383), Expect = 9.165e-156
Identity = 293/778 (37.66%), Postives = 461/778 (59.25%), Query Frame = 3
Query:  144 QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNIC-GSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASIS-PLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-----MQIARKR 2444
             G+++M  L EL++  ++ N+ IRY +  IYTY GSIL+++NPY EL +YD + +  Y+N+ I ++PPH+F +G+T +  M R N +Q  VISGESGAGKTES K +L++ A  SG    ++Q           +IL++ P++E+FGNA+TIRNDNSSRFGKY+EI F N ++  G+RI  +LLEKSR+   +P ER YHIFY +LLG+ S  K Q   +   DY YL          R+D     +  +    L L+  +     ++L+A+LHLGN+KF        E   + E+ ++  V+ +L+VD   L +CL+  T   V+  S+S PL+  Q+ + RD   K +Y  LF WIV K+N  +   +               + +  RS+ +LDI+GFE+F  NS EQLCIN+ANE LQQFF R++F+LEQEEY  E I W +I + DNQ  +D+++ +P  II ++++E   PQG+D + L K +NVH K + Y   K  H  +F I+H+AG + Y   GFL+KNRD+L  +I+ +I       +  +F+ ++  ++             G F+ SL  L+  +++CQP+FIRC+KPN  K+   F++++ + Q++Y+G++ET++IRK+G+PI+  FS F  R+ +L+  +      ++ +  C+ +     G K++ +++GKTKLFLK++    LE +       SA+ IQ+  R Y   +  + Q +AA KIQS  + +  R+  +K+  G  +LQA +R     MQ  +KR
Sbjct:   65 HGVEDMIRLGELNEAGIVHNIHIRYKENNIYTYTGSILVAVNPYQELPLYDTEQLEMYRNRRIGELPPHIFALGDTCFFNMQRTNTDQCCVISGESGAGKTESTKLMLQFLASASGQHSWIEQ-----------QILEANPIMEAFGNAKTIRNDNSSRFGKYIEIHFSNKHVIEGARIEQFLLEKSRVCRQSPGERNYHIFYCMLLGMGSEQKKQLNLESPSDYKYLTMGNCTNCDGRDDHKAFSQIRTAMKILLLSEIEQQEIFKMLAAILHLGNLKFKAAMCGNLECCDVPESIHLSTVATLLEVDSAQLTNCLSNHTI-IVRGESVSKPLSCTQASDSRDAFVKGIYGRLFMWIVNKINKAIFTPD---------------SENGRRSVGLLDIFGFEHFDTNSFEQLCINFANEHLQQFFVRHIFKLEQEEYNAEQIPWEHIDFSDNQRTLDVIALRPLNIISLIDEESKFPQGTDATMLVKLNNVHSKTNVYIASKSVHDTKFGINHYAGIVYYETEGFLDKNRDLLSTDIMLMIHTSSNYFLKQVFQMEKITKSS------------GSFKQSLEQLMKILESCQPYFIRCIKPNEFKKPKMFDRELCIRQLQYSGMMETIRIRKAGYPIRYSFSEFFQRYRVLLPIQSPYRKKENFREGCIDIAKSVIG-KHEDWKVGKTKLFLKDNHDTKLEVERDKAITASAIRIQKVVRGYKDRKRFLRQREAAIKIQSAWKSYYCRKTFQKMLHGFQRLQAIIRSRPVQMQYKKKR 802          

HSP 2 Score: 62.7734 bits (151), Expect = 1.075e-8
Identity = 125/590 (21.19%), Postives = 239/590 (40.51%), Query Frame = 3
Query: 5316 PWVFMLKREIYLPNEIQNT-TIMNPMIFCQIVRDLI--EFPCIRWVGNEKRKLLSVI--GNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINL--------TSNLDIKKRTRG--LLKEAVPFTDSGTMMLGVNNERIQFTSHSITNNIY-----KNTDKPINTDKVYDKVKKQGN--------LIDFTVNFSKYKDRQHVSNVILR----------WQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPL---LKQKKP----NLFIKFLRLTWI 6947
            PW    ++EI+ P    +T ++   +I+CQ++R L   E+ C +   + KR  +SV+  G     + +  L V       V    L+  L FS+F+E        +   +  ++I+   + F+ +     E  LL    + +  +  +  KT  Q        + T   ++F + + H +    L++ F +  K  +SH  + L        T   D+     G  LL +  P        +   NER   T     ++I+           I   KV  K     N        L +F+++  +YK    +S  +L+          + ++P+R+ +L        R+  EI +    L D      +P  ++  + IF   ++   L +EI+ Q+ KQ+ GN    S N  W  L +        +     LL H+ + ++N   E   LA  +L+  +I   +G RK+ P   E + +   S ++   ++ PN   + F +  N  V +    +C+  N+ SKL++T +        K G    + N     ++++D +  L   +++ +P    +  + F+R  WI
Sbjct: 1259 PWRLNFRKEIFTPWHDSSTDSVSTELIYCQVIRGLCFGEYRCDK--VSLKRNAVSVLSRGTFTPPEKHPALQVKEAF---VEYSRLQWPLLFSKFFEASKFTGPSISRNHFIVAINWKEINFLDEK----EKRLL---QLSFPELIGIPEKTFGQ-----CCILNTLRGEEFVLTSQHSDEIAHLLLYFLDELKA-RSHYAVALDNPYCSPFTDEPDLLSFRSGDVLLLDRSPELQLRANWIFAKNERTGKTGAVSLSSIHIIPTLSTPSSEILVRKVALKQCHSSNSEEVKPYTLEEFSLHHFRYKHWGSLSRAVLQRSRGKTHLWAYSREPLRQPLL--------RKVCEISD----LRDYACTTHSP--VELTDQIFSGPIKEEALRDEIYCQILKQMTGNSKSYSVNSGWQLLWLCTGLFPPTK----LLLVHVKKFIENRQKEP--LAKASLR--RILRVYGARKQPPHLVEVEAIQQMSTKIYHKVYFPNGKEETFEVGTNTKVRE----LCQ--NISSKLQLTSWEGFSL-FLKIGDKVISQNE---QDYFYDSLRQLNDFIRKTRPTAGGSFQLYFMRKLWI 1798          
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Match: MYO7B (unconventional myosin-VIIb [Source:NCBI gene;Acc:100491953])

HSP 1 Score: 536.954 bits (1382), Expect = 1.177e-155
Identity = 293/778 (37.66%), Postives = 461/778 (59.25%), Query Frame = 3
Query:  144 QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNIC-GSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASIS-PLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-----MQIARKR 2444
             G+++M  L EL++  ++ N+ IRY +  IYTY GSIL+++NPY EL +YD + +  Y+N+ I ++PPH+F +G+T +  M R N +Q  VISGESGAGKTES K +L++ A  SG    ++Q           +IL++ P++E+FGNA+TIRNDNSSRFGKY+EI F N ++  G+RI  +LLEKSR+   +P ER YHIFY +LLG+ S  K Q   +   DY YL          R+D     +  +    L L+  +     ++L+A+LHLGN+KF        E   + E+ ++  V+ +L+VD   L +CL+  T   V+  S+S PL+  Q+ + RD   K +Y  LF WIV K+N  +   +               + +  RS+ +LDI+GFE+F  NS EQLCIN+ANE LQQFF R++F+LEQEEY  E I W +I + DNQ  +D+++ +P  II ++++E   PQG+D + L K +NVH K + Y   K  H  +F I+H+AG + Y   GFL+KNRD+L  +I+ +I       +  +F+ ++  ++             G F+ SL  L+  +++CQP+FIRC+KPN  K+   F++++ + Q++Y+G++ET++IRK+G+PI+  FS F  R+ +L+  +      ++ +  C+ +     G K++ +++GKTKLFLK++    LE +       SA+ IQ+  R Y   +  + Q +AA KIQS  + +  R+  +K+  G  +LQA +R     MQ  +KR
Sbjct:   65 HGVEDMIRLGELNEAGIVHNIHIRYKENNIYTYTGSILVAVNPYQELPLYDTEQLEMYRNRRIGELPPHIFALGDTCFFNMQRTNTDQCCVISGESGAGKTESTKLMLQFLASASGQHSWIEQ-----------QILEANPIMEAFGNAKTIRNDNSSRFGKYIEIHFSNKHVIEGARIEQFLLEKSRVCRQSPGERNYHIFYCMLLGMGSEQKKQLNLESPSDYKYLTMGNCTNCDGRDDHKAFSQIRTAMKILLLSEIEQQEIFKMLAAILHLGNLKFKAAMCGNLECCDVPESIHLSTVATLLEVDSAQLTNCLSNHTI-IVRGESVSKPLSCTQASDSRDAFVKGIYGRLFMWIVNKINKAIFTPD---------------SENGRRSVGLLDIFGFEHFDTNSFEQLCINFANEHLQQFFVRHIFKLEQEEYNAEQIPWEHIDFSDNQRTLDVIALRPLNIISLIDEESKFPQGTDATMLVKLNNVHSKTNVYIASKSVHDTKFGINHYAGIVYYETEGFLDKNRDLLSTDIMLMIHTSSNYFLKQVFQMEKITKSS------------GSFKQSLEQLMKILESCQPYFIRCIKPNEFKKPKMFDRELCIRQLQYSGMMETIRIRKAGYPIRYSFSEFFQRYRVLLPIQSPYRKKENFREGCIDIAKSVIG-KHEDWKVGKTKLFLKDNHDTKLEVERDKAITASAIRIQKVVRGYKDRKRFLRQREAAIKIQSAWKSYYCRKTFQKMLHGFQRLQAIIRSRPVQMQYKKKR 802          

HSP 2 Score: 63.929 bits (154), Expect = 4.413e-9
Identity = 124/593 (20.91%), Postives = 243/593 (40.98%), Query Frame = 3
Query: 5316 PWVFMLKREIYLPNEIQNT-TIMNPMIFCQIVRDLI--EFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVID-----ETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINL--------TSNLDIKKRTRG--LLKEAVPFTDSGTMMLGVNNERIQFTSHSITNNIY-----KNTDKPINTDKVYDKVKKQGN--------LIDFTVNFSKYKDRQHVSNVILR----------WQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPL---LKQKKP----NLFIKFLRLTWI 6947
            PW    ++EI+ P    +T ++   +I+CQ++R L   E+ C +   + KR  +SV+ +R T    +      +  L+V +       L+  L FS+F+E        +   +  ++I+   + F+ +     E  LL    + +  +  +  K  ++    Q   + T   ++F + + H +    L++ F +  K  +SH  + L        T   D+     G  LL +  P        +   NER   T     ++I+           I   KV  K     N        L +F+++  +YK    +S  +L+          + ++P+R+ +L        R+  EI +    L D      +P  ++  + IF   ++   L +EI+ Q+ KQ+ GN    S N  W  L +        +     LL H+ + ++N   E   LA  +L+  +I   +G RK+ P   E + +   S ++   ++ PN   + F +  N  V +    +C+  N+ SKL++T +        K G    + N     ++++D +  L   +++ +P    +  + F+R  WI
Sbjct: 1251 PWRLNFRKEIFTPWHDSSTDSVSTELIYCQVIRGLCFGEYRCDK--VSLKRNAVSVL-SRGTFTPPAQYVKEKHPALQVKEAFVEYSRLQWPLLFSKFFEASKFTGPSISRNHFIVAINWKEINFLDEK----EKRLL---QLSFPELIGIRTKRAEK-TFGQCCILNTLRGEEFVLTSQHSDEIAHLLLYFLDELKA-RSHYAVALDNPYCSPFTDEPDLLSFRSGDVLLLDRSPELQLRANWIFAKNERTGKTGAVSLSSIHIIPTLSTPSSEILVRKVALKQCHSSNSEEVKPYTLEEFSLHHFRYKHWGSLSRAVLQRSRGKTHLWAYSREPLRQPLL--------RKVCEISD----LRDYACTTHSP--VELTDQIFSGPIKEEALRDEIYCQILKQMTGNSKSYSVNSGWQLLWLCTGLFPPTK----LLLVHVKKFIENRQKEP--LAKASLR--RILRVYGARKQPPHLVEVEAIQQMSTKIYHKVYFPNGKEETFEVGTNTKVRE----LCQ--NISSKLQLTSWEGFSL-FLKIGDKVISQNE---QDYFYDSLRQLNDFIRKTRPTAGGSFQLYFMRKLWI 1799          
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Match: MYO7B (unconventional myosin-VIIb [Source:NCBI gene;Acc:100491953])

HSP 1 Score: 536.954 bits (1382), Expect = 1.388e-155
Identity = 293/778 (37.66%), Postives = 461/778 (59.25%), Query Frame = 3
Query:  144 QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNIC-GSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASIS-PLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-----MQIARKR 2444
             G+++M  L EL++  ++ N+ IRY +  IYTY GSIL+++NPY EL +YD + +  Y+N+ I ++PPH+F +G+T +  M R N +Q  VISGESGAGKTES K +L++ A  SG    ++Q           +IL++ P++E+FGNA+TIRNDNSSRFGKY+EI F N ++  G+RI  +LLEKSR+   +P ER YHIFY +LLG+ S  K Q   +   DY YL          R+D     +  +    L L+  +     ++L+A+LHLGN+KF        E   + E+ ++  V+ +L+VD   L +CL+  T   V+  S+S PL+  Q+ + RD   K +Y  LF WIV K+N  +   +               + +  RS+ +LDI+GFE+F  NS EQLCIN+ANE LQQFF R++F+LEQEEY  E I W +I + DNQ  +D+++ +P  II ++++E   PQG+D + L K +NVH K + Y   K  H  +F I+H+AG + Y   GFL+KNRD+L  +I+ +I       +  +F+ ++  ++             G F+ SL  L+  +++CQP+FIRC+KPN  K+   F++++ + Q++Y+G++ET++IRK+G+PI+  FS F  R+ +L+  +      ++ +  C+ +     G K++ +++GKTKLFLK++    LE +       SA+ IQ+  R Y   +  + Q +AA KIQS  + +  R+  +K+  G  +LQA +R     MQ  +KR
Sbjct:   65 HGVEDMIRLGELNEAGIVHNIHIRYKENNIYTYTGSILVAVNPYQELPLYDTEQLEMYRNRRIGELPPHIFALGDTCFFNMQRTNTDQCCVISGESGAGKTESTKLMLQFLASASGQHSWIEQ-----------QILEANPIMEAFGNAKTIRNDNSSRFGKYIEIHFSNKHVIEGARIEQFLLEKSRVCRQSPGERNYHIFYCMLLGMGSEQKKQLNLESPSDYKYLTMGNCTNCDGRDDHKAFSQIRTAMKILLLSEIEQQEIFKMLAAILHLGNLKFKAAMCGNLECCDVPESIHLSTVATLLEVDSAQLTNCLSNHTI-IVRGESVSKPLSCTQASDSRDAFVKGIYGRLFMWIVNKINKAIFTPD---------------SENGRRSVGLLDIFGFEHFDTNSFEQLCINFANEHLQQFFVRHIFKLEQEEYNAEQIPWEHIDFSDNQRTLDVIALRPLNIISLIDEESKFPQGTDATMLVKLNNVHSKTNVYIASKSVHDTKFGINHYAGIVYYETEGFLDKNRDLLSTDIMLMIHTSSNYFLKQVFQMEKITKSS------------GSFKQSLEQLMKILESCQPYFIRCIKPNEFKKPKMFDRELCIRQLQYSGMMETIRIRKAGYPIRYSFSEFFQRYRVLLPIQSPYRKKENFREGCIDIAKSVIG-KHEDWKVGKTKLFLKDNHDTKLEVERDKAITASAIRIQKVVRGYKDRKRFLRQREAAIKIQSAWKSYYCRKTFQKMLHGFQRLQAIIRSRPVQMQYKKKR 802          

HSP 2 Score: 56.9954 bits (136), Expect = 5.980e-7
Identity = 65/295 (22.03%), Postives = 130/295 (44.07%), Query Frame = 3
Query: 6117 LIDFTVNFSKYKDRQHVSNVILR----------WQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ-FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPL---LKQKKP----NLFIKFLRLTWI 6947
            L +F+++  +YK    +S  +L+          + ++P+R+ +L        R+  EI +    L D      +P  ++  + IF   ++   L +EI+ Q+ KQ+ GN    S N  W  L +        +     LL H+ + ++N   E   LA  +L+  +I   +G RK+ P   E + +   S ++   ++ PN   + F +  N  V +    +C+  N+ SKL++T +        K G    + N     ++++D +  L   +++ +P    +  + F+R  WI
Sbjct: 1563 LEEFSLHHFRYKHWGSLSRAVLQRSRGKTHLWAYSREPLRQPLL--------RKVCEISD----LRDYACTTHSP--VELTDQIFSGPIKEEALRDEIYCQILKQMTGNSKSYSVNSGWQLLWLCTGLFPPTK----LLLVHVKKFIENRQKEP--LAKASLR--RILRVYGARKQPPHLVEVEAIQQMSTKIYHKVYFPNGKEETFEVGTNTKVRE----LCQ--NISSKLQLTSWEGFSL-FLKIGDKVISQNE---QDYFYDSLRQLNDFIRKTRPTAGGSFQLYFMRKLWI 1825          

HSP 3 Score: 19.631 bits (39), Expect = 5.980e-7
Identity = 9/25 (36.00%), Postives = 15/25 (60.00%), Query Frame = 2
Query: 6983 CQFSFYSIVKKYSRRGLVGSIEESV 7057
            C F ++  V KY R   + S+E++V
Sbjct: 1837 CIFHYHQEVPKYMRGYNLCSVEDAV 1861          
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Match: MYO7A (myosin 7a [Source:NCBI gene;Acc:100491335])

HSP 1 Score: 532.332 bits (1370), Expect = 2.768e-153
Identity = 297/793 (37.45%), Postives = 466/793 (58.76%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRS----AVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIY 2486
            S  G+++M  L +L++  +L NL IRY + LIYTY GSIL+++NPY  L IY    I  Y N+ I +MPPH+F I +  Y  M R+N++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+    P ER YHIFY +L G+    K +       DY+YL   K  T   R+D+       S    L  T +E+ +++ R+L+A+LH+GN+++     +  +   +V + ++   + +L+V    L +CLT +T  T  +   +PL+ EQ+++ RD   K +Y  LF WIV K+N        I R  S   ++        RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQEEY  E I+W +I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK +  H  N  Y  PK  +  QF I+HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++++ + Q++Y+G++ET++IR++G+PI+  F  F+ R+ +L+          D +  C ++     G K+  +++GKTK+FLK+    H +  ++I R+++     ++IQ+  R +      +   +AA  IQ   RG   RR    + IG ++LQA  R   +RK   + H    ++S +
Sbjct:   63 SIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTPDQIRLYTNRKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKKGAIEGAKIEQYLLEKSRVCRQVPDERNYHIFYCMLKGMSPEQKKKLSLGQASDYNYLCMGKCTTCDGRDDSKEYANIRSAMKVLMFTDTENWEIS-RLLAAILHMGNLRYEARMYDNLDACEVVYSTSLTTAATLLEVGPQELMNCLTSRTIITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINAA------IYRPLSNEPKAAR------RSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNVQHKLNTFYIPPKNNYETQFGINHFAGIVYYETKGFLEKNRDTLHGDIIQLVHSAKNKFIKQIFQADVAMGAE---TRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQGDLRGTCERIAESVLG-KDDDWQIGKTKIFLKD----HHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKIRKAALLIQRCWRGHNCRRNYTAMRIGFLRLQALYR---SRKLHTQYHVARMRISYF 820          
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Match: Myo15 (myosin XV [Source:MGI Symbol;Acc:MGI:1261811])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 404/1148 (35.19%), Postives = 618/1148 (53.83%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEG-KFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L +L + ++L+NL+ R+ + LIYTYIGSIL+S+NPY    IY  + +  Y  + + + PPHLF I    + KM+   +NQ ++ISGESG+GKTE+ K +L+  A ++               D+  +IL++TPLLE+FGNA+T+RNDNSSRFGK+VEIF + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG TSED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L+V  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF W++T+VN                  +L+S   +  SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E + W  IA+ DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++  +     +A +F      QT  P        T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D++M Q++Y+G+LETV+IRK GFP+++ F VF+ R+  LV  ++   +  D    C+ L+ +   V    + +G +KLFLKE   + LE   + ++NR+A+ +QR  R ++  R      +    +QS  RGF+ R+R +++   ++K ++ V   + R+R+L+   E +K  +                    PV                        L++P E+A LL    G K S           +   RA  L       LP DI+ + +  F+        F   + PL +P     V  +H  ++++  KLILR M    +    + +  +Y+       P L+ EIL Q+  +   + +    Y S        R W LL   LS   PSP +  ++LKFVSD         CQ +LLQ   SG     R FP T LE  A ++ +   L+V   +    S  +++++ GE +A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct:   39 EDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQ------------RRDVMQQILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVN------------------ALVSPKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLF-SSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDM---CVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLK---ELSKREV-------------------VPVRH----------------------LEVPAEVAGLLQAAAGLKLSSGPR-------VAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPV--EHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPN---AYNSK-------RGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSG---AARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 1084          

HSP 2 Score: 54.299 bits (129), Expect = 3.404e-6
Identity = 35/157 (22.29%), Postives = 67/157 (42.68%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQ 5765
            +Y YQ +PW   L++E++ P +  +  +   ++F QI+ D     C+R   +E+ ++ ++       D    L   +     +       E+YFSR +         VG     +++SH+G++ +Q    S E    +     YS  D +    P Q
Sbjct: 1476 FYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQN-QLDTQRPLVTESVKRAAISMARDSWEIYFSRLFP----AMGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQ 1627          
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Match: Myo15 (myosin XV [Source:MGI Symbol;Acc:MGI:1261811])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 405/1148 (35.28%), Postives = 618/1148 (53.83%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEG-KFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L +L + ++L+NL+ R+ + LIYTYIGSIL+S+NPY    IY  + +  Y  + + + PPHLF I    + KM+   +NQ ++ISGESG+GKTE+ K +L+  A        + Q  D +      +IL++TPLLE+FGNA+T+RNDNSSRFGK+VEIF + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG TSED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L+V  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF W++T+VN                  +L+S   +  SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E + W  IA+ DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++  +     +A +F      QT  P        T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D++M Q++Y+G+LETV+IRK GFP+++ F VF+ R+  LV  ++   +  D    C+ L+ +   V    + +G +KLFLKE   + LE   + ++NR+A+ +QR  R ++  R      +    +QS  RGF+ R+R +++   ++K ++ V   + R+R+L+   E +K  +                    PV                        L++P E+A LL    G K S           +   RA  L       LP DI+ + +  F+        F   + PL +P     V  +H  ++++  KLILR M    +    + +  +Y+       P L+ EIL Q+  +   + +    Y S        R W LL   LS   PSP +  ++LKFVSD         CQ +LLQ   SG     R FP T LE  A ++ +   L+V   +    S  +++++ GE +A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct:   18 EDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLA-------AMNQRRDVMQQ---IKILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVN------------------ALVSPKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLF-SSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDM---CVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLK---ELSKREV-------------------VPVRH----------------------LEVPAEVAGLLQAAAGLKLSSGPR-------VAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPV--EHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPN---AYNSK-------RGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSG---AARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 1065          

HSP 2 Score: 60.8474 bits (146), Expect = 3.581e-8
Identity = 63/319 (19.75%), Postives = 134/319 (42.01%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLL-LLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQI--NGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDW-LVPSKNQSVDSNELSVISKIAYYNMRGQ 7118
            +L + + P++E++++ S++ + + A+++   ++  + D    GQ+   +     + K+   +  + +E + Q+ KQI  N +P   S    W  L I+  +   ++   P+L+  L  +        Q +A    +N +   +FG R E P + E   ++ G         +P        I       DVI+ +C  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+    L   +  VP++  +    +L  +SK+A    R +
Sbjct: 1823 VLCFTKVPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQSE--LDVLCTLLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSEVFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEY--VIFVVTNRGQHVCP----LSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENEL--YVTMHYNQVLPDYLKGLFSSVPARQPT--EQQLQQVSKLASLQHRAK 2129          

HSP 3 Score: 55.8398 bits (133), Expect = 1.056e-6
Identity = 35/157 (22.29%), Postives = 67/157 (42.68%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQ 5765
            +Y YQ +PW   L++E++ P +  +  +   ++F QI+ D     C+R   +E+ ++ ++       D    L   +     +       E+YFSR +         VG     +++SH+G++ +Q    S E    +     YS  D +    P Q
Sbjct: 1457 FYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQN-QLDTQRPLVTESVKRAAISMARDSWEIYFSRLFP----AMGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQ 1608          
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Match: Myo15 (myosin XV [Source:MGI Symbol;Acc:MGI:1261811])

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 405/1148 (35.28%), Postives = 618/1148 (53.83%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEG-KFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L +L + ++L+NL+ R+ + LIYTYIGSIL+S+NPY    IY  + +  Y  + + + PPHLF I    + KM+   +NQ ++ISGESG+GKTE+ K +L+  A        + Q  D +      +IL++TPLLE+FGNA+T+RNDNSSRFGK+VEIF + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG TSED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L+V  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF W++T+VN                  +L+S   +  SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E + W  IA+ DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++  +     +A +F      QT  P        T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D++M Q++Y+G+LETV+IRK GFP+++ F VF+ R+  LV  ++   +  D    C+ L+ +   V    + +G +KLFLKE   + LE   + ++NR+A+ +QR  R ++  R      +    +QS  RGF+ R+R +++   ++K ++ V   + R+R+L+   E +K  +                    PV                        L++P E+A LL    G K S           +   RA  L       LP DI+ + +  F+        F   + PL +P     V  +H  ++++  KLILR M    +    + +  +Y+       P L+ EIL Q+  +   + +    Y S        R W LL   LS   PSP +  ++LKFVSD         CQ +LLQ   SG     R FP T LE  A ++ +   L+V   +    S  +++++ GE +A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1205 EDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLA-------AMNQRRDVMQQ---IKILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVN------------------ALVSPKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLF-SSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDM---CVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLK---ELSKREV-------------------VPVRH----------------------LEVPAEVAGLLQAAAGLKLS-------SGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPV--EHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPN---AYNSK-------RGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSG---AARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2252          

HSP 2 Score: 54.299 bits (129), Expect = 3.513e-6
Identity = 63/319 (19.75%), Postives = 134/319 (42.01%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLL-LLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQI--NGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDW-LVPSKNQSVDSNELSVISKIAYYNMRGQ 7118
            +L + + P++E++++ S++ + + A+++   ++  + D    GQ+   +     + K+   +  + +E + Q+ KQI  N +P   S    W  L I+  +   ++   P+L+  L  +        Q +A    +N +   +FG R E P + E   ++ G         +P        I       DVI+ +C  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+    L   +  VP++  +    +L  +SK+A    R +
Sbjct: 3010 VLCFTKVPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQSELDVLCT--LLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSEVFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEY--VIFVVTNRGQHVCP----LSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENEL--YVTMHYNQVLPDYLKGLFSSVPARQPT--EQQLQQVSKLASLQHRAK 3316          

HSP 3 Score: 53.9138 bits (128), Expect = 4.189e-6
Identity = 35/157 (22.29%), Postives = 67/157 (42.68%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQ 5765
            +Y YQ +PW   L++E++ P +  +  +   ++F QI+ D     C+R   +E+ ++ ++       D    L   +     +       E+YFSR +         VG     +++SH+G++ +Q    S E    +     YS  D +    P Q
Sbjct: 2644 FYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQN-QLDTQRPLVTESVKRAAISMARDSWEIYFSRLFP----AMGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQ 2795          
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Match: Myo15 (myosin XV [Source:MGI Symbol;Acc:MGI:1261811])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 407/1148 (35.45%), Postives = 624/1148 (54.36%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEG-KFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L +L + ++L+NL+ R+ + LIYTYIGSIL+S+NPY    IY  + +  Y  + + + PPHLF I    + KM+   +NQ ++ISGESG+GKTE+ K +L+  A        + Q  D +      +IL++TPLLE+FGNA+T+RNDNSSRFGK+VEIF + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG TSED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L+V  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF W++T+VN                  +L+S   +  SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E + W  IA+ DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++  +     +A +F      QT  P        T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D++M Q++Y+G+LETV+IRK GFP+++ F VF+ R+  LV  ++   +  D    C+ L+ +   V    + +G +KLFLKE   + LE   + ++NR+A+ +QR  R ++  R      +    +QS  RGF+ R+R +++   ++K ++ V   + R+R+L+   E  + +   +    + ++ SK  V   PV                        L++P E+A LL    G K S           +   RA  L       LP DI+ + +  F+        F   + PL +P     V  +H  ++++  KLILR M    +    + +  +Y+       P L+ EIL Q+  +   + +    Y S        R W LL   LS   PSP +  ++LKFVSD         CQ +LLQ   SG     R FP T LE  A ++ +   L+V   +    S  +++++ GE +A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1205 EDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLA-------AMNQRRDVMQQ---IKILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVN------------------ALVSPKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLF-SSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDM---CVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLKLRAEQRRRA--QEAWLREQEELSKREV--VPVRH----------------------LEVPAEVAGLLQAAAGLKLS-------SGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPV--EHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPN---AYNSK-------RGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSG---AARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2270          

HSP 2 Score: 54.299 bits (129), Expect = 3.514e-6
Identity = 63/319 (19.75%), Postives = 134/319 (42.01%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLL-LLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQI--NGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDW-LVPSKNQSVDSNELSVISKIAYYNMRGQ 7118
            +L + + P++E++++ S++ + + A+++   ++  + D    GQ+   +     + K+   +  + +E + Q+ KQI  N +P   S    W  L I+  +   ++   P+L+  L  +        Q +A    +N +   +FG R E P + E   ++ G         +P        I       DVI+ +C  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+    L   +  VP++  +    +L  +SK+A    R +
Sbjct: 3028 VLCFTKVPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQSELDVLCT--LLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSEVFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEY--VIFVVTNRGQHVCP----LSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENEL--YVTMHYNQVLPDYLKGLFSSVPARQPT--EQQLQQVSKLASLQHRAK 3334          

HSP 3 Score: 53.9138 bits (128), Expect = 4.191e-6
Identity = 35/157 (22.29%), Postives = 67/157 (42.68%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQ 5765
            +Y YQ +PW   L++E++ P +  +  +   ++F QI+ D     C+R   +E+ ++ ++       D    L   +     +       E+YFSR +         VG     +++SH+G++ +Q    S E    +     YS  D +    P Q
Sbjct: 2662 FYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQN-QLDTQRPLVTESVKRAAISMARDSWEIYFSRLFP----AMGSVGTGVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQ 2813          
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Match: Myo10 (myosin X [Source:MGI Symbol;Acc:MGI:107716])

HSP 1 Score: 507.679 bits (1306), Expect = 1.196e-156
Identity = 275/777 (35.39%), Postives = 453/777 (58.30%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTEL-GIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEI-FFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFR---KKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFL 2450
            L ++G+D+M +L EL   S++ NL  RY +  IYTYIGSI+ S+NPY  + G+Y++  +  Y    + ++PPH+F I    Y  + + ++NQ ++ISGESGAGKTES K +LK+ + +S   + +     + +S +   IL S+P++E+FGNA+T+ N+NSSRFGK+V++     GNI G RI +YLLEK+R+V  NP ER YHIFY +L GLD   + ++Y    ++Y YLN S     K  +D  + ++ ++  + +  + E++   +R+L+ +LHLGNI+F+         +T  +G  + +L +D   L   LT ++     +  ++PL+ +Q+++ RD+L+  LY+  F W++ K+N                  S +    +F+SI +LDI+GFENF  N  EQ  INYANE LQ++FN+++F LEQ EY +EG+ W  I + DN   +DL+  K  G++ ++N+E   PQ +D + L K H+ H  N  Y KP +     F + H+AG + Y V G LEKNRD  R ++LN++       I  +F     +    T    +K R P V   F+ SL +L+A + +  P+F+RC+KPNT K   +F++ +V++Q++Y+G+LETV+IRK+G+ ++  F  F  R+ +L    +R  +L D       ++++     N  ++LGKTK+FL+E   + LEK+ +   +R+A++I    RA+                   + G++ R++ RK+  G+V +Q   R  +ARK+FL
Sbjct:   27 LHEEGVDDMASLAELHGGSIMYNLFQRYKRNQIYTYIGSIIASVNPYQPIAGLYERATMEEYSRCHLGELPPHIFAIANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSVISQ--QTLDLGLQEKTSSVEQAILQSSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQQGNIQGGRIVDYLLEKNRVVRQNPGERNYHIFYALLAGLDQGEREEFYLSLPENYHYLNQSGCTEDKTISDQESFRQVITAMEVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQIPFKTA-LGRSADLLGLDPTQLTDALTQRSMILRGEEILTPLSVQQAVDSRDSLAMALYARCFEWVIKKIN------------------SRIKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWIDNGECLDLIEKKL-GLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKP-RVAVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNTQKMPDQFDQVVVLNQLRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVL----MRNLALPDDIRGKCTVLLQVYDASNSEWQLGKTKVFLRESLEQKLEKRREEEIDRAAMVI----RAH-------------------ILGYLARKQYRKVLCGVVTIQKNYRAFLARKKFL 753          
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Match: sp|Q9QZZ4|MYO15_MOUSE (Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 407/1148 (35.45%), Postives = 624/1148 (54.36%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNP--------TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEG-KFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
            + G+++MT L +L + ++L+NL+ R+ + LIYTYIGSIL+S+NPY    IY  + +  Y  + + + PPHLF I    + KM+   +NQ ++ISGESG+GKTE+ K +L+  A        + Q  D +      +IL++TPLLE+FGNA+T+RNDNSSRFGK+VEIF + G ICG+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG TSED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L+V  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF W++T+VN                  +L+S   +  SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E + W  IA+ DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++  +     +A +F      QT  P        T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D++M Q++Y+G+LETV+IRK GFP+++ F VF+ R+  LV  ++   +  D    C+ L+ +   V    + +G +KLFLKE   + LE   + ++NR+A+ +QR  R ++  R      +    +QS  RGF+ R+R +++   ++K ++ V   + R+R+L+   E  + +   +    + ++ SK  V   PV                        L++P E+A LL    G K S           +   RA  L       LP DI+ + +  F+        F   + PL +P     V  +H  ++++  KLILR M    +    + +  +Y+       P L+ EIL Q+  +   + +    Y S        R W LL   LS   PSP +  ++LKFVSD         CQ +LLQ   SG     R FP T LE  A ++ +   L+V   +    S  +++++ GE +A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1205 EDGVEDMTQLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLA-------AMNQRRDVMQQ---IKILEATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVN------------------ALVSPKQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLF-SSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDM---CVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFRSLVHTYVNRRRYLKLRAEQRRRA--QEAWLREQEELSKREV--VPVRH----------------------LEVPAEVAGLLQAAAGLKLS-------SGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPV--EHHAEAISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPN---AYNSK-------RGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSG---AARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2270          
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Match: sp|Q9UKN7|MYO15_HUMAN (Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 409/1155 (35.41%), Postives = 621/1155 (53.77%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFR-------KKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTG--RAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKS---PELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQ---IPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALEL 3545
             + G+++MT L +L + ++LSNL+IR+ + LIYTYIGSIL+S+NPY   GIY  + +  Y  + + + PPHLF +    + KM+   +NQ I+ISGESG+GKTE+ K +L+Y A ++   +EV Q           +IL++TPLLESFGNA+T+RNDNSSRFGK+VEIF + G I G+  + YLLEKSRIV     ER YHIFYE+L GL +  +  +  +  + Y YLN      I  ++DA + +  ++  + LG +SED D   RIL+++LHLGN+ F     + QE + +V    I  V+++L++  + L+  +T K TET+++   +PL  E +++ RD ++K LY+ LF+W++T+VN       L+  RQ  +            SIA+LDIYGFE+   NS EQLCINYANE LQ  FN+ VF+ EQEEY +E I W  I + DNQP I+L+S KP GI++IL+D+C  PQ +D +FL KCH  HG N  Y KPK    P+F I H+AG ++Y V  FL+KN D +R+++L++        +A +F         +R  ++ + T   +   V   FQ SL  L+ KM+ C P F+RCLKPN  KE   F  D+VM Q++Y+G+LETV+IRK GFP+++ F  F+ R+  LV     K  L      C+ ++ +   V    + +G +KLFLKE   + LE   + + N +A+ +QR  R ++  R           +QS  RG++ R+R +++   +VK ++ V   ++R+R+L+   E+            + Q    L   +  +S+        ++   +G+      L++P ELA LL    G            QV Q    R   L       LP DI+ + +  F+        F   + PL  P     +  +H  ++++  KLILR M     P  H    N +  ++  K    PEL+ EIL Q+  +             +H      R W LL   LS   PSP    Y+LKFVSD         CQ +L+Q       Q     R  P T LE  A  + +   L+V   +    S  ++S++ GE++A   L  R       +GW+V++    +  + +G +YVLD++S LEL
Sbjct: 1220 GEDGVEDMTQLEDLQETTVLSNLKIRFERNLIYTYIGSILVSVNPYQMFGIYGPEQVQQYNGRALGENPPHLFAVANLAFAKMLDAKQNQCIIISGESGSGKTEATKLILRYLAAMNQK-REVMQQ---------IKILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEGGVISGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREIQAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSWLITRVNA------LVSPRQDTL------------SIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQIDWQEITFADNQPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPL-PEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFVRSRTRVVAHLFSSHAPQAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFMRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQGFIDRYCCLVAL---KHDLPANGDMCVSVLSRLCKVMPNMYRVGVSKLFLKEHLYQLLESMREHVLNLAALTLQRCLRGFFIKRRFRSLRHKIILLQSRARGYLARQRYQQMRRSLVKFRSLVHAYVSRRRYLKLRAEW------------RCQVEGALLWEQEELSK--------REVVAVGH------LEVPAELAGLLQAVAGL--------GLAQVPQVAPVRTPRLQAEPRVTLPLDINNYPMAKFVQCHFKEPAFGMLTVPLRTPL--TQLPAEHHAEAVSIFKLILRFM---GDPHLHGARENIFGNYIVQKGLAVPELRDEILAQLANQVW----------HNHNAHNAERGWLLLAACLSGFAPSPCFNKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTLPPTQLEWTATYEKASMALDVGCFNGDQFSCPVHSWSTGEEVAGDILRHR-GLADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLEL 2292          

HSP 2 Score: 56.225 bits (134), Expect = 6.267e-6
Identity = 61/281 (21.71%), Postives = 118/281 (41.99%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIH-NFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVK--SRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQL 7007
            +L + + P++E++++ S++ + + A ++    +  + D    GQ+ D     NL+ K+   +  + +E + QV KQI  N S K  S    W  L I+  +   ++ + P L   L  + +      Q +A    +N +   +FG R ELP   E   ++ G         +P        I       DV++ IC  + +       EY  ++F +T  G         L    Y  +++  ++Q      + F R+ W  PL  +     +V+ H+ Q+
Sbjct: 3047 MLCFTKTPLQESLIELSDSSLSKMATDMFLAVMRFMGDAPLKGQS-DLDVLCNLL-KLCGDHEVMRDECYCQVVKQITDNTSSKQDSCQRGWRLLYIVTAYHSCSEVLHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMALTRPEAFNEY--VIFVVTNRGQHVCP----LSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLKFENEL--YVTMHYNQV 3317          

HSP 3 Score: 55.4546 bits (132), Expect = 9.217e-6
Identity = 41/184 (22.28%), Postives = 89/184 (48.37%), Query Frame = 3
Query: 5133 PRTNLNNAKTEIV-PVPLPRNLSHNGKSGIPI-TLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLK--CELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQ 5672
            P T ++     +V PV      S    S +P  +L+P + ++ T+   L  L +  +Y YQ  PW   L++E++ P +  +  +   ++F QI+ D +   C+R   +E+ ++ ++        +++   + T ++ + +  T +   E+YFSR +      T  VG     +++SH G++ ++
Sbjct: 2628 PGTQVSREAVALVKPVTSAPRPSMAPTSALPSRSLEPPEELTQTR---LHRLINPNFYGYQDAPWKIFLRKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRISEDERLRMKALFAQ---NQLDTQKPLVTESVKRAVVSTARDTWEVYFSRIFP----ATGSVGTGVQLLAVSHVGIKLLR 2801          
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Match: sp|Q622K8|HUM6_CAEBR (Unconventional myosin heavy chain 6 OS=Caenorhabditis briggsae OX=6238 GN=hum-6 PE=3 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 2.711e-160
Identity = 303/767 (39.50%), Postives = 472/767 (61.54%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFF-DNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S QG+++M  L +  + ++L NL IRY +KLIY Y GSILI++NPY ++ IY    I  Y+ K I ++PPH+F I +  YT M R+ +NQ ++ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY+++ F ++G+I G++I  YLLEKSRIV  +  ER YHIFY +L GL    K +       DY YL   K  T + R+DAA+L E  S    L +  +++    ++L+A+LH+GNI+F     +  E+  + +   +  ++K+L + + +L   +T K+  T ++  IS LN +Q+I+ RD L+K +Y +LF  IV +VN  + + +  +R                 SI +LDI+GFENF  NS EQLCIN+ANETLQQFF ++VF++EQ+EY +E I+W +I + DNQ  +DL++ +P  I+ ++++E   P+G+D + L K H+ HG+N+ Y +PK      F + HFAG++ Y+  GFLEKNRD    ++  +I + ++  +A +F    +L+    + K  T  V   F+ SL  L+ ++    P+FIRC+KPN  K AL  ++D+V+ Q++Y+G++ET+KIR+SG+PI+  +  F+ R+ +LV+     A+  D   A  K+  K  G  N  ++LGKTK+FLK+     LE++   I    AVIIQ+  R +   +    Q QAA  IQ+  RG+  R+R R++  G  +LQA +R
Sbjct:   60 SVQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLATISGQHSWIEQ-----------QVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSKEEKMELELGTAADYYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLAALLHIGNIRFRQNTTDNMESVDVADPSTLVRIAKLLNLHEQNLLDAITTKSLVTREERVISRLNGQQAIDARDALAKAIYGKLFIHIVRRVNDAIYKPSQSIRT----------------SIGILDIFGFENFESNSFEQLCINFANETLQQFFVQHVFKMEQKEYDEENINWRHIKFVDNQATVDLIAQRPMNILSLIDEESIFPKGTDKTMLLKLHSTHGRNELYLQPKSELQRAFGVTHFAGSVFYNTRGFLEKNRDSFSGDLSALISSSKMPFLARLF---DDLEYDTSSRKKVT--VGNQFRRSLEQLMTQLTQTHPFFIRCIKPNELKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIRGPANRIDLHDAAKKICHKVLG-PNADYQLGKTKVFLKDKHDLVLEQEYYRILKDKAVIIQKNVRRWLVRKDFEKQRQAAVTIQTAWRGYDQRKRYRQIISGFSRLQAVLR 793          
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Match: sp|P91443|HUM6_CAEEL (Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 4.750e-159
Identity = 298/767 (38.85%), Postives = 469/767 (61.15%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFF-DNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEE----QETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR 2423
            S QG+++M  L +  + ++L NL IRY +KLIY Y GSILI++NPY ++ IY    I  Y+ K I ++PPH+F I +  YT M R+ +NQ ++ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY+++ F ++G+I G++I  YLLEKSRIV  +  ER YHIFY +L GL    KS+       DY YL   K  T + R+DAA+L E  S    L +  +++    ++L+++LH+GNI+F +      E+  + +   +  ++K+L++ + +L   +T K+  T ++  IS LN +Q+++ RD L+K +Y +LF  IV +VN  + +                 + S   SI +LDI+GFENF  NS EQLCIN+ANETLQQFF  +VF++EQ+EY +E I+W +I + DNQ  +DL++ +P  I+ ++++E   P+G+D + L K H+ HG+N+ Y +PK      F + HFAGN+ Y+  GFLEKNRD    ++  +I + ++  +A +F        +  T+  +   V   F+ SL  L++++    P+FIRC+KPN  K AL  ++D+V+ Q++Y+G++ET+KIR+SG+PI+  +  F+ R+ +LV+      +  D   A  K+     G  N  ++LGKTK+FLK+     LE++   I    A++IQ+  R +   +    Q QAA  IQ+  RGF  R+R R++  G  +LQA +R
Sbjct:   60 SVQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYKRKRIGELPPHIFAIADNAYTNMRREKKNQSVIISGESGAGKTESTKLVLQFLATISGQHSWIEQ-----------QVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIVTQSENERNYHIFYCLLAGLSREEKSELELGTAADYYYLIQGKTLTAEGRDDAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTNDNMESVDVADPSTLVRIAKLLQLHEQNLLDAITTKSLVTREERVISRLNGQQAVDARDALAKAIYGKLFIHIVRRVNDAIYK----------------PSQSRRTSIGILDIFGFENFESNSFEQLCINFANETLQQFFVHHVFKMEQKEYDEEHINWRHIKFVDNQATVDLIAQRPLNILSLIDEESIFPKGTDKTMLLKLHSTHGRNELYLQPKSELQRAFGVTHFAGNVFYNTRGFLEKNRDSFSADLSVLISSSKMPFLARLFD-----DIEYDTSSRKKVTVGNQFRRSLEQLMSQLTQTHPFFIRCIKPNEMKRALVMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAAKKICHMILGT-NADYQLGKTKVFLKDKHDLVLEQEYYRILKDKAIVIQKNVRRWLVRKDFEKQRQAAVTIQTAWRGFDQRKRYRQIISGFSRLQAVLR 793          
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Match: sp|Q17LW0|MYO7A_AEDAE (Myosin-VIIa OS=Aedes aegypti OX=7159 GN=ck PE=3 SV=1)

HSP 1 Score: 551.206 bits (1419), Expect = 7.417e-159
Identity = 302/785 (38.47%), Postives = 459/785 (58.47%), Query Frame = 3
Query:  129 LHLSD-QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF--LRAH 2459
            +H S  QG+++M +L +L +  +L NL IRY   LIYTY GSIL+++NPY  L IY    I  Y+ + I ++PPH+F IG+ +Y  M R  ++Q IVISGESGAGKTES K +L+Y A +SG    ++Q           +IL++ P+LE+FGNA+T+RNDNSSRFGKY++I F+N G I G+ I  YLLEKSRIV+ N  ER YHIFY +L GL S  K +       DY YL          RNDAA   +  S    L  +  ++   +++L+A+LH GNI +    ++  + + + E  N+  V+ +L+V        LT KT     +  +S L+++QS++ RD   K +Y  LF  IV K+N+ + +                   S   +I +LDI+GFENF  NS EQ CIN+ANE LQQFF R++F+LEQEEY  E I+W +I + DNQ  +DL++ K   I+ ++++E   P+G+D + L K H  HG + NY KPK      F ++HFAG + Y   GFLEKNRD    ++L +I +     +  +F +   +  +    + RTP +   F+ SL +L+  + +CQP+FIRC+KPN  K+ + F++ +   Q++Y+G++ET++IR++G+PI+  F  F+ R+  L++  I  A   D + A  K+     G  +  ++LG TK+FLK+     LE++   +  R  +I+QR  R +   R  +   QAA  IQ   +G+  R+R +K+ IG ++LQA +R ++   RF  LR H
Sbjct:   52 MHASSVQGVEDMISLGDLHEAGILRNLLIRYNDNLIYTYTGSILVAVNPYQILPIYTADQIKLYKERKIGELPPHIFAIGDNSYANMRRYGQDQCIVISGESGAGKTESTKLILQYLAAISGKHSWIEQ-----------QILEANPILEAFGNAKTVRNDNSSRFGKYIDIHFNNSGVIEGAEIEQYLLEKSRIVSQNAEERNYHIFYCLLAGLSSDEKRKLNLGYASDYRYLTGGGCIKCDGRNDAAEFADIRSAMKVLCFSDHEIWEILKLLAALLHTGNITYRATVIDNLDATEIPEHINVERVANLLEVPFQPFIDALTRKTLFAHGETVVSTLSRDQSMDVRDAFVKGIYGRLFVLIVKKINSAIYK----------------PKSSTRSAIGVLDIFGFENFKHNSFEQFCINFANENLQQFFVRHIFKLEQEEYNHESINWQHIEFVDNQDALDLIAIKQLNIMALIDEESKFPKGTDQTMLAKLHKTHGTHRNYLKPKSDINTSFGLNHFAGVVFYDTRGFLEKNRDTFSADLLQLISSSTNRFLQMVFAEDIGMGAE---TRKRTPTLSTQFKKSLDSLMKTLSSCQPFFIRCIKPNELKKPMMFDRALCCRQLRYSGMMETIRIRRAGYPIRHKFKDFVERYRFLISG-IPPAHRTDCRLATSKICASVLGRSD--YQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRFLRMRQAAVTIQKFWKGYAQRQRYKKMKIGYMRLQALIRSRVLSHRFRHLRGH 803          
BLAST of Unconventional myosin-XV vs. TrEMBL
Match: A0A0X3PDF9 (Unconventional myosin-XV (Fragment) OS=Schistocephalus solidus OX=70667 GN=MYO15 PE=3 SV=1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 452/1239 (36.48%), Postives = 686/1239 (55.37%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLS-SDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKN-PTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKA--SLKDQQAACLKLMIKFKGV--------KNKHFELGKTKLFLKEDFARHLEKQVQIIRNR----SAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKT--EGKFSPESSLP-------FQEQVIQTGRAQHLWN--RGE-YKLPNDIDLFVLENFLDDFGNHI-PFESKSR--PLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLP---SKSIRTKYQSDHEEIRLTRA-----------WTLLG----------NLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKL----------------LQFASS---GHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWSEITGQLLEQNFLMSKRSRLNGDPVDIA 3641
            G+DNM NL  LS+ ++L NL++RY +K IYTYIGSIL+S+NPY +L I   + + +Y+N+ +  MPPH++GI E  Y  ++ D  +QV++ISGESGAGKTE+FKR+L+Y A  S G        DQ++    A  +L+STPLLESFGNA T+RNDNSSRFGKYVE+FF    I G+R+TNYLLEKSR+V     ER YH+FY++L  LD   K+ +    I DY+YL   K   ++ R+D   L+  ++ W +L  T +D+++ +RI+S +LHLGNI F E  E S++   E + I++  L +D  +L+  LT K TET K+   SP+NK Q+   RD+++K LYSE F+ +V ++N  L   N         D   L+ G   R+I++LDIYGFEN P+NSLEQLCINYANE LQ FFNRYVFELEQ EY +EG+SW YI +PDN+ II+LL+A+P+GII ILNDE  + QG D SF++KCH  H  N +Y  PK +   +F+I HFAG I Y+V G +EKNRD +R E L+++ N  +  IA +F++  E++  N P AK R+P ++  F SSL +L+  MKT +PWF+RC+KPN  K+AL F   +VM+Q++Y GILETVKIR SGFP+++ ++VF + +  L+ K   +A   +KD      +LM     V        +   +E+G+ K+FL+++ A  LE     +R R    +A IIQR WR     +L   +N AA  IQ++ RG++ R+  + + +G       VR+ +                    P++   +D     ++K    E+        + +          L  P +LAF++DK   +GK    S+ P       F  Q   T      W   +G+ + +P      V+ N       H+  F+   R  PL  P +     Q   D ++ A KLI R++Y  S+    +F+  SYL  +A  +  + KEIL Q+L +T+    +  +     S+ E+   ++A           W   G          N++S   P   +     +      GV       + L                L+F        P+  RL+P + LE   N  G+   L + +PD  + ++H   F+  ++LA+ ++  + K  +L +GW+VS+  +  + +  G  +++D++SA ELP  W  + G   +QNFL++    ++ +P+D+ 
Sbjct:   67 GVDNMVNLRNLSEVTILENLKMRYRKKNIYTYIGSILVSVNPYVDLLIDGPEVMSTYRNQPMASMPPHVYGIAEGMYQNLLHDGSDQVVIISGESGAGKTEAFKRILRYLASSSEG--------DQITWGSAAQGVLESTPLLESFGNATTLRNDNSSRFGKYVEVFFLGPTIVGARVTNYLLEKSRVVQQAVGERNYHVFYQLLSSLDRETKAAHRLTSITDYAYLQYGKASRVESRSDPDGLQVLLNCWSNLRFTGDDMELCLRIMSGILHLGNIDFGETDEASFIKNPEILEIIASELAIDPVALQLILTTKVTETQKETVRSPVNKVQARVNRDSVAKSLYSEYFDHLVNELNLRLAPRN--------SDEMDLNLG--LRTISLLDIYGFENLPNNSLEQLCINYANENLQLFFNRYVFELEQAEYNQEGVSWAYIKFPDNKDIINLLTARPDGIIHILNDEAYLGQGKDSSFIHKCHQAHKNNPHYGIPKISSNSEFLIVHFAGTIPYAVDGLVEKNRDRMRPEALSMLCNSGIEGIAFMFKRMSEVKRSNQPGAKGRSPTLLDSFHSSLQSLMETMKTKRPWFVRCIKPNPEKKALTFEDTMVMEQLRYIGILETVKIRSSGFPVRLPYTVFANNYTSLLEKNTYRAVTRIKDPHERTQQLMNNLHLVIGQSGNVKRGVEYEMGRQKIFLRQELADSLE----FVRRRRHVQAARIIQRAWRRRALGQLDRARNNAAILIQAVFRGYLARKNNKNILMG-------VRLPV--------------------PLQTTSED----PLWKENEDEVEYSQLTPTEMSQ---------LMCPADLAFIMDKIGKDGKGKELSNDPEMEVTKTFMVQRRLTSDLPGCWTTYKGDSFSVPTIQQ--VIANSGSSTSAHLDTFQLGQRMAPLVRPLVFARPMQIEGDMAIEASKLITRLIYQNSLSLHDEFILGSYLYQMALSNSMMFKEILFQLLNQTINWPITSELDYATDSEDEDAMFSQARTDLVRQRSTKWRTTGRTGLQMKRSKNVISHNTPQDQMRRSHRRLWMHIAGVLTCGRLPKSLMAAVVKHIRIHAPRRSLRFCEDRIVTAPKTVRLYPPSLLEWRVNYTGTNMALFLTYPDGTTANIHTLCFSRADELANQAISLKAKMARLGRGWTVSLYRNTSIIEPGGHCFIMDLLSANELPVDWPLLAGLGHDQNFLVTA---MDLEPLDLG 1238          
BLAST of Unconventional myosin-XV vs. TrEMBL
Match: T1JBR9 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=3 SV=1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 423/1153 (36.69%), Postives = 654/1153 (56.72%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEE-----QETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTA----------KARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELP 3548
            L+  G D+M +L +L++ SLL NL++RY ++LIYTY GSIL+++NPY    IY    +  Y+ +++  +PPHLF IG + Y  M +D E+QV+VISGESGAGKTES K +++Y A        V ++S  L   I  +IL+++PLLE+FGNA+T+RNDNSSRFGKY+E+ F NG I G+  T YLLEKSRIV   P ER YH+FYE+L GL+   K +Y       Y YLN      I  ++D  + +  +S    LG + ++ +   RILS+VLHLGNI F  +     QE   +     I   S +L++  D +   LT KTTE   +  ++PLN +Q+++ RD +SK LYS LF+W+V ++N                  S++  GS   SIA+LDI+GFE+F +NS EQLCINYANETLQ +FN+++F+LEQ+EY KE I W  IA+ DNQP+I+L+S KP GI+ +L+DE + P+ +D+SFL KCH  H  N+ Y +P+ +   +F I H+AG + YSV GFL+KNRD LR +++ ++ + ++  I+ +F   R       T           K RTP V   F  SL  L+  M  C PWF+RC+KPN  K  + F+  IV++Q++YTG+LET+KIRK G+P+++ F  F  R+  LV  +I K      +  C K+++     +  H++LG TK+FL+E   + LE++   + N +A+I+Q+  R     +  +   +  TKIQ+ +RGF+ R++ +K+  GI++ QA  RM   ++R+     E  +  +     E K ++ +K+   K+ + +                  NY  L+IP ELAF+  K EG+ + + S  F ++ I     Q  +    Y+LP+DID F    F++ +       ++  P+ VP+L +    D+  +SL   KLILR M   ++    +    +Y+      +  L+ E L Q+  +T  ++S          E+ + R W L+ N +S   PS  +Y Y++K+VSD        TCQ KLLQ +      + R++P  +LE   N+K     L V   D++     + S+TV E+    S+  + +      GWSVS+ +++   + +G +YVLD +S  E+P
Sbjct:   61 LASSGEDDMIHLNDLNEASLLWNLRLRYDKQLIYTYTGSILVAVNPYKMFDIYGLDVVKKYEGQILGTLPPHLFAIGSSAYATMSKDRESQVVVISGESGAGKTESTKLIMQYLA-------AVNKSSSNL---ITEQILEASPLLEAFGNAKTVRNDNSSRFGKYLEVHFKNGVITGANTTEYLLEKSRIVTQAPEERNYHVFYEILAGLNDEEKEKYGLTSADKYFYLNQGGSCEISCKDDGEDFQALLSAVQVLGFSLDEQETIFRILSSVLHLGNIYFHRKPLKHGQEGVEIGSNAEIKWTSHLLQLSPDGIVQALTTKTTEARNEKLMTPLNLDQALDARDAISKALYSRLFSWLVQRIN------------------SIVCKGSKKTSIAILDIFGFEDFQENSFEQLCINYANETLQFYFNKHIFKLEQQEYAKEKIEWQTIAFQDNQPVINLISKKPVGILHLLDDESNFPKATDMSFLEKCHYNHALNELYSRPRMSS-MEFGITHYAGQVWYSVEGFLDKNRDTLRSDVVELLISSKLQMISKMFMDLRNTGEATKTVNRNNGRFVTMKPRTPTVAARFNDSLLALVENMTRCNPWFVRCIKPNNEKAPMNFDMAIVLEQLRYTGMLETIKIRKMGYPVRMKFQQFCERYRCLVRDKIPKGV--PTREIC-KVILDSDPHRRDHYQLGTTKVFLRETMEQMLEQKRYNLLNNAAIILQKCIRGRVARKKFLSMRKHTTKIQARIRGFLIRQKYQKIRRGIIRAQATYRMARQKERYKELKDEMKRQEV----AEAKAREVAKIKAQKSEMEK---------SARVAATGINY--LEIPAELAFIFSKLEGELNWQVS--FSDRNIIKVVGQVPFVEDSYRLPSDIDYFPFSKFVNIYFKSHNLGARKEPIKVPFLAKLKDSDYH-ESLAIFKLILRFMSDHTLGGKRESALGNYIVQKGLANESLRDETLCQLANQTWKNES----------EVSIERGWLLMANCMSCFPPSKTLYKYLMKYVSDQAFNGYKATCQNKLLQ-SERVDSYLVRMYPPCSLEWKTNRKHCNMALEVAFVDDELMYGPVESWTVAEEFC--SVLLKERGINECWGWSVSLSHANGSTELNGYDYVLDAVSEKEIP 1150          

HSP 2 Score: 76.2554 bits (186), Expect = 1.469e-9
Identity = 65/309 (21.04%), Postives = 135/309 (43.69%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGN--PSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDWLVPSKNQSVDSNELSVISKIA 7097
            ++++ + P++ ++L+  ++ + + A+E    ++    +    +N   ++    I      +  L +E++ Q+ KQ   N  P   S    W   SI+  +   +  ++P+L ++L     +        A   L+N +   K+G RK +P   E   +  G         +P  + +        V D+I+ IC  LN+ S+ E+ E+SL        G T T     L    Y  +++  L + +   ++ F R  W  PL LD  +  ++   F Q++   L E  L+ +  +++ ++ +  ISK+A
Sbjct: 2490 MVKYTKSPIQASLLKLDSSELNKLALECFISIMQYMGDYPQSKNKTEVECVYGILMNCHHHPHLRDEVYCQIMKQTTNNKSPKTDSCQKGWRLFSIIAAYFDCSDLLKPYLFKYLETAAYDKRRAYHGTAMVCLQNLRKTFKYGGRKNVPSIEEITAITAGRNSKRQIYRLPGGTER-------VVADIIEEICSHLNIRSQQEMEEFSLYCI---VEGDTFTMP---LAREEYILDVTTELHKNQQVFYLIFCRSVWYCPLRLD--SELYIEVVFNQIAPDYL-EGMLLVTPGETIPTDIVYDISKVA 2782          

HSP 3 Score: 70.8626 bits (172), Expect = 5.996e-8
Identity = 40/154 (25.97%), Postives = 81/154 (52.60%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVI-GNRVTKDINSILAVPTNTMLK--VIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVT 5747
            Y TY ++PW   +++E++ P+E     +   ++FCQ+V+D+    CIR+   E++KL  ++ G  +T   N++ +    T +K  ++D      +YF+R +    V           + +SHSGVR V+++   P + L +   + + +I +V+
Sbjct: 2096 YNTYTRMPWTLRIRKEVFTPSEELTNPLAFHLVFCQVVQDVFSNSCIRFNREERQKLRQLVDGYGITP--NNLHSTHHKTAIKKNIVDLARDAAVYFARLFP---VSGGRALPQVEMLGVSHSGVRLVRRHRDVPIDWLEVLDELTFEDIAEVS 2244          
BLAST of Unconventional myosin-XV vs. TrEMBL
Match: A0A210QCQ2 (Unconventional myosin-XV OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05236 PE=3 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 431/1154 (37.35%), Postives = 648/1154 (56.15%), Query Frame = 3
Query:  141 DQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQ-----ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRE-LQTKN--------PTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFL---LDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFR-MKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELP 3548
            ++G+++M NL  L + ++L NL+ RY ++ IYT++GSIL S+NPY    IY +  +  Y+ + +  +PPHLF IG  +Y++M+++ ENQV+VISGESGAGKTE+ K L++Y A V+    ++          I  +IL++ PLLESFGNA+TIRNDNSSRFGKY+E+FF  G+I G+R + YLLEKSR+V     ER YH+FYE+L G +   K +Y  +    Y YLN     +I  R+DA N +   +  + L     + +   +ILS VLHLGNI F   Q     +T  L     +  +S +L++ +D LK  LT K TET  D  ++P N EQ+++ RD +SK LYS LF W+V +VN       LI+ R    +R   SA      IA+LDI+GFE+F  NS EQLCINYANETLQ FFN+++F LEQ EY KE I W  I + DNQP+IDLL++KP GI+ IL+DECS PQ +D+SFL KCH  H  N  Y+KP+ +  P+F + HFAG I YSV  FLEKN+D LR +++ ++   +   IA++F++ R+ L TK          T K RTP V   F  SL +L+  M  C P+F+RC+KPN  K  ++F K +V+DQ++YTG+LET++IRK GFPI++ F VF+ R+  L+  +I   +L  +   C ++++      +  + +G TK+F+KE F   L+   + I+  S V IQ+  R +   R  +    A  KIQ++++ +++R++  K+  GI+K QA VRM+  R R+L A  E  + +  ++    K ++  K+   +        K ++ K    I N      L+IP ELA++   LD  +   +     P  + V       HL  +  Y+LP D+D  V   F + +  +  +     P+    L +   +D  + +++  K+ILR M    +    +     Y+  +   +  L+ EI  Q+  +   ++ +            + RAW L+   LS   PS  ++ Y+LKFVSD        TCQ K LQ A    PQ+ R +P   LE  A  + +   L V   DN      + S+T GE   SH +  R +K  K   GW+V +      Y+  G +YVLD++S +E+P
Sbjct:    7 EKGVEDMINLSVLDEGTILHNLEARYERERIYTFVGSILASVNPYKMSNIYGRDMVKKYEGQPLGSLPPHLFAIGSVSYSRMLKEKENQVVVISGESGAGKTEATKLLMQYLAAVNKSGNDL----------ITEQILEANPLLESFGNAKTIRNDNSSRFGKYIEVFFKTGSIVGARTSEYLLEKSRLVTQAAEERNYHVFYEMLSGFNEEQKGKYGLQSANKYFYLNQGGSCSISGRDDAENFRVLNTAMEVLNFERNEQETIFKILSCVLHLGNIYFKAIQHDNGPDTVLLGSDAELKWMSHLLQLSEDWLKQALTTKVTETRGDRVLTPFNIEQALDSRDAISKALYSRLFTWLVERVN-------LIICR---AEREKTSA------IAVLDIFGFEDFHVNSFEQLCINYANETLQFFFNQHIFRLEQREYTKENIDWSLIEFQDNQPVIDLLASKPAGILVILDDECSFPQATDLSFLEKCHFHHSSNSLYDKPRMS-VPEFYVIHFAGKIKYSVDHFLEKNKDTLRSDVVELLCESKNRMIASMFKEMRDRLITKTLSKSTGRYVTLKPRTPTVAAGFTESLLSLIDTMSKCNPYFVRCIKPNNHKAPMQFEKTVVLDQLRYTGMLETIRIRKMGFPIRVKFPVFIERYRFLLLGKINDRALPTE--VCNQILLTQGPSMSHMYRIGATKVFMKETFEHQLDLHAKNIQYNSVVTIQKLTRMFLARRKFLHLQTATCKIQAVIKTWVERKKYLKVRNGIIKAQAQVRMRRERHRYLHAREELKRKAEQDRIARQKQEEQVKMAREE--------KARQAKAMEAISN------LEIPGELAYIYSKLDDWQSVHTERHIGPVTDPV------AHLDQK--YQLPMDVDSHVFSKFANIYFRNPDWGVLKAPIKAG-LTQLQGEDLNNRAVSVFKMILRYMGDPHLSKRREKAMADYIVLMGLNNEGLRDEIYCQVANQCWNNQDLTA----------IGRAWCLMAACLSAFPPSEKLFKYLLKFVSDVGYNGHKITCQHKALQCAKM-QPQLSRSYPPCLLEWHAILQCTNMALPVKFADNVRMYGPVESWTSGEIFTSHLVSSRGLKENKF--GWTVVLQEETDFYELMGYDYVLDLLSEMEIP 1095          

HSP 2 Score: 77.0258 bits (188), Expect = 9.276e-10
Identity = 56/264 (21.21%), Postives = 114/264 (43.18%), Query Frame = 3
Query: 6177 ILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYL--WNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQ--FNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPL 6956
            +++W + P++ ++L+       + A+E    ++    +   G N         I +   ++ E+ +EI+ Q+ KQ   N S+K ++ +  W   SI+  +   ++ ++P+L ++L     + S      A+  L+N +   K+G RK +PL +E   L +G      S        +    +  +  V+D I+ IC  L++   +E+ EY+L +           +  Y+L      D  S  ++  K    + F R  W  P 
Sbjct: 2190 MVKWTRSPIQASLLKLPTAEFNKLALECFLCVMKFMGDYPIGPNQSEYDCVLKILRSCHKHPEMRDEIYCQLCKQTTSNRSMKPKSCIMGWRLFSIIACYCDCSESIRPYLFKYLETTSSDSSRTFSGAASICLQNLRKTFKYGGRKNVPLKAEISALADGRVSKRYSFIYSGSEREGMLQVRPSLVVKDSIEEICNRLDIFDPVEMEEYTLFLRTSDDHYSRLKSEEYIL------DVTSEFIRGNKDYQLV-FQRTVWFFPF 2446          

HSP 3 Score: 72.4034 bits (176), Expect = 2.003e-8
Identity = 43/158 (27.22%), Postives = 82/158 (51.90%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNE-IQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLK-CELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPD 5762
            Y TY  VPW   +++E++ P E ++N   ++ +IFCQ+V+D+    CIR   +E+ K+  ++ N      N      +N + K++ +T K    YFSR + +     SE G T  ++ +SH+G+R + +     ++ L +  H  + ++  +   T D
Sbjct: 1829 YLTYNSVPWSLNVRKEVFHPRERLENVDALH-IIFCQVVQDVYNLGCIRIGKDERIKMRGMLENYGINRTNYQTGDFSNQVKKIVVDTAKEWGAYFSRLFPV--AGQSEKG-TVRYIGVSHAGIRLIDREQSMVDDNLEVLEHFKFEDVIDIVMPTKD 1982          
BLAST of Unconventional myosin-XV vs. TrEMBL
Match: A0A1S3KD11 (LOW QUALITY PROTEIN: unconventional myosin-XV-like OS=Lingula unguis OX=7574 GN=LOC106180800 PE=3 SV=1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 422/1169 (36.10%), Postives = 672/1169 (57.49%), Query Frame = 3
Query:  135 LSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKREL---------QTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLK-DQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFL--------RAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNA----FNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQ-TGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMK----GWSVSVIYSDRVYDCSGQNYVLDIISALELP 3548
            L ++G+D+M  L +L++ SLL NL+IRY ++ IYTY+GSIL+++NPY    +Y    +  Y+ +++  +PPHLF IG   Y+KM++D +NQV+VISGESGAGKTESFK L++Y A V+       ++ + L   I  +IL++TP+LE+FGNA+TIRNDNSSRFGKYVE++F  G I G+R + YLLEKSRIV     ER YH+FYE+L GL S ++ +Y  +    Y YLN      I  +ND  + K  +  ++ LG T ++ D  ++IL++VLHLGN+ F    + +Q+T  +     +  VS +L++    LK  LTMK T   ++  ++P N +Q+++ RD ++K LYS LF W+V ++N  +++     ++ +              SIA+LDI+GFE+F  N  EQLCINYANETLQ +FN+++F+LEQ+EY KE I W  I + DNQP ID+++ KP GI+ +L+DE   P+G+D SFL KCH  H  N+ Y KP+ +  P F I HFAG ++Y V  FLEKN+D LR + + ++   ++  I+ +F++ R+            +    K RTP V   F  SLT L+ KM  C P+FIRC+KPN TK A++F+  +V+ Q++YTG+LET++IRK G+P ++ FS+F  R++ L+  + RK  +  D +  C  ++++ + ++ + ++LG +K+F++E F++H+E         S + +QR  R Y   R  +    AA ++Q+ +R +++R R R L  GI+K QA  RM++ RKR+L        +   E  K+ +  + IE       K+T Y  P +  P + ++ + +     +         L+IP ELAF+  K +G + P   L     +I+  G  + +    ++ LP+DI+ FV   +   +     +  +  P+  P+L ++   D K DS+   KLILR M   ++    + +   Y+      + +L+ EI  Q+  +T      R    ++ E     R W L+ N LS   PSP++  Y+LK+VSD         CQ KLLQ      P + R +P   LE  A KK +   L V   D +    H++S+T  E+     +C  ++  + +     GW++ +   +  Y+ +G +YVLDI+S +E+P
Sbjct:   68 LGEEGVDDMITLNDLNEGSLLWNLKIRYEREQIYTYVGSILVAVNPYKMFDMYGLDRVKQYEGQVMGTLPPHLFAIGSACYSKMIKDEQNQVVVISGESGAGKTESFKLLMQYLAAVN-------RSGNNL---ITEQILEATPILEAFGNAKTIRNDNSSRFGKYVEVYFSVGKINGARTSEYLLEKSRIVTQAENERNYHVFYELLAGLPSGDREKYGLQKANKYFYLNQGGSCVIDGKNDYEDFKSLLQAFEVLGFTKQEQDSIIKILASVLHLGNVYFEKKQVNDQDTVDIGSDAEVKWVSHLLQLSPTWLKEALTMKVTTARQERLLTPFNIDQALDARDGIAKALYSALFTWLVDRINHTVHKKQGKGKKHT--------------SIAILDIFGFEDFKVNGFEQLCINYANETLQYYFNQHIFKLEQQEYAKERIQWDSITFTDNQPAIDMIARKPIGILHLLDDESHFPKGTDQSFLEKCHYTHADNELYSKPRLSS-PVFSIRHFAGKVTYDVRNFLEKNKDTLRNDAVTLLTTSKMELISEMFKQLRDKFISKQVNQHNGRYIAMKPRTPTVAASFHESLTNLIDKMSKCNPFFIRCIKPNNTKAAMQFDIPVVLSQLRYTGMLETIRIRKLGYPARMRFSMFYERYWCLI--DHRKIPVNVDHRGKCELILLETRAMEVEKYQLGLSKVFMRESFSQHMEALRHEKLAASVLKLQRYVRGYLCRRRYMKMRVAAVRLQAHLRAWMNRTRYRILRKGIIKAQAQYRMRLQRKRYLAMLADHKHKKQEEQRKIKMAKEKIE------KKITSY--PSASDPIRRQQGQLEEEEERSARAVAGVAHLEIPPELAFIFSKLDG-WQP---LHTDRNLIKVVGHVEPM--NFQFSLPDDINSFVFTKYTKAYFKDYGWGMRKEPIKSPFLPKSSDVDIK-DSMAIFKLILRFMNDVNLSERRECVLADYIVQKGLINLQLRDEIYSQLCNQTW-----RNPSHANSE-----RGWLLMANCLSCFPPSPNLSKYLLKYVSDNAYNGYKAFCQSKLLQCIDI-EPLVCRYYPPCMLEWKATKKKTNMALEVKFADGQYMIGHVDSWTTSEEF----VCSLLRSGRHITDGNHGWTLILQDENEQYELAGHDYVLDIVSEMEIP 1179          

HSP 2 Score: 103.219 bits (256), Expect = 9.616e-18
Identity = 75/330 (22.73%), Postives = 154/330 (46.67%), Query Frame = 3
Query: 6054 KNTDKPINTDKVYDKVKKQGNLIDFTVNFSKYKDRQHVSNVILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVK--SRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPND-SYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAG---PTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILD 7025
            + T K +   K +   KK+G  +D+T     +K++      +++W + P++ ++L++      + A+E    ++    +    ++  P+   N +      + +L +E++ Q+ KQ   N S K  S    W  LSI+  +      ++P+L++++  +  + S     +A+  ++N++   K+G RK +P   E   + +G         +        N+      EDVI+ +C  L + + LE+ EYSLI + +TK     P K        N F FD  + L +Q+K  +F+ F R +W+ P+++D ++ N++   + Q      D
Sbjct: 2469 RGTLKLLENLKSHSLRKKRGGGLDWT-----WKEQAD----MVKWTKSPIQASLLKAKTPQFNKMALECFIAVMQYMGDYPLPRDKTPVDCVNQLLMACHSHPDLKDEVYCQICKQTTNNKSSKPDSCQQGWRLLSIMTAWFDCTDALRPYLIKYIQSVAFDTSRTHCGIASICVQNFRKTVKYGGRKNVPDAEEIKAITDGRVSKRQQCMLAGILPIVLNVRPCTLAEDVIEDVCYRLGLENPLEVEEYSLI-YVLTKENEYVPMKR-------NEFIFDITTELSRQRKKYVFL-FQRTSWVFPIHMDSQSENYIDITYHQTLPDFFD 2780          

HSP 3 Score: 73.9442 bits (180), Expect = 7.795e-9
Identity = 53/212 (25.00%), Postives = 99/212 (46.70%), Query Frame = 3
Query: 5295 YYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGN-RVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKT----SEVGN----TYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIH-GNSARKLIMEFSEHQKVEQSHG 5900
            +Y Y +VPW   +++E++ PNE      +  ++FCQIV D+    CIR   +EK K+ +++G   +T +  +  +  ++    V+D      LYFSR + + +  T      +G     +   +++ HSGVR V++      + L +  H  Y +I +V+         P+  T+    R ++ +   H  N  R +I  F     +E  +G
Sbjct: 2130 FYCYTRVPWQLHVRKEVFSPNEKLENPALVTLVFCQIVIDIHNDACIRINKDEKNKMKAILGGYGITLENMTSTSHKSHVKKNVVDSARDWPLYFSRLFPVSFSGTMNARGRLGGHRMPSVQLLAVGHSGVRLVKRVKGIFVDSLEVIEHFRYEDIVEVSV--------PRGSTLQLNIRGRWLILYTHRANQIRHMINAFC----IESEYG 2329          
BLAST of Unconventional myosin-XV vs. TrEMBL
Match: A0A564Y0R4 (Myosin motor domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1919 PE=3 SV=1)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 435/1229 (35.39%), Postives = 670/1229 (54.52%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLS-SDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF-RKKRELQTKNPTAK-----ARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRK-----ASLKDQQAACLKLMIKFKG----VK-NKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKF----SPESSLPFQEQVIQTGRAQHLWN--RGEYKLPNDIDLFVLEN------FLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAET-----------------------------LPSKSIRTK-----------------YQSDHEEIRLT--RAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWSEITGQLLEQNFLMS 3602
            G+DNM NL  LS  ++L NL+IRY +K IYTYIG+IL+++NPY +L I     + +Y+N+ +  MPPH++GI E  Y  ++ D  +QV++ISGESGAGKTE+FKR+L++ A  S G        +Q++    A  +L+STPLLESFGNA T+RNDNSSRFGK+VE++F   +I G+R+TNYLLEKSR+V   P ER YH+FY++L GLD   K  ++   + DY+YL   K   +  R+D   LK  +S W +L  T +D+D+ +RI+S VLHLGN++F E  E SY+   E + I++  L +++ +L + LT K TET  +A  SP+N+ Q+   RD+++K+LYS+ F  +V ++N  L           V D S      +   I++LDIYGFEN P NSLEQLCINYANE LQ FFNRYVFELEQ EY  EG+SW Y+ +PDN+ II LL+ KP+GI  ILNDE  + QG+D SF+ K H  H  N +Y  PK +   +F+I HFAG I+YS  G +EKNRD +R E L+++    +  +A++F     ++  + P A       R+P ++  F +SL  L+  MKT +PWF+RC+KPN  K+ + F   +VM+Q++Y GILETV+IR SGFP+++ +  F+  +  L+ ++  +       LK +  A L  + +  G    VK  K FE+GKTK+FL+++ +  LE   +    ++A IIQR WR     +L   +N AAT IQ++ RG++ R++ +KL   ++K++    +Q      L A  +               ++N +   Y+AP+                 N      L IP +L+F+++K++  F    + E S  F  + + T      W   RG+      I   +  +       LD F        +  PL  P +     Q   D ++ A KLI +++Y  S     +FL  SYL  LA  +  L +EIL Q+L +T                             +  KS R K                 +++  +E+R +  R W  +  +L+           V++ V           C+++++       P   R +P + LE   N  G+   L + +PD  + ++H   F+  ++LA+ ++  + K  +L +GW++S+     V + SG  YV+D++SA ELP  W  ++G + +Q FL +
Sbjct:   67 GVDNMVNLRNLSQMTILDNLKIRYNKKNIYTYIGNILVTVNPYVDLLIDGLDVMTTYRNQPMASMPPHVYGIAEGMYQNLLHDGVDQVVIISGESGAGKTEAFKRILRHLAASSEG--------EQITWGSAAQGVLESTPLLESFGNATTLRNDNSSRFGKFVEVYFAGPSITGARVTNYLLEKSRVVQQTPGERNYHVFYQLLSGLDKETKDAHHLTSVSDYAYLQYGKASKVASRSDPDALKVLLSCWSTLRFTGDDMDLCLRIMSGVLHLGNVEFGERDEVSYIKNPEILSIIANELGINKQTLANVLTTKVTETRNEAVRSPVNEMQAKVNRDSIAKYLYSKYFELLVEELNRRLA--------PPVSDNS-----DSVPCISLLDIYGFENLPSNSLEQLCINYANENLQLFFNRYVFELEQSEYSSEGVSWSYVTFPDNRVIIQLLTGKPDGIFHILNDEAYLGQGNDKSFIQKSHAAHKNNPHYGVPKISSFSEFLIVHFAGIIAYSTDGLVEKNRDRIRPEALDMLCGSTLGRVASVFLPGNAKVNNRGPQAGTSSRFGRSPTLLDGFHTSLLALMETMKTKRPWFVRCIKPNPEKKPMTFEDTMVMEQLRYIGILETVRIRSSGFPVRLPYEQFVHTYTSLLDRQTFRQVTSIPDLKQRAQALLANIHRVLGETTPVKLGKDFEVGKTKVFLRQELSDKLENVRRRRHVQAARIIQRAWRRRALGQLDRARNNAATLIQAVFRGYLARKKNQKL---LMKIRIPAPLQSGEPSALMAMSDAIMW-----------KENEEEMEYEAPL-----------------NDQEIASLSIPQDLSFVIEKSDPGFLSNSAMEVSKTFMVKRLMTSDLPGSWTQFRGDLWTAPAITQIIANSGSATSKHLDKFQ----LGQRQAPLIRPLILNRPTQIEGDMAIEASKLITKLIYQSSGDLLEEFLMGSYLYQLALSNFTLFREILFQLLNQTFNWPINSELDYATDSEDEEIAFSYERKDLIRQKSTRWKSTGRTGVQMKRSRHEYSHKTAQDEMRRSHRRLWMHIAGILTCGRLPKSQRAAVVRHVRQFAPPRSLRFCEDRIVT-----APTTTRTYPPSMLEWRTNYTGTNMALYLTYPDGATANIHTTCFSRADELANQAISLKAKTARLGRGWTISLYRKGGVIEPSGHRYVMDMLSATELPSDWFTLSGLIPDQTFLAT 1234          

HSP 2 Score: 85.1149 bits (209), Expect = 3.123e-12
Identity = 53/165 (32.12%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 5271 LCGLP--DMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGN-RVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKT 5756
            L G P  +MRY TY+   W   +++E+  P E      +  ++FCQIV D++E    R   N+ R L + IG   +   +N ++  PT     +ID   +C  YF RFY I+    SE    YHW  +    +RFV Q  +  E  L   + I   NI+  +CK 
Sbjct: 1418 LSGYPPHEMRYLTYKHARWSLRVRKELITPQEKLKPKRLLDLVFCQIVGDVLENATPRLTPNDIRVLRNTIGEILLNSSLNQLVLQPTAVKRMIIDAAKQCPYYFGRFYAIEPTDKSENSRLYHWCVVGLKAIRFVVQ--KKNERHLEPYAEIPLGNIE--SCKA 1578          
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Match: myo7ab (unconventional myosin-VIIa-like [Source:NCBI gene;Acc:103035949])

HSP 1 Score: 551.977 bits (1421), Expect = 4.963e-160
Identity = 293/786 (37.28%), Postives = 472/786 (60.05%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGL-----NQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRS----AVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFL 2450
            S  G+++M  L +L++  +L NL IRY  ++IYTY GSIL+++NPY  L IY   +I  Y N+ I +MPPH+FGI +  Y  M R+N++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+    P ER YHIFY +L G+ S  K++       DY+YL          R+D       +S    L  T +E+ +++ ++L+A+LH+GN++F     +  ++  +V + ++   + +L+VD   +  CLT +T  T  ++  +PL+ +Q ++ R+   K +Y  LF WIV K+N  +     NQ+N I R                 SI +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQEEY  E I+W +I + DNQ  +D+++ KP  II ++++E   P+G+D + L+K ++ H  + NY  PK +H   F I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++ + + Q++Y+G++ET++IR++G+PI+  F+ F+ R+ +L+         +D +  C ++ +   G +N+ +++G+TK+FLK+    H + Q++I R+++     ++IQ+  R        +    A   IQ++ RGFI R+  R +  G ++LQA  R   +RK +L
Sbjct:   63 SIHGVEDMIQLGDLNEACILRNLFIRYRDRVIYTYTGSILVAVNPYQLLPIYTPDHIRLYSNRKIGEMPPHIFGIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNRRGAIEGAKIEQYLLEKSRVCRQAPDERNYHIFYCMLRGMSSDQKTKLGLGLATDYNYLTMGNCTVCDGRDDMKEYSSILSAMKVLMFTDTENWEIS-KLLAAILHMGNLRFEARTFKHLDSCVVVRSPDLAKAATLLEVDPQDVMTCLTTRTLITRGESVSTPLSVDQGLDVRNAFVKGIYGRLFVWIVEKINAAIYRTLSNQDNDIPR-----------------SIGLLDIFGFENFNINSFEQLCINFANENLQQFFVRHVFKLEQEEYNLERINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLSKLNSQHKLSINYIPPKNSHETHFGIQHFAGVVQYETKGFLEKNRDSLHSDIIQLVHSSKNKFIKQIFQADVAMGVE---TRKRSPTLSSQFKRSLDLLMRTLSVCQPFFVRCIKPNELKKPMLFDRGLCVRQLRYSGMMETIRIRRAGYPIRYTFAEFVDRYRVLMPGVKPAHKQEDHRGTCQRIAVSVLG-RNEDWKIGRTKIFLKD----HHDVQLEIERDKAITDKVILIQKAVRGMKDRANFLKARSAVIVIQTMWRGFICRKNYRVMRTGFLRLQALCR---SRKHYL 808          
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Match: myo7aa (myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1])

HSP 1 Score: 534.643 bits (1376), Expect = 1.568e-154
Identity = 293/796 (36.81%), Postives = 465/796 (58.42%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLT-SEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGL---NQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRS----AVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIY 2486
            S  G+++M  L +L++  +L NL IRY + LIYTY GSIL+++NPY  L IY    I  Y NK I +MPPH+F I +  Y  M R+N++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+      ER YHIFY +L G+ S  K +       DY+YL          R+D        S    L  T +E+ +++ ++L+++LH+GN+ +     +  +   +V   ++   SK+L+VD   L +CLT +T  T  +   +PL+ EQ+++ RD   K +Y  LF WIV K+N  +     ++L   R               RSI +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQEEY  E I+W +I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK ++ H  N NY  PK  +  QF I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++++ + Q++Y+G++ET++IR++G+PI+  F  F+ R+ +L+         +D +  C ++     G ++  +++GKTK+FLK+    H +  ++I R+++     ++IQ+  R +      +   +AA  IQ   RG+  R+    +  G  +LQA  R   +RK +   H    +++++
Sbjct:   41 SIHGVEDMIRLGDLNEAGILRNLLIRYREHLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQARDERNYHIFYCMLKGMTSDQKKKLGLGKATDYTYLTIGNCTVCDGRDDQKEYSNIRSAMKVLMFTDTENWEIS-KLLASILHMGNLHYEARTYDNLDACEVVRCADLTTASKLLEVDSKDLMNCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIFKPTSHDLKAVR---------------RSIGLLDIFGFENFTVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDTTMLNKLNSQHKLNTNYIPPKNNYETQFGIQHFAGIVYYETRGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAET---RKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLG-RDDDWQMGKTKIFLKD----HHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLKMKRAALTIQKTWRGYHCRKNYDAMRAGFSRLQALYR---SRKLYQTYHVARQRITLF 798          
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Match: myo7bb (myosin VIIBb [Source:ZFIN;Acc:ZDB-GENE-070912-482])

HSP 1 Score: 527.709 bits (1358), Expect = 3.399e-152
Identity = 297/787 (37.74%), Postives = 452/787 (57.43%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFME----EQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFR---------------------KKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFV 2420
            S +G+D+M  L +L++  +L NL +R+ Q +IYTYIGS+L+++NPY  L IY  + +  Y  + + ++PPH+F I +  Y  ++R+  NQ  VISGESGAGKTES K +L++ A VSG    ++Q           +IL + P+LE+FGNA+T RNDNSSRFGKYVEIFF+ +G I G+ I  YLLEKSR+ +  P ER YHIFY +L G+    K+         ++YL      T   ++DA       +    L  T  +      +L+A+LHLGNI F        E+  ++ +++  I +K+L+VD+ +L   LT ++    ++    PL+ EQ+I+ RD L+K +YS LF WI  K+N+ ++++                    ++SI +LDI+GFENF  NS EQ+CINYANE LQQFF  ++F+LEQEEY KEGI W  I + DNQ  IDLL+ KP  I+ ++++E   P+G+D + L+K    H ++      +  H  QF I HFAG + Y  +GFLEKNRD L  +I+++I+      +  IF+                      KR LQ  N   +  T  + G F+ SL +L+  +  C+P+FIRC KPN +K++ +F++ + + Q++Y+G+LET+KIRK G+PI+  F+ FL R+ +L+ K        +  A C   + +        + +GKTK+FL++     LE + +   NR A+IIQR    +   +  I +  AA  +Q   RG  DR++I KL  G ++LQA V
Sbjct:   59 SVEGVDDMIKLGDLTEAGVLRNLLVRHKQGIIYTYIGSVLVAVNPYQLLPIYTAEQVRLYHGRKLGELPPHVFAIADKCYYNLLRNQRNQCCVISGESGAGKTESTKLILQFLAAVSGQHSWIEQ-----------QILQANPVLEAFGNAKTTRNDNSSRFGKYVEIFFNKDGIIEGAHIEQYLLEKSRVCHQAPMERNYHIFYCLLSGMAKEQKNILALGDATQFNYLTEGDCITCDGQDDADEFGRIRTALKVLTFTDRESWEIFCLLAAILHLGNISFEAGVENNMESCDVMSSDHFTIAAKLLEVDKLTLDLSLTHRSFVANRERLTKPLSSEQAIDCRDALAKAIYSRLFMWIFGKINSAIHKHTA-------------ENSYTYKSIGLLDIFGFENFDKNSFEQMCINYANEQLQQFFVEHIFKLEQEEYLKEGIKWKNINFTDNQLTIDLLAVKPLNILSLIDEESHFPKGTDKTLLDKIKENHKRSKIMVPSRNIHSMQFGIKHFAGVVFYDCSGFLEKNRDALSLDIISLIQKSSSKLLRLIFQSELNASVSRPAKNNNSRVLVNSKRSLQQGNDRRQIST--LSGQFRHSLDSLMKALSLCEPFFIRCFKPNDSKQSNEFDRKLCIQQLRYSGLLETIKIRKLGYPIRHRFTEFLGRYRVLL-KTTDCDPNTEPAADCCDAICRAVIKDEDDWRIGKTKIFLRDYHDSFLELERERELNRKALIIQRVLLGHRDRKTFIKKKSAALTLQKHWRGHRDRKQIEKLLQGFLRLQATV 818          
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Match: si:ch73-194h10.2 (si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-21])

HSP 1 Score: 525.783 bits (1353), Expect = 5.981e-152
Identity = 293/780 (37.56%), Postives = 449/780 (57.56%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVT------KEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-MQIARK 2441
            S  G+D+M  L +L++  LL NL +R+   +IYTY GSIL+++NPY  L IY  + +  Y ++ + ++PPH+F I ++ +  M R+ ++Q  VISGESGAGKTES K +L++ A VSG    ++Q           +IL++ P+LE+FGNA+TIRNDNSSRFGKY++I F   G+I G+RI  YLLEKSR+      ER YHIFY +L+G+ +  K         +Y+YL   K  + + R+D      F S    L  +  D     ++L+A+LHLGN+ F        E   ++ + +  + +++L+VD  +L+  LT ++  T +++   PL  EQ++  RD   K +Y  LF WIV K+N+ + +                + GS  +SI +LDI+GFENF  NS EQLCIN+ANE LQQFF ++VF+LEQEEY +E I W +I Y DNQ  +D+L+ +   I+ ++++E   P+G+D + LNK    H K+  Y  PK  H  +F I HFAG + Y   GFLEKNRD L  +++ ++E      +  IF    EL T +   K R   + G F+ SL  L+  +  CQP+FIRC+KPN  K+ + F++++ M Q++Y+G++ET++IRK+G+PI+  F  FL R+ +L+       K +R  + ++              V    +++GKTK+F K+     LE +     N  A+IIQ+  R +   +  + Q  AA  +Q   RG   R+  R   +G  +LQA VR  QI R+
Sbjct:   34 SVSGVDDMIRLGDLNEAGLLRNLLVRHRDGIIYTYTGSILVAVNPYQLLPIYTPEQVQLYTDRRLGELPPHVFAIADSCFFNMRRNRKDQCCVISGESGAGKTESTKLILQFLAAVSGQRSWIEQ-----------QILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSKGGSIEGARIEQYLLEKSRVCRQAQEERNYHIFYYMLMGMPAEQKKILSLGSAAEYNYLTMGKCTSCEGRDDIQEYAHFRSAMKILTFSENDSWEIHKLLAAILHLGNLDFEATISNNLEGCDILSSNHFNMAAQLLEVDTKALELSLTQRSFMTNRESVSKPLTSEQALGGRDAFVKGIYGRLFIWIVEKINSAIYKPP--------------AEGSTCQSIGLLDIFGFENFKQNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWTHIEYSDNQRTLDILAVRSLNILSLIDEESHFPKGTDSTLLNKLDKTHSKSTIYISPKNDHDTKFGIQHFAGPVFYDSKGFLEKNRDALSLDLILLVETSTNKLLKKIFHS--ELSTND--TKGRVLTLCGQFRLSLDALMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRKAGYPIRHTFQEFLDRYRVLLNSTVCDPKTVRTNTCQE--------------VAEDDWKIGKTKVFFKDFHDTMLELKRDKALNEKALIIQKVLRGHKHRKQFLKQRSAAVVVQKYWRGHKGRKLYR---LGFARLQATVRSRQITRQ 767          
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Match: si:ch73-194h10.2 (si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-21])

HSP 1 Score: 514.227 bits (1323), Expect = 7.704e-148
Identity = 287/793 (36.19%), Postives = 450/793 (56.75%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRK-------------------KRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-MQIARK 2441
            S  G+D+M  L +L++  LL NL +R+   +IYTY GSIL+++NPY  L IY  + +  Y ++ + ++PPH+F I ++ +  M R+ ++Q  VISGESGAGKTES K +L++ A VSG    ++Q           +IL++ P+LE+FGNA+TIRNDNSSRFGKY++I F   G+I G+RI  YLLEKSR+      ER YHIFY +L+G+ +  K         +Y+YL   K  + + R+D      F S    L  +  D     ++L+A+LHLGN+ F        E   ++ + +  + +++L+V   +L+  LT ++  T +++   PL  EQ++  RD   K +Y  LF WIV K+N+ + +                + GS  +SI +LDI+GFENF  NS EQLCIN+ANE LQQFF ++VF+LEQEEY +E I W +I Y DNQ  +D+L+ +   I+ ++++E   P+G+D + LNK    H K+  Y  PK  H  +F I HFAG + Y   GFLEKNRD L  +++ ++E      +  IF                     +  L+     +K R   + G F+ SL  L+  +  CQP+FIRC+KPN  K+ + F++++ M Q++Y+G++ET++IRK+G+PI+  F  FL R+ +L+   +     +  +  C + + +        +++GKTK+F K+     LE +     N  A+IIQ+  R +   +  + Q  AA  +Q   RG    R++ ++ +G  +LQA VR  QI R+
Sbjct:   56 SVSGVDDMIRLGDLNEAGLLRNLLVRHRDGIIYTYTGSILVAVNPYQLLPIYTPEQVQLYTDRRLGELPPHVFAIADSCFFNMRRNRKDQCCVISGESGAGKTESTKLILQFLAAVSGQRSWIEQ-----------QILEANPILEAFGNAKTIRNDNSSRFGKYIDIHFSKGGSIEGARIEQYLLEKSRVCRQAQEERNYHIFYYMLMGMPAEQKKILSLGSAAEYNYLTMGKCTSCEGRDDIQEYAHFRSAMKILTFSENDSWEIHKLLAAILHLGNLDFEATISNNLEGCDILSSNHFNMAAQLLEVK--ALELSLTQRSFMTNRESVSKPLTSEQALGGRDAFVKGIYGRLFIWIVEKINSAIYKPP--------------AEGSTCQSIGLLDIFGFENFKQNSFEQLCINFANEQLQQFFVKHVFKLEQEEYARENIVWTHIEYSDNQRTLDILAVRSLNILSLIDEESHFPKGTDSTLLNKLDKTHSKSTIYISPKNDHDTKFGIQHFAGPVFYDSKGFLEKNRDALSLDLILLVETSTNKLLKKIFHSELSTNDTKGRGNSKMVITPQNSLRQMTNDSKKRVLTLCGQFRLSLDALMKTLTACQPYFIRCIKPNDFKKPMLFDRELCMRQLRYSGMMETIRIRKAGYPIRHTFQEFLDRYRVLLNSTVCDPKTESAK-KCSESICQNTFSAEDDWKIGKTKVFFKDFHDTMLELKRDKALNEKALIIQKVLRGHKHRKQFLKQRSAAVVVQKYWRGH-KGRKLYRVQLGFARLQATVRSRQITRQ 819          
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 504.597 bits (1298), Expect = 1.022e-145
Identity = 280/779 (35.94%), Postives = 450/779 (57.77%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTEL-GIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRK---KRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRF-YLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRA 2456
            S +G+++M+ L +L + +++ NL +R+    IYTYIGSIL ++NPY  + G+YDK  +  Y   L+ ++PPH++ I    Y  + +  ++Q ++ISGESGAGKTES K +L + +  S G  +  Q S   ++++ T IL+S+P++E+FGNA+T+ N+NSSRFGK++++ F   G I G RI +YLLEK+R+V  NP ER +H+FY +L G  +  K          Y YL  S   +    +D  + ++ M+    +    E++   +++LS VL LGNI+F+     + +   + + +VS++L +D   L   LT ++     +   +PL  EQ+ + R++++  LYS+ F+WI+ K+N  +  N+                  NF+SI +LDI+GFENF  N  EQ  INYANE LQ++FN+++F LEQ EY +EGI W  I + DN   +DL+  K  G++ ++N+E   P+G+D + L K H  H  N  Y KP +    QF I H+AG + Y V GFLEKNRD  R ++LNV+    +  I  +F +       +T    AK R P V   F+ SL +L+A + T  P+F+RC+KPN  K A +F   +V++Q++Y+G+LETV+IR++G+P++  F  F SR+  LL  +E+      D +  C+ L+ +    KN  ++LG+TK+FL++   ++LEK      ++SA +I+    AY   +        A  +Q+  R    +RR  +L    + LQ   R  +AR R  RA
Sbjct:   56 SIEGVEDMSALADLHEGAIMHNLHLRFHDNKIYTYIGSILAAVNPYRLIDGLYDKAAVGRYAQNLLGELPPHIYAIANECYRCLWKRLDSQCVLISGESGAGKTESTKLILNFLSETSQGAGKAAQ-SGPTNTNVETAILESSPIMEAFGNAKTVYNNNSSRFGKFIQLHFSQQGFIQGGRILDYLLEKNRVVRQNPGERNFHVFYALLAGTTAEQKESLCLSEPNSYKYLAQSGCISDDACDDVKSFEKVMTAMQVMAFVKEEVREVLKLLSGVLQLGNIEFVTAG-GAQISNKDVVSVVSELLGLDSLQLSEVLTQRSMILRGEEISTPLTIEQAEDSRNSMAMALYSQCFSWIIQKINGRIKGND------------------NFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNREGIIWEDINWMDNGECLDLIEKKL-GMLALINEESRFPKGTDFTMLEKLHGQHATNQFYTKP-RVADHQFGIKHYAGEVLYDVRGFLEKNRDTFRDDLLNVLRESGIDFIYDLFERVSGGGGEETLKAGAKQRRPTVSSQFKDSLHSLMASLSTSNPFFVRCIKPNMKKLAQRFEHVVVLNQLRYSGMLETVRIRRAGYPVRRPFQDFYSRYKVLLGNREVP----DDPKGKCIALL-RVYDAKNAAWQLGRTKVFLRDTLEQNLEKLRDTELHKSATLIRAHVLAYLARKRFRRLRACAVAVQAWFRCRSCQRRFSRLRASAITLQKHRRSALAR-RLYRA 806          
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009024.1 (pep scaffold:Pmarinus_7.0:GL483156:63:16235:-1 gene:ENSPMAG00000008155.1 transcript:ENSPMAT00000009024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.121 bits (1141), Expect = 6.330e-138
Identity = 238/614 (38.76%), Postives = 362/614 (58.96%), Query Frame = 3
Query:  423 GESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKART--PAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQA----ACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQ 2234
            GESG+GKTE+ K +L + +           NS          IL++ P+LE+FGNA+T+RN+NSSRFGKY+++F + G I GS  + YLLE+SR+V     ER YH+FYE+L+GL    K +   +  + Y YLN      +  ++D  + +  +   + LGL+ E+     RIL+A+LHLGNI F    M+ QE + +     + I + +L+V    L+  +T K TET+++   SPL+ E S+  RDTL+K LY++LF WI+ ++N           +Q V             ++A+LDIYGFE+   NS EQLCINYANE LQ F N+ +F+ EQEEY ++ +SW  + + DNQP + L++ KP+GI+ IL+D+ + PQ SD SFL KCH  HG N+ Y KP K   P+F I H+AG ++Y V+ F+EKNR+ +R++++++        +A IF+ +R L    P  +       V   FQ SL  LL++M+ C    IRCLKPN+ KEA  F  ++V +Q++Y GILET++IRK+GFP+++ F  F+ R+     K IR A L +        CL ++   K      F +G +++F+KE     L+++
Sbjct:    1 GESGSGKTEAAKLILGFLS-------ATPSNSSCPQEHEGPSILEAIPVLEAFGNAKTLRNNNSSRFGKYLQVFVERGVISGSITSEYLLERSRVVYQAANERNYHVFYELLVGLPPQQKQRLGLQDAEMYYYLNQGGVCELPGKSDGRDFQR-LGALERLGLSLEERGALFRILAAILHLGNIYFARAEMDRQEVACVASGPEMRITADLLQVSFQKLQMSITYKLTETMREKIFSPLSVEASVKARDTLAKVLYTQLFAWIIARLNAKGAST-----QQGV-------------TLAILDIYGFEDLGVNSFEQLCINYANECLQSFINKIIFKQEQEEYVRDRLSWKEVPFCDNQPCLALIAQKPHGILHILDDQTAFPQASDHSFLQKCHYHHGGNELYSKP-KIPLPEFTIKHYAGRVTYQVSHFVEKNREHVRQDVMDLFLGSSCTLLAEIFQTRRHLAAAVPGPRGGPLGHTVSSAFQHSLQELLSRMEQCNTCLIRCLKPNSRKEAGSFEPELVRNQLRYLGILETIRIRKAGFPVRMPFDSFIRRW-----KCIRYAVLTESTGKGKNGCLSILNILKPEPEGLFRIGLSQVFMKEALYVRLDRE 582          
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000498.1 (pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.121 bits (1141), Expect = 7.356e-137
Identity = 244/675 (36.15%), Postives = 385/675 (57.04%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQK-LIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGN-ICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFM---EEQETSYL-VETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVH-GKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIF---------------RKKRELQTKN-----PTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKE 2090
            G +++T L  L + ++L NL++R+A+   IYTY G +L++INPY +L IY +  I +Y  + + DM PH+F + E  Y +M RD +NQ I++SGESGAGKT S K  ++YFA V G   E         ++I  ++L S P++E+ GNA+T RNDNSSRFGKY+EI F+    I G+ +  YLLEKSR+V     ER YH+FY++    +       + +  + + Y        I+D +D  +L+     +  LG+ +       +I++ +LHLGN++      EQET ++  E +++ I  ++L +++D + H L  +   T  +  + P+ + Q+ N RD L+KH+Y++LF+WIV ++N  L        R S    S          I +LDIYGFE F  NS EQ CINYANE LQQ FN +VF+LEQEEY +E I W  I + DNQP IDL+ AK  G++ +L++EC +P+GSD S+  K +  H G+  ++ KP+ ++   FII HFA  + Y   GFLEKNRD + +E +N+++  +   +   F               R++R     N        KAR+      F++SL  L+  +    P ++RC+KPN  K A  F+    + Q++  G+LET+++  +G+P +  +  F +R+ +L+ K+
Sbjct:    3 GENDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLPIYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASE---------ANIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQLCASAELPEFKDLHLEPAEAFVYTAQGGNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQDREQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKISTGAETYVKPMGRAQAQNARDALAKHVYAQLFSWIVHRINKAL--------RSSTKQHSF---------IGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAKL-GVLDLLDEECKMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNVA-FIICHFADKVEYQCDGFLEKNRDTVYEEQINILKASQSSLLTLAFVSRPPCLHPTGTPPPRRRRNSTEGNRHRSSARTKARSHVATFQFRNSLHLLMETLNATTPHYVRCIKPNDDKMAFTFDPKRAVQQLRACGVLETIRLSAAGYPSRWTYQEFFNRYRVLMRKK 649          
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 419.468 bits (1077), Expect = 4.579e-124
Identity = 252/757 (33.29%), Postives = 403/757 (53.24%), Query Frame = 3
Query:  150 IDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGI--VSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYP-DNQPIIDLLS--AKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKK-THPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGD---------------FQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVR 2354
            +++M  L  L++ S+L NL+ RY   LIYTY G   + +NPY  L IY ++ I  Y+ K   ++PPH++ + +T Y  M++D E+Q I+ +GESGAGKTE+ K++++Y A V+   K  K +      ++  ++L + P+LE+FGNA+T++NDNSSRFGK++ I FD  G I G+ I  YLLEKSR +     ER +HIFY++L G     K+    +G  +Y +L+N     I  + D  N +E  S  + +G T E+    +R++S+VLH GNI F +E+ T      +N     +  +L +        +     +  +D       KEQ+    + L+K  Y  LF W+V ++N  L++     +RQ          G++F  I +LDI GFE F  NS EQLCINY NE LQQ FN  +F LEQEEY++EGI W++I +  D QP I+L+   A P GI+ +L++EC  P+ +D SF  K     G +  ++KPK+      F + H+AG + Y    +L KN D L   +  ++       +A +++    +   + T    T    G                ++  LT L+A ++   P F+RC+ PN  K+A K    +V+DQ++  G+LE ++I + GFP +I+F  F  R+ +L    I K  + D + AC + MIK   +    + +G++K+F +     HLE++  +      +  Q   R Y   R    + Q  + ++ I R
Sbjct:   93 VEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVVNPYKNLPIYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHG--APGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLSGAGEHLKTDLLLEGYNNYRFLSNGN-VVIPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVVSSVLHYGNIVFKKERNTDQASMPDNTAAQKLCHLLGIAVTDFTRAILTPRIKVGRDYVQKAQTKEQADFAIEALAKATYERLFRWLVQRLNKALDR----TKRQ----------GASF--IGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFCEKLVQEQGTHPKFQKPKQLKDKADFSVIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKDVDRIVGLD-TVSGMTDTAFGSTYKTRKGMFRTVGQLYKEQLTKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPNAIPKGFM-DGKQACER-MIKGLELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIAFQATCRGYLARRAFGKRQQQLSALRVIQR 827          
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Match: myo1f (myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506])

HSP 1 Score: 419.083 bits (1076), Expect = 2.876e-123
Identity = 244/731 (33.38%), Postives = 409/731 (55.95%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVIS-GESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNIC-GSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTET---VKDASIS-PLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAK--PNGIIQILNDECSI----PQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRS----AVIIQRKWRAY 2291
            G+D+M  L ++++ +++ NL+ R     I+TYIG +LIS+NP+ ++  +  + I  YQ     + PPH++ + +  Y  M+ D+ENQ ++IS GESGAGKT + K ++ Y + VSGG  +V+   D         IL S PLLE+FGNA+T+RN+NSSRFGKY EI F  G    G  I+N+LLEKSR+V+ N  ER +HI+Y++L G     K          Y YLN +  + + D +D  + +E M+    +G+  ++  + ++I++ +LHLGNI FME+   + +   + +   + +L ++QD L   LT +T ++    K  SI+  LN EQ+   RD L+K L+S LF+++V ++N  + +      R+               +I +LDIYGFE F  N  EQ CIN+ NE LQQ F     + EQEEY +EGI W  I Y +N+ + DL+  K  P G++ IL+D C+      +G+D + L K     G ++++     T    F++HH+AG +SY V GF E+NRDVL  +++ ++++ +     ++F +  +++      K R        +     L+  +  C P +IRC+KPN TK    + +  V  Q++Y G+ E +++R++GF  + +F  FL R Y ++T E   A   D++   +  +++   ++   F++G++K+F+K   +  L   ++ +R+R     A  IQ+ WR +
Sbjct:   18 GVDDMVLLSKVTEDAIVENLKKRLMDDWIFTYIGPVLISVNPFKQMPYFTDREIDIYQGAAQFENPPHIYALSDFMYRNMLIDSENQCVIISSGESGAGKTVAAKYIMSYVSKVSGGGDKVQHVKDI--------ILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGNISNFLLEKSRVVSQNTEERNFHIYYQLLTGSSGTQKENLGISTPDYYFYLNQTGTYVVDDTDDNKDFQETMAAMQVIGILPDEQAMVLQIVAGILHLGNISFMEQGNYAAVESLDYLAFPAHLLGIEQDRLMEKLTSRTMDSKWGGKSESITVTLNTEQAAYTRDALAKALHSRLFDFLVQEINKAIRKE-----REEY-------------NIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIEYFNNKIVCDLIENKVNPPGVMSILDDVCATMHAKGEGADTTLLQKLQAGIGCHEHF----NTWNRGFVVHHYAGKVSYDVEGFCERNRDVLFPDLVELMQSSQYPFFYSLFPENLQVEK-----KGRPTTASSKIKKQANDLVNTLMRCTPHYIRCIKPNETKRPRDWEESRVRHQVEYLGLRENIRVRRAGFAYRRVFQKFLQR-YAILTAETWPAWRGDERQG-ITHILRAVNMEADQFQMGRSKVFIKAPESLFL---LEEMRDRKFDAFARTIQKAWRKF 708          
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 468.003 bits (1203), Expect = 2.318e-136
Identity = 284/775 (36.65%), Postives = 447/775 (57.68%), Query Frame = 3
Query:  144 QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELG-IYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETE-NIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGK---NDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVL------------RKEILNVIENCEVVEIATIFRKKRELQ---TKNP---TAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKE-----IRKASLKDQQAACLKLMIKFKGVKNKH-FELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRI 2378
            +  +++T+L  L++ ++L  ++ RY+Q  IYTY G +LI+ NP+  +  +Y +  I +Y  K   ++ PHLF I E  Y  M  D +NQ IV+SGESGAGKT S K +++YFA V        Q+  ++S +   +IL + P++E+FGNA+T RNDNSSRFGKY+EI FD + +I G+RI  YLLE+SR+V   P ER YHIFY+++ GL +  K + +     DY Y+N   +  I   +DA   K  +     +G+T E      +IL+A+LH+GNI+  + +  + L   E N+ +  ++L +D  +    +T K   T  +  +S LN  Q++  +D+++K +YS LF+W+V  +NT       ++   +V D+      S+F  I +LDIYGFE+F  NS EQ CINYANE LQQ FN++VF+LEQEEY KE I W +I + DNQP IDL+  K  GI+ +L++E  +P GSD S+  K +    K   N  + KP+     +FI+ H+A +++Y V GF+EKNRD +             + ++N++E  E         KK EL+   +K P       R P +   F+ SL  L+  + +    +IRC+KPN  KEA +F+  +V+ Q++  G+LET++I  +GFP +  F  F+ R+Y+L+  E      +K    ++    +  MI    VK+K  +++G TK+F K     +LEK      + S V+IQ+K RA +  +  +  +QA   +Q+ ++GFI R+R+
Sbjct:   70 EATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMS-ETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINT-------VLCNPAVNDQI-----SSF--IGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKL-GILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQ-TKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRV 827          
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 441.425 bits (1134), Expect = 2.711e-128
Identity = 283/812 (34.85%), Postives = 444/812 (54.68%), Query Frame = 3
Query:  144 QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELG-IYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLS-SDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF-MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGK---NDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRK---KRELQTKNPTAKART--------------PAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASL------KDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQN-QAATKIQSIVRGFIDRRRIR---KLHIGIVKLQAFVRMQIARKRFLRAHPEFTKL 2477
            +  D++T L  L++ ++L  ++ RY    IYTY G +LI+ NP+ ++  +Y ++ I +Y +K   ++ PHLF I E  Y  M+ +  NQ +V+SGESGAGKT S K +++YFA V    +E      ++  S I ++IL + P++E+FGNA+T RNDNSSRFGKY++I FD N  I GS+I  YLLEKSR+V     ER YHIFY++L GL    K + +    KDY Y N   +  I   ++A   K        +G+  E      +IL+ +LH+GNI+  M   + S   E +N+ I  ++L +D  +    +  K   T  +  ++ LN  Q++  RD+++K +YS LF+W+V  +N            +++ D  L      F  I +LDIYGFE+F  NS EQ CINYANE LQQ FN++VF+LEQEEY KE I W +I + DNQP IDL+  K  GI+ +L++E  +P GSD S+ +K ++   K   N+ + KP+     +FI+ H+A ++ Y V GF+EKNRD +    L+V +         IF++    REL++ +   +  T              P +   F+ SL  L+A + +    +IRC+KPN+ K+  +F+  +V+ Q++  G+LET++I  +GFP +  F  F+ R++LL    +    L      K+      + ++      +  +++G TK+F K      LEK      N   +IIQ+K RA +  RL  +Q  ++  K QS +R  + R R+    K    I+ LQ  +R    R+ +  A  +  KL
Sbjct:   71 ESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASV----QESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNIN------------KTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKL-GILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQ-TKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK----ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARY-YRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAIL-LQTNIRALWKREYYRAAIGQIIKL 858          
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 428.328 bits (1100), Expect = 2.603e-125
Identity = 272/755 (36.03%), Postives = 408/755 (54.04%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNG-NICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLV-ETENIGIVSKMLKVDQDSLKHCLT---MKTTETVKDASI--SPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAK-PNGIIQILNDECSIPQ----GSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGD-FQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKA---SLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKED---FARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVR 2354
            GI ++T L ++SD+S+  NL+ R+   +IYTYIG +LIS+NP+ +LGIY    + SY+ K   ++PPH+F I E+ Y  +   NENQ ++ISGESGAGKTE+ KR+++Y A  S    E           I   +L + PLLESFG A+T+RN+NSSR GKY+EI F++    C   ITNYLLEK R+V     ER +HIFY+   G     K  +  +  + Y Y   +   T    +D  + +  +    ++GL  E+ D   R+L+A+L +GNI F+E +E +  V +T     V+ +L+VD   L  CL    M+T+  +K  S+   PLN  Q+   RD L+K +Y+ LF+WIV +VN                  SL +     +SI +LDIYGFE F  NS EQ+CINY NE LQQ F +   + EQE Y++E I W  I Y DN+ + DL+ AK P GI+  +ND  +        +D +F  +  N+   N  +E        +F+I H+AG+++Y + G  +KN+D L+K+++ +I       ++TIF    +  +K      R P   GD    S   L+  +   +P +IR +KPN TK    ++   V+ Q+KY G+ E V+IR++GF  +  F  F+ RFYLL + +   A   +        +KL+++   +  K F+LG T +F+K     FA  LE          A  IQR WR + + R+      AA KIQ  +R
Sbjct:   37 GISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSES-------IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNV-----------------SLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL-NLFNSNPYFE----LRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVDKDSK------RRPPTAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLL-SPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFA--LEDMRDKYWYNMAARIQRAWRRFLQRRI-----DAAIKIQRTIR 748          
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 423.32 bits (1087), Expect = 4.028e-124
Identity = 267/755 (35.36%), Postives = 410/755 (54.30%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNG-NICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLV-ETENIGIVSKMLKVDQDSLKHCLT---MKTTETVKDASI--SPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSA-KPNGIIQILNDECSIPQ----GSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGD-FQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACL---KLMIKFKGVKNKHFELGKTKLFLKED---FARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVR 2354
            G+ ++T L ++SD+++  NL+ R+    IYTYIG +LIS+NP+ +LGIY    +  Y+ K   ++PPH+F I E+ Y  M   NENQ ++ISGESGAGKTE+ KR+++Y A  S    E           I   +L + PLLESFG A+T+RN+NSSR GKY+EI F+N    C   ITNYLLEK R+V+    ER +HIFY+   G     +  +  +  + Y Y   +   + +  +D  + +E +     +GL  E+ D   R+L+A+L +GN+ F+E +E +  V +T     V+ +L++D   L   L    M+T   +K  S+   PLN  Q+   RD L+K +Y+ LF+WIV++VN                 +SL +     +SI +LDIYGFE F  NS EQ+CINY NE LQQ F +   + EQE Y++E I W  I Y DN+ + DL+ A +P GI   +ND  +        +D +F  +  N+   N +++        +F+I H+AG+++Y + G  +KN+D L+K+++ +I       +ATIF    + ++K      R P   GD    S   L+  +   QP +IR +KPN TK    ++   V+ Q+KY G+ E V+IR++GF  + +F  F+ RFYLL +     A     Q   L   K +++   +  + ++LG T +F+K     FA  LE       +  A  IQR WR + + R+      AATKIQ  +R
Sbjct:   37 GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTES-------IGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVN-----------------KSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL-NLFTTNPHFD----LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDRESK------RRPPTAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLL-SPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFA--LEHMRDRYWHNMAARIQRAWRRFLQRRI-----DAATKIQRTIR 748          
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 412.149 bits (1058), Expect = 8.555e-117
Identity = 269/821 (32.76%), Postives = 439/821 (53.47%), Query Frame = 3
Query:  150 IDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNK------------LIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKE--VKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFF-DNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKG--IKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAY-PDNQPIIDLLSAK--PNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQ-FIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRE------LQTKNPTAKARTPAVMGDFQSSLT-------TLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKF----KGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPI 2498
            ++NM+ L  L++ S+L NL+ RY   LIYTY G  L++INPY  L +Y + +I  Y NK              + +PPH+F I E  Y  ++ + ++Q I+++GESGAGKTE+ K++L+Y A ++ G        +   +      +IL S P+LESFGNAQT+RN+NSSRFGK+++I F ++G I G+ I  YLLEKSRIV+ N +ER YHIFY++L GLD         K   +KDY  L+NS +  I   ND  N KE +S  + +G + + +    ++++ +L +GNI+F+ ++      + +   I S  L VD+   +  +    ++  K+      N +Q+    + LS++LY  LF +IV  +N  L+                 SA  N+  I +LDI GFE F +NS EQLCINY NE LQQFFN ++F LEQ EY KE I W YI Y  D Q  IDL+ +K  P G++ +L++E  +P+ +D SF +K   +   + N  K K++     FI+ H+AG++ Y+V G+L KN+D L   +L+++ + +   I+ +F+ + E      ++      + +  A    F+++ +       TLL ++ +  P F+RC+ PN  K+   FN+ +++DQ++  G+LE +++ + G+P +I F  F  R+ +L  +     +   +  A  K   +F      +  K +++G TKLF K      LEKQ  +  N   + +    R Y   + +    Q   K + I   F       +L+  +VK   +  + I  K  L +  + T+   +N+ I
Sbjct:   77 VENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVSDRAEQASFKNDVSAICSN-LGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHG---------------SATLNY--IGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKL--ISTWDQNSSKFKRSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRVIGNTF-------RLYNRLVKEDPWFNLFIRIKPLLTSSNDMTRTKKFNEQI 870          
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 525.398 bits (1352), Expect = 3.716e-163
Identity = 292/774 (37.73%), Postives = 454/774 (58.66%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKL-IQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFF-DNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF---MEEQ-ETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARK 2441
            S +G++NM  L +L +  +L NL IRY    IYTY+GS+L+++NPY    IY   YI  YQ  +   D+PPH++  GE ++  M R+  NQ +VISGESGAGKTES K +L+Y   VSG             S I  +ILD+ P+LE+FGNA+TIRNDNSSRFGKY+++ F D+  I G++I +YLLE+SRIV   P ER YHIFY +L G+    K   +    +DY YL+     T +  +DA           +L  T E+     R ++AVLHLGNI F   ME+  E   ++  E +   + +L+V ++ ++   T K+T    +   SP++ E++ + RD   K LYS++F WIV K+N+       I + +   D S        +SI +LDI+GFE F  NS EQLCINYANE LQQFF   +F+ EQEEY +EGI W+++ + DNQ ++D+L+ KP   I ++++E   PQG+D SFL+K +  H  N ++ +PK     QF + HFAG + Y   GFL+KNR+    +++++I + +      +F K+R + T+    + R+P +   F+ SL  L+  + +C+ +F+RC+KPN  K+ ++F++++   Q++Y+G+LETV+IRKSG+ ++  F  F++R+++LV   +R  S +D        +I    +  ++++LG  ++FLKE     LE+    + +   + +QR  R Y ++R      + A  IQS  RG+ +R+    +  G  +LQA  R   ARK
Sbjct:   62 SVEGVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSG-----------RHSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAKMEDNIEACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSS------IYKPRGKDDTS------GRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNHKDNKHFVRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSMGTE---TRKRSPTLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRDMSSRDASH-----LIATSLLGQENWKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQRAMRRYLRMRRARRTRKGAVLIQSRWRGYRNRKAFLAMKRGFARLQATFR---ARK 801          
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Match: EDO31924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK4])

HSP 1 Score: 514.227 bits (1323), Expect = 1.261e-161
Identity = 267/621 (43.00%), Postives = 387/621 (62.32%), Query Frame = 3
Query:  237 TYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIAT-RILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFME----EQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVI--ENCEV-VEIATI--FRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSR 2066
            TYIG IL+S+NPY +L  Y  + +  Y ++ I  +PPH+F IG   Y ++ +   +QVIVISGESGAGKTES K+L++Y A            ++     + T +I+++TPLLESFGNA+T++NDNSSRFGKY+EIFFD+ G+ICG+RI+ YLLE+SRIV    +ER YHIFYE+L GL    K Q   K  +++ YLN      I+ R D A   + +S  + L ++  + D     L+AVLHLG+  F +      + + L +     I + +L +D   L   L  K TE   +   SP N EQ+I+ RD ++K LYS +F W+V +VN                   ++  G    SIA+LDI+GFE+F  NS EQLCINYANE+LQ FFN+++F++EQ+EY  EGI WH + Y DNQ  +DL++  P+GI+ +L+DE + P+ +D+SFL KCH  H  +  Y KP K H P+F + HFAG ++Y V GFL+KNRD L++++ +++   N EV +EI ++   R+ R+   K P    +   V   F  SL  L+  MK C P+F+RC++PN  K   +F + +V+DQ++Y GILETVKIRK+GFPI+I++  F+ R
Sbjct:   36 TYIGKILLSVNPYKQLDSYTPELVEKYADQAIGRLPPHIFAIGSAAYAEIQKGGAHQVIVISGESGAGKTESTKQLVQYLA-----------TANPTKGSLTTEQIVEATPLLESFGNAKTVKNDNSSRFGKYLEIFFDSEGSICGARISEYLLERSRIVGQVRKERNYHIFYEMLAGLPQEKKQQLQLKSAEEHHYLNKGHGL-IQKRCDLAAFSKVISAMEILEISESERDGIFTTLAAVLHLGDAGFYKGLASAHDVAVLRDEHEAEITAHLLGLDAQHLIKALMHKQTEARGEQIFSPRNTEQAIDARDAIAKELYSRVFTWLVNRVN------------------GMVFHGKQRSSIAILDIFGFEDFRINSFEQLCINYANESLQFFFNQFIFKMEQDEYTIEGIPWHEVKYTDNQACLDLMAKPPHGILHLLSDESNFPKATDLSFLEKCHQYHKASKAYVKP-KMHVPEFAVSHFAGTVTYKVHGFLDKNRDGLKQDLTDLLCKTNSEVMMEIGSLKMPRENRKNSLKAPPNSIQKSTVCAKFNDSLIRLVVAMKRCNPFFVRCIRPNPDKAPDEFVEKLVLDQIRYCGILETVKIRKTGFPIRIVYPNFVKR 625          
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 485.337 bits (1248), Expect = 1.167e-144
Identity = 279/820 (34.02%), Postives = 451/820 (55.00%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQK-LIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETEN--IGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVH-GKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKART-----------PAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLV-TKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKL--HIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPV 2549
            G +++T L  L + ++L NL +R+ Q   IYTY G +L++INPY EL +Y    + +Y+ + + DM PH+F + E  +  M+RD  NQ +++SGESGAGKT S K  ++YF+ V G   E +         I  +++ + P++E+ GNA+TIRNDNSSRFGKY+EI FD N +I G+ +  YLLEKSR+V     ER YH+FY++    +      +      ++SYLN      +   +DA   +E       +G+  ++  +  RILSA+LHLGN++ ++  +    VE  +  + + + +L +D++ L+  L  +   TV +  I PL+  ++   R+ +SK +YS+LF W+V  +N                  +L S       I +LDIYGFE F  NS EQ CINYANE LQQ F ++VF+LEQ+EY +E I W +I + DNQP IDL+ AK  GI+ +L++EC +P+GSD  +  K +  H  K+ ++ KP+ ++   F+IHHFA ++ Y V+GF+EKNRD +  E L ++   E   +  +F +          A +R             +V   F  SL+ L+  + +  P ++RC+KPN TK   +F+    + Q++  G+LET++I  +G+P +  +  F +R+ +L+ +K+I +   ++     L+  IK + +    F++GKTK+F +     +LEK       RS V+IQ+ +R Y + +L +   +AA  IQ+ VRG   R   R L  +     +Q + R    R+ +LR H     +  Y + +  + Q    L   KA V
Sbjct:   56 GENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQ---------IEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINC-----------------TLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIEAKL-GILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLA-FVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSKKINRKKPRETIKLILETFIKDEDM----FQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFHLRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGV 843          
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 427.172 bits (1097), Expect = 3.436e-126
Identity = 267/786 (33.97%), Postives = 435/786 (55.34%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGL-DSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFME-----EQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIP-QGSDVSFLNKCHNVHGKNDNYEKPK-------KTHP-PQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKED---FARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF 2447
            G+ +M  L  L++ +++ NL  RY  K IYTYIG++++SINPY +  +Y ++ I  Y+++ I ++PPH++ I +  Y  M   N++Q I+I+GESG+GKTE+ K +++Y A V G  +EV +  +QL        L S P+LE+FGNA+T+RNDNSSRFGKY++I FD  G+  G  IT YLLEKSR+V  N  ER +HIFY +L G  D+        +    Y YLN S+  ++  ++D  +        + +G T +++    ++LSA+L+LGN +  E       E   ++  + +    +ML+ D + L + L  +T ET  +   +PLN  Q+   RD L+K +Y  LF WIV +VN     +++ VR++              + I +LDIYGFE F DNS EQ  INY NE LQQ F     + EQEEY +EGI W  I Y +N  I +L+    +GI+ +L++EC  P + SD++FL K       +++YE  K       KT P   F + H+AG ++Y V GFL+KN D+L + +   + +C       +F +     TK+   + +T A    F+ S+  L+  +K+  P +IRC+KPN  K A  F++ ++  Q++Y G++E +++R++GF  +  + V L R+ +L  +      L   +   ++L+ K   VK   +  G+TK+F++     FA  LE++ +      AVIIQ+ +R + + +      ++   I    R F D+R  R++    + + ++ R   ARK +
Sbjct:   22 GVSDMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDRVKEQL--------LQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVN-----DSIQVRKR-----------GKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEG--CPTKSSKRRPKTTATQ--FKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTW-PNWLGAPRDGIVELL-KHLNVKPTEYAYGRTKIFIRNPRTLFA--LEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFRDQRDYRRMRNAAILIASYARGWKARKAY 775          
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 410.994 bits (1055), Expect = 1.512e-124
Identity = 247/740 (33.38%), Postives = 408/740 (55.14%), Query Frame = 3
Query:  150 IDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQD--MPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSG-GFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGL--DSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASIS----PLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLL-SAKPNGIIQILNDECS----IPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKK----------RELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKE-DFARHLEKQVQIIRNRSAVIIQRKWRAY 2291
            + +M  + ++S+ S+ +NL+IR  Q+ IYT IG +LIS+NP+ ++ IY    +  Y  K   +   PPHL+ +    +  M+ + ++Q ++ISGESGAGKT S K ++ + + V G G  EV++  D         I+ S PLLE+FGNA+T+ N+NSSRFGK++EI +  +G   G +I+ +LLEKSR+V+    ER YHIFY++L G   D  ++ +      + Y YLN +  +TI+  +D ++    ++  + +G+ S   +  +++++ VLHLGNI+F EE   +  V+   +   S++L VD+D L   LT  + ET     +      LNK+Q++  RD L+K ++ +LF ++V  VN+      +  R Q                I +LDIYGFE+F  N  EQ  INY NE LQ  F  +  ++EQEEY +EGISW  I Y +N  ++ L+ S +P GI+ +L+D CS    + +GS  + ++K   V G N ++ K  +     F I H+AG +SY   GF EKN+D L  +++ ++++     +  +F             R+ ++   ++K RT A           L++K++ C P ++RC+KP  +K  L ++   V+ Q++Y G+ E +K+R++GF  +  F   + R+ LL    +RK    D  AAC  +++    +    +++GKTKLFLKE      LE+    I  + A+ IQ  +R Y
Sbjct:    5 VSDMIEIPDVSEASIANNLKIRLKQEEIYTNIGRVLISVNPFKKINIYGMDAVELYSGKKHNEGAKPPHLYEVANNMFENMLIEGDSQCVIISGESGAGKTVSAKHVMGFLSKVCGEGSTEVERVKDI--------IMQSNPLLEAFGNAKTVMNNNSSRFGKFMEIQYSRSGQPNGGKISTFLLEKSRVVSQGQGERNYHIFYQLLSGCTPDEMSELEIDLGPAESYKYLNQTGVYTIEGTDDVSDYAATINAMEVIGIASSTRNTVLKLVATVLHLGNIQFTEEDNQAVPVDVSMLDAPSRLLSVDKDILLDKLTSYSMETRWGGKVEVTKKTLNKDQAVIARDALAKAIFFQLFEYLVEAVNS-----TMATRDQDFY-------------IGVLDIYGFESFKVNGFEQFSINYVNEKLQNLFIDFTLKMEQEEYAEEGISWSDIDYFNNDVVLQLIESRRPPGIMGVLDDVCSTLHAVSEGSANTLMDKLRGVIGSNSSFAKYFQAQARHFAITHYAGKVSYESEGFCEKNKDTLSNDLVCLMQSSTEPFVRDMFPDSLYGASAGVGGRKAKSNTGSSKIRTQA---------HALVSKIRMCTPHYVRCVKPTESKIPLDWDDKKVLHQVRYLGLAENIKVRRAGFAFRREFPRIVERYSLLDPITVRKHQ-SDPVAACKAILLA-GNLDMTKYQVGKTKLFLKEPQMINQLEEARNAIITKYALTIQTVYRGY 707          
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 538.495 bits (1386), Expect = 1.122e-162
Identity = 294/801 (36.70%), Postives = 465/801 (58.05%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLK-DQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDF----------------------ARHLEKQVQIIRNRSAV-IIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLR 2453
            S  G+ +M  L +L++  +L NL IRY + +IYTY GSIL+++NPY  L IY   +I  Y NK I +MPPH+F I +  Y  M R+N++Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++TP+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+    P ER YH+FY +L G+    K++       DYSYL          RND       +S    L  T  ++    ++L+A+LH+GN++F     +  +   +V + ++   + +++V+   +  CLT +T  T  ++  +PL+  Q ++ RD   K +Y  LF WIV K+N         + R    + SL+      RS+ +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQ+EY  E ISW +I + DNQ  +D+++ KP  II ++++E   P+G+D + L K ++ H  N NY  PK ++  QF I HFAG + Y   GFLEKNRD L  +I+ ++ +     I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++++ + Q++Y+G++ET++IR++G+PI+  F+ F+ R+ +L+   I+ + L+ D +  C +++    G K++ +++GKTK+FLK+                         R L+ +   +R RSAV ++Q+ WR Y   +   I      ++Q++ R     R  RK  + +  LQA  R  + R+ F R
Sbjct:   68 SIHGVQDMIRLGDLNEAGILRNLLIRYNEHVIYTYTGSILVAVNPYQLLPIYTADHIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLKGMAPEMKAKLGLGLATDYSYLTMGNCTECDGRNDLREYSSILSAMKVLMFTETEIWEISKLLAAILHMGNLRFEARTYDNLDACVVVRSPDLVTAASLMEVEPKDVMVCLTTRTLITRGESVTTPLSMNQGLDVRDAFVKGIYGRLFVWIVDKINAA-------IYRPPSCESSLIR-----RSMGLLDIFGFENFFVNSFEQLCINFANENLQQFFVRHVFKLEQKEYNLEDISWQHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDATMLYKLNSQHKLNCNYIPPKNSYETQFGIQHFAGVVHYESRGFLEKNRDSLHTDIIQLVHSSRNKFIKQIFQADVAMGVET---RKRSPTLSSQFKRSLEMLMRTLSVCQPFFVRCIKPNELKKPMLFDRELCIRQLRYSGMMETIRIRRAGYPIRYSFAEFVDRYRVLMPG-IKPSHLQEDLRGTCQQILTARLG-KHEDWQIGKTKIFLKDQHDMQLEIDRDKAITNKVILIQKSVRGLQARKNFLRLRSAVTVLQKAWRGYQCRKKYRIMKTGFLRLQAVCRSRKYYRSYRKTRLRVTLLQARCRGFLVRQAFAR 840          
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Match: ENSORLT00000002420.2 (myosin VIIA [Source:NCBI gene;Acc:101165746])

HSP 1 Score: 540.036 bits (1390), Expect = 5.534e-156
Identity = 304/830 (36.63%), Postives = 465/830 (56.02%), Query Frame = 3
Query:  138 SDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDN-GNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF----MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLE---------------KQVQIIRNR--------SAVIIQRKWRAYW-------------KIRLVI----------IQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTK 2474
            S  G+++M  L +L++  +L NL IRY +KLIYTY GSIL+++NPY  L IY    I  Y NK I +MPPH+F I +  Y  M R+N +Q  +ISGESGAGKTES K +L++ A +SG    ++Q           ++L++ P+LE+FGNA+TIRNDNSSRFGKY++I F+  G I G++I  YLLEKSR+      ER YHIFY +L G+ +  K +       DY+YL   K      R+D        S    L  T  +     ++L+A+LH+GN+++     +  +   +V + ++   S +L+VD   L +CLT +T  T  +   +PL+ EQ+++ RD   K +Y  LF WIV K+N  + +             S   AG   R I +LDI+GFENF  NS EQLCIN+ANE LQQFF R+VF+LEQEEY  E I+W +I + DNQ  +D+++ KP  II ++++E   P+G+D + LNK +  H  N NY  PK  H  QF I HFAG + Y   GFLEKNRD L  +I+ ++ + +   I  IF+    +  +    + R+P +   F+ SL  L+  +  CQP+F+RC+KPN  K+ + F++++ + Q++Y+G++ET++IR++G+PI+  F  F+ R+ +L+         +D +  C K+     G ++  +++GKTK+FLK+     LE               K V+  ++R        SAV IQ+ WR Y              +++ ++          +  Q  T  Q   RG++ RR  R     ++ +QA+ R  IAR+ F R   E+ +
Sbjct:  107 SIHGVEDMIRLGDLNEAGILRNLLIRYREKLIYTYTGSILVAVNPYQLLPIYTADQIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNRDQCCIISGESGAGKTESTKLILQFLAAISGQHSWIEQ-----------QVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAHDERNYHIFYCMLKGMTAEEKKKLGLSKATDYTYLTIGKCTVCDGRDDLKEYSNIRSAMKVLMFTDRENWEISKLLAAILHMGNLQYEARTYDNLDACEVVRSPHLTTASALLEVDFKDLMNCLTSRTLITRGETVSTPLSIEQALDVRDAFVKGIYGRLFVWIVEKINAAIYKP----------PSSQPKAGR--RCIGLLDIFGFENFVVNSFEQLCINFANENLQQFFVRHVFKLEQEEYNLENINWQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNFQHKLNTNYIPPKNNHETQFGIQHFAGVVYYETKGFLEKNRDTLYGDIIQLVHSSKNKFIKQIFQADVAMGAE---TRKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQKIAEAVLG-RDDDWQMGKTKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGYKDRSNFLKMRKSAVFIQKTWRGYHCRKNYGAVRTGFSRLQALVRSRKLCASYHVARQRITVFQGRCRGYLVRRAFRHRLWAVITIQAYTRGMIARRLFRRLKGEYRR 909          
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Match: si:ch73-194h10.2 (unconventional myosin-VIIb [Source:NCBI gene;Acc:101163405])

HSP 1 Score: 522.702 bits (1345), Expect = 6.486e-151
Identity = 295/796 (37.06%), Postives = 459/796 (57.66%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYAQKLIY-TYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF---MEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKK--------------------RELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVR-----MQIARKR 2444
            G+D+M  L +L+++ LL NL +R+ +  IY TY GSIL+++NPY  L IY   ++  Y ++ + ++PPH+F I ++ +  M R+ +NQ  VI GESGAGKTES K +L+Y A VSG    ++Q           +IL++ P+LE FGNA+TIRNDNSSRFGKY+++ F+ +G I G+RI  YLLEKSR++   P ER YHIFY +L+G+ +  K         DY YL      + + R+D      F S    L  +  D     ++L+A+LHLGN++F   +   E   L +  +  + S++L+VD  +L+  LT ++  T+K+     L + Q+++ RD   K LY +LF W+V K+N+        V + +  D+ L       +SI +LDI+GFENF  N  EQLCIN+ANE LQQFF ++VF+LEQ+EY +E I W +I Y DNQ  +D+L++K   ++ ++++E + P+G+D + L K +  H K + Y +PK  H   F I HFAG + Y  + FLEKNRD    +++ V+E      +   F+ +                     +  T     K R P ++G F+ SL +L+  +  CQP+FIRC+KPN  K  + F++D+ M Q++Y+G++ET+KIRK+G+P++  F  FL R+ +L+   I      + +  C + + K    ++K ++ GKTK+FLK+     LE +  I  N  A++IQR  R Y K R  + +  AA  +Q   RG   R+  + + +G  +LQA VR     +Q  RKR
Sbjct:   56 GVDDMIMLGDLNEEGLLRNLLVRHKEGKIYQTYTGSILVAVNPYQLLPIYTTDHVHMYTDQRLGELPPHVFAIADSCFFNMRRNRKNQCCVI-GESGAGKTESTKLMLQYLAAVSGQHSWIEQ-----------QILEANPILE-FGNAKTIRNDNSSRFGKYIDVNFNKSGAIEGARIEQYLLEKSRVIRQAPEERNYHIFYYMLMGMSADQKKILSLGTAADYKYLTMGNCTSCEGRDDVKEFAHFRSALKILTFSEADSWEIFKLLAAILHLGNVEFETIVSNMEGCELCKCSHFNMASQLLEVDPKALETSLTQRSVSTIKETVSKFLTRAQAVDGRDAFVKALYGKLFIWVVNKINSA-------VYKTAEEDKDLQ------QSIGLLDIFGFENFTKN-FEQLCINFANEQLQQFFVKHVFKLEQDEYSRENIVWKHIEYQDNQKTLDVLASKTMNMLALIDEESNFPKGTDTTLLQKMNQFHEKGNVYIRPKNVHETVFGIRHFAGEVYYD-SQFLEKNRDAFSSDMIQVVEASTNKLLRQTFQNELSSSSKTIKSSSNPRMVITMSKSSTNKTPEKKRVPTLIGQFRQSLDSLMKTLSACQPYFIRCIKPNDFKRPMLFDRDLCMRQLRYSGMMETIKIRKAGYPVRYTFKEFLDRYRVLLKTSICNP---ESEEKCCETICKSVLKEDKDWKTGKTKIFLKDIHDTKLEVERMIELNTKALLIQRVLRGY-KYREFLKKRSAAIVLQKNWRGHKGRKLFKMVQLGFARLQAQVRSRHLHLQYKRKR 819          
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 463.766 bits (1192), Expect = 7.270e-133
Identity = 280/789 (35.49%), Postives = 431/789 (54.63%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYA-QKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNG-NICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIV--SKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGK-NDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMG------------DFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKH-FELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHI--GIVKLQAFVRMQIARKRFLR 2453
            G +++T L  L + ++L NL++R+   KLIYTY G +L++INPY  L IY+   I +Y  + + DM PH+F + E  Y +M RD  NQ I+ISGESGAGKT S K  ++YFA VS    E         +++  R+L S+P++E+FGNA+T RNDNSSRFGKY+EI FD    I G+ +  YLLEKSR+V     ER YHIFY++           +      D+      +   I   NDA  L      +  LG+  ED     +ILSA+LHL N++  ++      +  +++ ++   +++ V  +   H L  +  +T K++ + P+ +  ++  RD L+KH+Y+ LF+WIV  VN  L                  S G     I +LDIYGFE F  NS EQ CINYANE LQQ FN +VF+L+QEEY +EGI W  I + DNQP I+L+ AK  G++ +L++EC +P+GSD ++  K +N+  K N ++EKP+ ++   FIIHHFA  + Y   GFLEKN+D + +E +N ++  +   +  +F  + +  T +P     TP   G             F+ SL  L+  + +  P ++RC+KPN  K     +    + Q++  G+LET++I  +GFP +  +  F +R+ +L+ +   K  L D++  C  L+ K   +KN+  ++ GK K+F +     +LEK        + V IQ+  R +   R  +   ++   IQ   RG   RR +  L      V +Q  VRM + RKR+L+
Sbjct:   80 GENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYESLPIYEPDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDQRNQSIIISGESGAGKTVSAKYAMRYFATVSCSSGE---------ANVEERVLASSPIMEAFGNAKTTRNDNSSRFGKYIEIGFDKKYCIIGANMRTYLLEKSRVVFQAHGERNYHIFYQLCASSHLPEFKTFKLGCADDFHCTKQGQSPIIDGVNDAKELCSTRRAFSLLGMEEEDQMEIYQILSALLHLSNVEIKDQSGDRSSISPDDVHMMVFCELMGVPCEETAHWLCHRKLKTSKESFVKPVPRVNAVQGRDALAKHIYARLFSWIVGCVNGALK-----------------STGKQNSFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLDQEEYMREGIPWTLIDFYDNQPCINLIEAKL-GVLDLLDEECKMPKGSDDTWTQKLYNILLKQNSHFEKPRLSNRA-FIIHHFADKVEYQCLGFLEKNKDTVNEEQINALKKTKFDFLLKLF-DEDDKGTGSPN--KLTPGRAGQSQRDNKKTVGLQFRQSLHLLMETLNSTTPHYVRCIKPNDLKAPFVLDPVRAVQQLRACGVLETIRISAAGFPSRWSYPEFFTRYRVLMKQ---KDVLPDRKQTCKDLLEKL--IKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQ 832          
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 463.766 bits (1192), Expect = 8.171e-133
Identity = 280/789 (35.49%), Postives = 431/789 (54.63%), Query Frame = 3
Query:  147 GIDNMTNLVELSDQSLLSNLQIRYA-QKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNG-NICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIV--SKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGK-NDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMG------------DFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKH-FELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHI--GIVKLQAFVRMQIARKRFLR 2453
            G +++T L  L + ++L NL++R+   KLIYTY G +L++INPY  L IY+   I +Y  + + DM PH+F + E  Y +M RD  NQ I+ISGESGAGKT S K  ++YFA VS    E         +++  R+L S+P++E+FGNA+T RNDNSSRFGKY+EI FD    I G+ +  YLLEKSR+V     ER YHIFY++           +      D+      +   I   NDA  L      +  LG+  ED     +ILSA+LHL N++  ++      +  +++ ++   +++ V  +   H L  +  +T K++ + P+ +  ++  RD L+KH+Y+ LF+WIV  VN  L                  S G     I +LDIYGFE F  NS EQ CINYANE LQQ FN +VF+L+QEEY +EGI W  I + DNQP I+L+ AK  G++ +L++EC +P+GSD ++  K +N+  K N ++EKP+ ++   FIIHHFA  + Y   GFLEKN+D + +E +N ++  +   +  +F  + +  T +P     TP   G             F+ SL  L+  + +  P ++RC+KPN  K     +    + Q++  G+LET++I  +GFP +  +  F +R+ +L+ +   K  L D++  C  L+ K   +KN+  ++ GK K+F +     +LEK        + V IQ+  R +   R  +   ++   IQ   RG   RR +  L      V +Q  VRM + RKR+L+
Sbjct:   80 GENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYESLPIYEPDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDQRNQSIIISGESGAGKTVSAKYAMRYFATVSCSSGE---------ANVEERVLASSPIMEAFGNAKTTRNDNSSRFGKYIEIGFDKKYCIIGANMRTYLLEKSRVVFQAHGERNYHIFYQLCASSHLPEFKTFKLGCADDFHCTKQGQSPIIDGVNDAKELCSTRRAFSLLGMEEEDQMEIYQILSALLHLSNVEIKDQSGDRSSISPDDVHMMVFCELMGVPCEETAHWLCHRKLKTSKESFVKPVPRVNAVQGRDALAKHIYARLFSWIVGCVNGALK-----------------STGKQNSFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLDQEEYMREGIPWTLIDFYDNQPCINLIEAKL-GVLDLLDEECKMPKGSDDTWTQKLYNILLKQNSHFEKPRLSNRA-FIIHHFADKVEYQCLGFLEKNKDTVNEEQINALKKTKFDFLLKLF-DEDDKGTGSPN--KLTPGRAGQSQRDNKKTVGLQFRQSLHLLMETLNSTTPHYVRCIKPNDLKAPFVLDPVRAVQQLRACGVLETIRISAAGFPSRWSYPEFFTRYRVLMKQ---KDVLPDRKQTCKDLLEKL--IKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQ 832          
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Match: SMESG000061386.1 (SMESG000061386.1)

HSP 1 Score: 4811.51 bits (12479), Expect = 0.000e+0
Identity = 2484/2497 (99.48%), Postives = 2488/2497 (99.64%), Query Frame = 3
Query:  123 GKLHLSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPXXXXXXXXXXXIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWSEITGQLLEQNFLMSKRSRLNGDPVDIASRGFIKNVSRPQGLTSNKGPSTVNSLHSMDTWVEQVFESSFRNEDDGNSAVQDFIHGLEDELKAKGQNHYSSNPTLAANFAHSLNVHNSNPNLAFGGHGNLHYSTDYLMHQHAPNNSSMYFSAAPPQNDFDMLQDPTYLQEQLNSVQLENKVIQSSIEREILQSRLXXXXXXXXXXXPVLNPNVXXXXXXXXXXXXXXXTNYPIVQPTNRFPMXXXXXXXXXXXXFVHSEQFSNSPASGPSFHQSNPLSNSQPYIHMDNNQITRDQSKSLDQNDSTTIXXXXXXXXXXXXTNSKTIDLQNIKLKKTTISVXXXXXXXXXXXXVLNGHTPNNDSEERTQSGGKIVPKRRTSIVKYSEVGKPSTTVVDDKDVLPGEKLQEDKKSYMRAAEVPKVNVTNRAAFLENFFKEKPPPGVDPTVQGRKRKAPALPVEETKFPENQVNAINLLASMNSSKKILPRPSMSGDKLLEXXXXXXXXXXXXXXXSISNEKDEIMFETQLPRTNLNNAKTEIVPVPLPRNLSHNGKSGIPITLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINLTSNLDIKKRTRGLLKEAVPFTDSGTMMLGVNNERIQFTSHSITNNIYKNTDKPINTDKVYDKVKKQGNLIDFTVNFSKYKDRQHVSNVILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDWLVPSKNQSVDSNELSVISKIAYYNMRGQGQTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLESTEKQTLGTNEFQKLFLEYCERLPRFGLIKCQITDVKPLSKPGQYXXXXXXXXXXXXENESQEPIINFLISEFSSFQVSIENSTKSHFIIRYKNKEEIQFDSIHGEKLKFLFIQYEMTKKLRLIDK 7613
            GKLHLSDQ IDNMTNLVELSDQSLLSNLQ+RYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYI+YPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASL DQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPKKTKRNKKKTTIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWSEITGQLLEQNFLMSKRSRLNGDPVDIASRGFIKNVSRPQGLTSNKGPSTVNSLHSMDTWVEQVFESSFRNEDDGNSAVQDFIHGLEDELKAKGQNHYSSNPTLAANFAHSLNVHNSNPNLAFGGHGNLHYSTDYLMHQHAPNNSSMYF AAPPQNDFDMLQDPTYLQEQLNSVQLENKVIQSSIEREILQSRLQKIKQQKYYQQPVLNPNVPMQYQQQYMPHQAPMTNYPIVQPTNRFPMYPHYHQQQYPYQFVHSEQFSNSPASGPSFHQSNPLSNSQPYIHMDNNQITRDQSKSLDQNDSTTIPQKPPKKEPVQQTNSKTIDLQNIKLKKTTISVPAPP PPPPPPPVLNGHTPNNDS ERTQSGGKIVPKRRTSIVKYSEVGKPSTTVVDDKDVLPGEKLQEDKKSYMRAAEVPKVNVTNRAAFLENFFKEKPPPGVDPTVQGRKRKAPALPVEETKFPENQ NAINLLASMNSSKKILPRPSMSGDKLLELKTKQVKLPKPKPQVSISNEKDEIMFETQLPRTNLNN KTEIVPVPLPRNLSHNGKSGIPITLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINLTSNLDIKKRTRGLLKEAVPFTDSGTMMLGVNNERIQFTSHSITNNIYKNTDKPINTDKVYDKVKKQGNLIDFTVNFSKYKDRQHVSNVILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDWLVPSKNQSVDSNELSVISKIAYYNMRGQGQTKLKNDDSLKSLLPSKLLDQKKKTISKK IMKIMNLESTEKQTLGTNEFQKLFLEYCERLPRFGLIKCQITDVKPLSKPGQYFV+FSSHSISIVENESQEPIINFLISEFSSFQVSIENSTKSHFIIRY+NKEEIQFDSIHGEKLKFLFIQYEM KKLRLIDK
Sbjct:    5 GKLHLSDQRIDNMTNLVELSDQSLLSNLQVRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYISYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLTDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKGQDNSKLTVYKAPVSEIPKKTKRNKKKTTIGNAFNYDLLKIPIELAFLLDKTEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDFGNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFHKFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLTRAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSGHPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLASHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWSEITGQLLEQNFLMSKRSRLNGDPVDIASRGFIKNVSRPQGLTSNKGPSTVNSLHSMDTWVEQVFESSFRNEDDGNSAVQDFIHGLEDELKAKGQNHYSSNPTLAANFAHSLNVHNSNPNLAFGGHGNLHYSTDYLMHQHAPNNSSMYFPAAPPQNDFDMLQDPTYLQEQLNSVQLENKVIQSSIEREILQSRLQKIKQQKYYQQPVLNPNVPMQYQQQYMPHQAPMTNYPIVQPTNRFPMYPHYHQQQYPYQFVHSEQFSNSPASGPSFHQSNPLSNSQPYIHMDNNQITRDQSKSLDQNDSTTIPQKPPKKEPVQQTNSKTIDLQNIKLKKTTISVPAPPEPPPPPPPVLNGHTPNNDSGERTQSGGKIVPKRRTSIVKYSEVGKPSTTVVDDKDVLPGEKLQEDKKSYMRAAEVPKVNVTNRAAFLENFFKEKPPPGVDPTVQGRKRKAPALPVEETKFPENQANAINLLASMNSSKKILPRPSMSGDKLLELKTKQVKLPKPKPQVSISNEKDEIMFETQLPRTNLNNVKTEIVPVPLPRNLSHNGKSGIPITLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNEIQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSILAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGVRFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRKKFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINLTSNLDIKKRTRGLLKEAVPFTDSGTMMLGVNNERIQFTSHSITNNIYKNTDKPINTDKVYDKVKKQGNLIDFTVNFSKYKDRQHVSNVILRWQQDPMREAILQSSNNGIIRQAIEIHNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQINGNPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLAAFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQFNIPFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLFNNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLSKSILDEDWLVPSKNQSVDSNELSVISKIAYYNMRGQGQTKLKNDDSLKSLLPSKLLDQKKKTISKKRIMKIMNLESTEKQTLGTNEFQKLFLEYCERLPRFGLIKCQITDVKPLSKPGQYFVIFSSHSISIVENESQEPIINFLISEFSSFQVSIENSTKSHFIIRYQNKEEIQFDSIHGEKLKFLFIQYEMIKKLRLIDK 2501          
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 541.962 bits (1395), Expect = 7.390e-157
Identity = 308/781 (39.44%), Postives = 462/781 (59.15%), Query Frame = 3
Query:  129 LHLSD-QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF---MEEQETSYLVETEN-IGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSN--FRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF 2447
            +H+S  QG+D+M +L +L++  +L NL IRY +  IYTY G IL+++NPY  L IY  K I +Y+N  I D+ PH+F I +  Y  M R + +Q I+ISGESGAGKTES K +L++ A VSG    ++Q           ++LDS P+LE+FGNA+TIRNDNSSRFGKY++I+F  NG I G++I  +LLEKSRIV+    ER YH+FY +L GL    +S++  +    Y+YLN      +    D  +     S    L  T ++     ++L+A LHLGNI F   +E    S  V  ++     SK+L++D + L+  LT K   T  D  ++ ++  Q IN RD L K +Y  LF WIV K+NT + + +L     S V +S L+A SN  + SI +LDI+GFENF +NS EQLCINYANE LQQFF R++F++EQEEY  E I W +I++ DNQ  +DL+  K   I+ ++++E   P+G+D S LNK  N   K+  + K K      F I HFAG + Y + GFLEKNRD    +++ +I+  +   +  +F K  ++       + R P +   F+ SL +L+  +   +P+F+RC+KPN  K+ L F++ + + Q++Y+G++ET++IRK+G+PI+  F  F+ R+ +LV         KD +    KL+ K   +  K +++GKTKLFLK+     LE       +   ++IQ+ WR Y+     + +  AA KIQ+ VR  + RR+  K+  G   LQA  R ++A K+ 
Sbjct:   59 MHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQ-----------QVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSL-----SQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFD---TRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETT-KLVCK-NILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFLKMKKGFCLLQASFRAKVASKKL 818          
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 541.576 bits (1394), Expect = 1.053e-156
Identity = 308/781 (39.44%), Postives = 462/781 (59.15%), Query Frame = 3
Query:  129 LHLSD-QGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKF---MEEQETSYLVETEN-IGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSN--FRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGFIDRRRIRKLHIGIVKLQAFVRMQIARKRF 2447
            +H+S  QG+D+M +L +L++  +L NL IRY +  IYTY G IL+++NPY  L IY  K I +Y+N  I D+ PH+F I +  Y  M R + +Q I+ISGESGAGKTES K +L++ A VSG    ++Q           ++LDS P+LE+FGNA+TIRNDNSSRFGKY++I+F  NG I G++I  +LLEKSRIV+    ER YH+FY +L GL    +S++  +    Y+YLN      +    D  +     S    L  T ++     ++L+A LHLGNI F   +E    S  V  ++     SK+L++D + L+  LT K   T  D  ++ ++  Q IN RD L K +Y  LF WIV K+NT + + +L     S V +S L+A SN  + SI +LDI+GFENF +NS EQLCINYANE LQQFF R++F++EQEEY  E I W +I++ DNQ  +DL+  K   I+ ++++E   P+G+D S LNK  N   K+  + K K      F I HFAG + Y + GFLEKNRD    +++ +I+  +   +  +F K  ++       + R P +   F+ SL +L+  +   +P+F+RC+KPN  K+ L F++ + + Q++Y+G++ET++IRK+G+PI+  F  F+ R+ +LV         KD +    KL+ K   +  K +++GKTKLFLK+     LE       +   ++IQ+ WR Y+     + +  AA KIQ+ VR  + RR+  K+  G   LQA  R ++A K+ 
Sbjct:   59 MHVSSLQGVDDMISLGDLNEAGILRNLLIRYKRNEIYTYTGRILVAVNPYAVLPIYTPKEIKNYKNCKIGDLSPHIFAIADNAYNNMRRVSRDQSIIISGESGAGKTESTKLILQFLAAVSGQHSWIEQ-----------QVLDSNPILEAFGNAKTIRNDNSSRFGKYIDIYFGVNGAIEGAKIDQFLLEKSRIVSQMRDERNYHVFYCMLEGLPIETRSRFGLRASDHYAYLNQGGRIDLTGTTDIVDFPTLHSAMKVLTFTEDECQEIFQLLAAFLHLGNINFKAKLERNMDSCEVSMDSEFNFASKLLQLDSEDLRKALTTKNIITRDDFVVTNVSIAQGINIRDALVKGIYGRLFVWIVEKINTAIYRPSL-----SQVPKSALNAKSNSKYTSIGVLDIFGFENFDNNSFEQLCINYANENLQQFFVRHIFKMEQEEYAAELIDWQHISFTDNQETLDLIGVKNCNILALIDEESRFPKGTDHSLLNKLVNTCSKHPRFIKQKADIVKIFGIEHFAGVVHYQIDGFLEKNRDFFNADLMELIQTTKSQFLKILFEKDFKMGFD---TRKRAPTLGMQFRKSLDSLMKILMEREPFFVRCIKPNEFKKKLDFDRSLCLRQLRYSGMMETIRIRKAGYPIRHEFPDFIDRYRILVPGIPSSFRCKDTRETT-KLVCK-NILDPKGYQIGKTKLFLKDAQDILLEDLRDKALSNRIILIQKTWRKYYHRTQFLKKKSAAIKIQTFVRMKLTRRKFLKMKKGFCLLQASFRAKVASKKL 818          
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Match: SMESG000068232.1 (SMESG000068232.1)

HSP 1 Score: 420.624 bits (1080), Expect = 2.304e-123
Identity = 257/739 (34.78%), Postives = 403/739 (54.53%), Query Frame = 3
Query:  153 DNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETV----KDASISPL-NKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYPDNQPIIDLLSAK-PNGIIQILNDECS----IPQGSDVSFLNKCHNVHGKNDNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATK 2336
            D++  L ++S  S+  NL+ R+    IYTYIG++LI++NP+ +L I+ +K I  YQ     + PPH++ I +  +  MM D E+Q ++ISGESGAGKT S K +++Y + VSGG   V+Q        I   IL+S PLLE+FGNA+T+RN+NSSRFGKYVEI FD  G   G +I+ +LLEKSR+V  N  ER +HIFY+++ G +   +  +       YSYLN S  + + D +D +  K  M   + +GL  ++    + I++AVLHLGN+ F+E Q+ +   +  ++     +L +++  L     M + E      K+ +I  L N++Q+   RD LSK LYS +F++IV K+N  +  N         +D           +I +LDIYGFE F  N  EQ CINY NE LQQ F     + EQ+EY +EG+ W  + Y +N+ + DL+  K P G+  IL+D C+    +    D  F+ K    +   D+Y     +H   F I H+AG +SY   GF E+NRD L  +++ +++      I  +F +       +   K  T  V    +     L+ K+  CQP +IRC+KPN TK+A  +  D V+DQ+ Y G+ E + +R++G+  +  F  F+ R Y +++KE       D +     LM K   + +  +++GKTKLF+K+  +  L ++ +          +RK+  Y K+  +  +   ATK
Sbjct:   15 DDLVLLPKISQDSITENLKKRFMDDCIYTYIGNVLIAVNPFKKLSIFTQKEIGMYQGAATYENPPHIYAIADNMFRNMMIDYESQCVIISGESGAGKTVSAKFIMEYISKVSGGAGRVEQ--------IKEIILESNPLLEAFGNAKTVRNNNSSRFGKYVEIQFDRGGEPIGGKISQFLLEKSRVVLQNQNERNFHIFYQLIEGCEKDIREMFGITTPDYYSYLNQSGVYKVDDTDDKSEFKNTMHAMEVMGLEKDEQLSILSIVAAVLHLGNVLFIEGQQQAEFKDKRSLQFPCYLLGLEESEL--ATKMASREMADRMNKEQNIVILFNRQQAFQARDALSKALYSRMFDYIVDKINVAMAIN---------IDD---------MNIGILDIYGFEIFVKNGFEQFCINYVNEKLQQIFIELTLKAEQDEYVQEGVQWTPVNYFNNKVVCDLIELKNPPGVFSILDDVCATAFKVTDSIDNKFVAKMDGSNLNKDHYS----SHSTGFTIFHYAGKVSYECEGFCERNRDQLSVDVIEMMQKSTNPFIVDLFPE----NVTDLKNKRSTLTVGSRIRKQANDLVVKLTKCQPHYIRCIKPNETKKARDWENDRVVDQVTYLGLRENIIVRRAGYAYRRPFEKFMQR-YAILSKETWPKWTGDVKKGIQHLM-KTADINDGQWQIGKTKLFIKDPESLFLLEERR----------ERKFNHYAKVIQIFFRQVNATK 705          
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.557e-121
Identity = 245/707 (34.65%), Postives = 389/707 (55.02%), Query Frame = 3
Query:  150 IDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILISINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQVIVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDSTPLLESFGNAQTIRNDNSSRFGKYVEIFFD-NGNICGSRITNYLLEKSRIVNINPRERGYHIFYEVL-LGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRNDAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFM-----EEQETSYLVETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDTLSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAMLDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWHYIAYP-DNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVH-GKNDNYEKPKKTHPPQ----FIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCEVVEIATIFRKKRELQTKNPTAKARTPAVMGDF-QSSLTTLLAKMKTCQPWFIRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFLSRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKEDFARHLE 2228
            I++M NL  L+D S+  NL+ RY + LIYTY G   I++NPY    IY  + I+ Y+ K   +MPPH+F I +  Y+ M+ D ENQ ++I+GESGAGKTE+ K+++ YFA V+   K+   +  +    +  +I+ + P+LE++GNA+T RN+NSSRFGK++ I F  +G I G+ I  YLLEKSR+++    ER YHIFY++L  G  S++           +S++N   E TI   +D   +K     +  LG + E+     +  ++++++G +KF      E+ E     E E    VS +L V+   L   +     +   +      +K+Q +     L+K LY+ +F W+VT+VN  L+     V+RQ                I +LDI GFE F  N  EQ+CINY NE LQQFFN ++F LEQEEYKKE I W +I +  D Q  I+L+  KP GI+ IL +EC  P+ SD +   K ++ H GK+ N+ KPK   P Q    F +HH+AG++ Y++ G+LEKN+D L + ++ ++   +   +A++F    +        K  +   +    + SL  L+  + +  P FIRC+ PN  K+    +  +VM Q+   G+LE ++I + GFP ++++S F  R+ +L    I +  ++ +Q    K++   + +    + LG TK+F K      LE
Sbjct:   82 IEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQG-ELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEK---VSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK---VKRQFF--------------IGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE-KPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTD-KILTAIQ-LDTNLYRLGNTKVFFKAGTLAQLE 764          
The following BLAST results are available for this feature:
BLAST of Unconventional myosin-XV vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO15A1.305e-635.41myosin XVA [Source:HGNC Symbol;Acc:HGNC:7594][more]
MYO15A1.305e-635.41myosin XVA [Source:HGNC Symbol;Acc:HGNC:7594][more]
MYO7B5.572e-15938.72myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607][more]
MYO7B5.572e-15938.72myosin VIIB [Source:HGNC Symbol;Acc:HGNC:7607][more]
MYO7A7.166e-15935.95myosin VIIA [Source:HGNC Symbol;Acc:HGNC:7606][more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-63.734e-16038.85Unconventional myosin heavy chain 6 [Source:UniPr... [more]
hum-17.489e-12233.25Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-22.852e-12133.59Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-23.431e-12133.59Heavy chain, Unconventional Myosin [Source:UniPro... [more]
nmy-15.597e-11833.68Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo10A6.535e-17934.19gene:FBgn0263705 transcript:FBtr0310333[more]
Myo10A6.535e-17934.19gene:FBgn0263705 transcript:FBtr0346278[more]
Myo10A1.116e-17834.19gene:FBgn0263705 transcript:FBtr0310334[more]
ck1.687e-15938.09gene:FBgn0000317 transcript:FBtr0080724[more]
ck1.687e-15938.09gene:FBgn0000317 transcript:FBtr0343687[more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo15aa3.005e-835.44myosin XVAa [Source:ZFIN;Acc:ZDB-GENE-080425-2][more]
myo15ab3.410e-17934.06myosin XVAb [Source:ZFIN;Acc:ZDB-GENE-090312-149][more]
BX324225.11.207e-15837.68myosin VIIAb [Source:NCBI gene;Acc:556141][more]
myo7ab1.310e-15837.68myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
myo7ab1.337e-15837.81myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO15A1.289e-16139.63myosin XVA [Source:NCBI gene;Acc:100488159][more]
MYO7B9.165e-15637.66unconventional myosin-VIIb [Source:NCBI gene;Acc:1... [more]
MYO7B1.177e-15537.66unconventional myosin-VIIb [Source:NCBI gene;Acc:1... [more]
MYO7B1.388e-15537.66unconventional myosin-VIIb [Source:NCBI gene;Acc:1... [more]
MYO7A2.768e-15337.45myosin 7a [Source:NCBI gene;Acc:100491335][more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo153.404e-635.19myosin XV [Source:MGI Symbol;Acc:MGI:1261811][more]
Myo153.581e-835.28myosin XV [Source:MGI Symbol;Acc:MGI:1261811][more]
Myo153.513e-635.28myosin XV [Source:MGI Symbol;Acc:MGI:1261811][more]
Myo153.514e-635.45myosin XV [Source:MGI Symbol;Acc:MGI:1261811][more]
Myo101.196e-15635.39myosin X [Source:MGI Symbol;Acc:MGI:107716][more]
back to top
BLAST of Unconventional myosin-XV vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QZZ4|MYO15_MOUSE0.000e+035.45Unconventional myosin-XV OS=Mus musculus OX=10090 ... [more]
sp|Q9UKN7|MYO15_HUMAN6.267e-635.41Unconventional myosin-XV OS=Homo sapiens OX=9606 G... [more]
sp|Q622K8|HUM6_CAEBR2.711e-16039.50Unconventional myosin heavy chain 6 OS=Caenorhabdi... [more]
sp|P91443|HUM6_CAEEL4.750e-15938.85Unconventional myosin heavy chain 6 OS=Caenorhabdi... [more]
sp|Q17LW0|MYO7A_AEDAE7.417e-15938.47Myosin-VIIa OS=Aedes aegypti OX=7159 GN=ck PE=3 SV... [more]
back to top
BLAST of Unconventional myosin-XV vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PDF90.000e+036.48Unconventional myosin-XV (Fragment) OS=Schistoceph... [more]
T1JBR91.469e-936.69Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A210QCQ29.276e-1037.35Unconventional myosin-XV OS=Mizuhopecten yessoensi... [more]
A0A1S3KD119.616e-1836.10LOW QUALITY PROTEIN: unconventional myosin-XV-like... [more]
A0A564Y0R43.123e-1235.39Myosin motor domain-containing protein OS=Hymenole... [more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo7ab4.963e-16037.28unconventional myosin-VIIa-like [Source:NCBI gene;... [more]
myo7aa1.568e-15436.81myosin VIIAa [Source:ZFIN;Acc:ZDB-GENE-020709-1][more]
myo7bb3.399e-15237.74myosin VIIBb [Source:ZFIN;Acc:ZDB-GENE-070912-482][more]
si:ch73-194h10.25.981e-15237.56si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
si:ch73-194h10.27.704e-14836.19si:ch73-194h10.2 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo10l11.022e-14535.94myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000009024.16.330e-13838.76pep scaffold:Pmarinus_7.0:GL483156:63:16235:-1 gen... [more]
ENSPMAT00000000498.17.356e-13736.15pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 ge... [more]
myh104.579e-12433.29myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myo1f2.876e-12333.38myosin IF [Source:ZFIN;Acc:ZDB-GENE-081104-506][more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO22.318e-13636.65Type V myosin motor involved in actin-based transp... [more]
MYO42.711e-12834.85Type V myosin motor involved in actin-based transp... [more]
MYO32.603e-12536.03One of two type I myosins; localizes to actin cort... [more]
MYO54.028e-12435.36One of two type I myosin motors; contains proline-... [more]
MYO18.555e-11732.76Type II myosin heavy chain; required for wild-type... [more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455633.716e-16337.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319241.261e-16143.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418191.167e-14434.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495153.436e-12633.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350071.512e-12433.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Unconventional myosin-XV vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo7ab1.122e-16236.70myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
ENSORLT00000002420.25.534e-15636.63myosin VIIA [Source:NCBI gene;Acc:101165746][more]
si:ch73-194h10.26.486e-15137.06unconventional myosin-VIIb [Source:NCBI gene;Acc:1... [more]
myo5ab7.270e-13335.49unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
myo5ab8.171e-13335.49unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Unconventional myosin-XV vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061386.10.000e+099.48SMESG000061386.1[more]
SMESG000005090.17.390e-15739.44SMESG000005090.1[more]
SMESG000005090.11.053e-15639.44SMESG000005090.1[more]
SMESG000068232.12.304e-12334.78SMESG000068232.1[more]
SMESG000056451.11.557e-12134.65SMESG000056451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002656 ID=SMED30002656|Name=Unconventional myosin-XV|organism=Schmidtea mediterranea sexual|type=transcript|length=7783bp
AGAGAACTGAAGGAAATTTTAAGCACTAATATTCATTTTCAATAATCGGG
AATTAATTAGTATTCAAGTATATTTAAAAGAAATTGATATTGAAAACAAA
GAATAAAAAAATGGATAAAATTGGGAAATTGCACTTGTCGGATCAAGGGA
TAGATAATATGACAAATCTGGTAGAACTGTCAGATCAGTCCCTGTTATCA
AACCTTCAAATAAGATATGCACAGAAATTGATTTACACTTATATTGGCAG
TATACTGATTAGTATAAACCCTTACACCGAACTGGGAATTTACGATAAAA
AATATATTGTGTCATACCAAAACAAGCTTATCCAAGACATGCCACCACAT
TTATTTGGAATAGGAGAGACGAATTACACGAAAATGATGAGGGATAATGA
GAACCAAGTCATTGTTATCAGCGGAGAATCAGGAGCTGGAAAAACAGAAA
GTTTTAAAAGATTGCTGAAATATTTTGCATTTGTTTCTGGTGGGTTTAAG
GAAGTCAAACAGAATTCTGACCAATTGTCAAGCGATATTGCCACACGAAT
TCTGGACAGTACTCCACTATTAGAAAGTTTCGGTAATGCTCAAACGATTC
GCAACGACAATTCGTCAAGATTCGGAAAATATGTGGAAATATTTTTTGAC
AACGGCAACATATGTGGATCACGGATCACGAATTATCTTTTGGAGAAATC
CCGAATTGTTAATATTAATCCCAGAGAAAGAGGATATCACATCTTCTATG
AAGTTCTTCTTGGATTAGATTCATTCAACAAAAGCCAATATTACTTCAAG
GGTATTAAAGATTATTCGTACCTCAATAATTCCAAAGAGTTTACCATTAA
AGATCGAAATGATGCTGCAAATCTCAAAGAATTTATGAGTCAATGGGACT
CATTAGGATTGACGAGTGAAGATTTAGATGTGGCAATGAGGATCTTGAGT
GCAGTTTTGCATCTTGGTAATATAAAATTTATGGAAGAACAAGAGACTAG
TTATTTGGTGGAAACCGAAAATATTGGTATTGTTTCTAAAATGTTAAAAG
TTGACCAGGATTCATTGAAACATTGCTTAACGATGAAAACAACTGAAACC
GTAAAAGATGCATCGATCAGCCCGTTGAATAAGGAACAATCTATTAATTA
CAGAGATACACTTTCCAAGCATCTTTATTCGGAGTTATTCAACTGGATCG
TCACCAAAGTTAATACTGGTTTGAACCAAAATAATTTGATAGTTCGGCGC
CAATCAGTAGTGGACAGGTCTCTTCTTTCGGCGGGTTCCAACTTCCGATC
CATTGCCATGCTTGATATCTACGGTTTTGAGAACTTTCCTGACAACAGTT
TGGAACAGCTGTGCATCAATTATGCAAATGAAACTTTACAACAATTTTTC
AACCGATATGTGTTTGAATTGGAACAAGAAGAATACAAAAAAGAAGGTAT
TAGTTGGCACTACATAGCCTATCCCGACAACCAACCGATTATAGACTTAT
TGTCTGCGAAACCTAATGGCATCATACAGATCCTGAATGACGAGTGTTCC
ATTCCTCAAGGATCAGATGTATCATTTTTAAATAAATGCCACAATGTTCA
TGGTAAAAACGATAATTATGAGAAGCCGAAAAAAACTCACCCACCTCAAT
TTATCATTCATCATTTCGCTGGAAATATTTCATATTCGGTCGCTGGGTTT
TTAGAAAAAAATCGTGACGTTTTACGGAAAGAAATTCTGAATGTCATCGA
AAATTGTGAGGTTGTCGAAATTGCCACGATTTTTCGTAAGAAACGAGAAC
TGCAAACGAAAAACCCAACTGCCAAAGCAAGAACACCTGCGGTTATGGGA
GATTTCCAAAGTTCATTGACAACTTTGTTAGCGAAAATGAAAACCTGTCA
ACCTTGGTTTATAAGATGCTTGAAACCGAACACAACAAAAGAAGCTTTAA
AATTTAATAAAGATATTGTCATGGATCAAATGAAATATACCGGCATTCTT
GAAACCGTAAAAATCCGAAAATCCGGATTTCCTATTCAAATTTTATTCAG
CGTCTTTTTGTCTAGATTCTATTTGCTCGTTACGAAAGAAATAAGGAAAG
CAAGTCTAAAAGACCAGCAAGCTGCTTGCCTGAAGTTGATGATTAAGTTC
AAAGGAGTAAAAAATAAGCATTTTGAACTAGGAAAAACGAAATTGTTTTT
GAAAGAAGATTTTGCTCGTCATTTAGAGAAACAAGTTCAAATCATTCGCA
ATCGAAGTGCTGTGATAATTCAAAGGAAATGGCGCGCATATTGGAAAATT
CGATTGGTCATCATACAAAATCAAGCCGCAACCAAAATACAGTCCATTGT
TCGAGGATTTATAGACAGGAGACGAATCAGAAAATTGCACATAGGAATTG
TCAAATTGCAAGCGTTCGTTCGAATGCAAATCGCTAGAAAAAGATTTCTG
CGGGCTCATCCAGAATTTACAAAATTATCCATTTACAACAAACCCATTGA
ACCGAAAGGGCAAGATAATTCTAAGCTGACCGTATACAAGGCACCGGTGA
GTGAGATTCCTAAAAAGACCAAGAGAAATAAAAAAAAGACTACAATTGGA
AATGCGTTTAATTATGATTTGTTAAAAATACCGATTGAATTAGCTTTCCT
ATTGGATAAAACCGAAGGAAAATTCAGTCCAGAATCCTCTCTACCATTTC
AGGAGCAAGTTATTCAAACGGGCAGGGCTCAACATTTGTGGAACCGTGGG
GAGTACAAATTGCCAAATGACATTGATTTATTCGTGCTGGAAAATTTTCT
TGATGACTTTGGCAATCATATACCATTCGAATCCAAGTCGAGGCCATTAA
CTGTTCCTTATCTCAATGAGAATGTTTTCCAGGATCACAAGGATGATTCA
CTAACTGCTCATAAATTGATACTGAGGATCATGTACGCAAAGTCGATGCC
ATGGTTCCACAAGTTTTTAACAAATAGTTATCTTCAGTTCTTGGCGACGA
AATCACCAGAATTGCAAAAGGAAATACTTGTCCAAATTTTGGCAGAAACC
TTACCGAGTAAATCTATCAGAACTAAATATCAATCTGATCACGAAGAAAT
CCGATTGACAAGAGCCTGGACGTTGCTGGGGAATTTGCTGAGCTTCATCA
TCCCTTCTCCAGATATTTATAACTATGTTTTAAAATTCGTATCGGATTGT
ATAGGAGTCGATCAAGCAAATACTTGTCAAGAGAAACTTTTACAATTTGC
TTCGTCTGGCCATCCTCAAATACCCAGGCTTTTTCCAGCTACGAATCTTG
AAAATTGTGCAAATAAGAAAGGCTCAAAAACTTGCTTAAATGTTCTTCAT
CCAGATAATAAATCAAATTCAGTTCATATAAATTCTTTTACAGTAGGAGA
AGATTTAGCCAGTCATTCTTTATGTTTTAGGATGAAAAGGTTCAAACTAA
TGAAAGGATGGTCGGTTTCAGTAATATATTCAGATAGAGTTTACGATTGT
TCTGGTCAGAACTATGTCCTGGACATTATTTCAGCTCTTGAACTACCTCA
ACACTGGTCAGAAATAACTGGACAACTTTTGGAGCAAAATTTTCTCATGT
CAAAACGTAGCCGATTGAATGGAGATCCTGTGGATATCGCGTCGCGAGGT
TTTATAAAAAATGTTTCAAGACCCCAAGGTCTTACTTCTAACAAAGGCCC
TTCAACTGTAAACAGTTTGCATTCCATGGACACTTGGGTAGAACAAGTTT
TTGAAAGTTCATTTCGAAACGAAGATGACGGGAATTCTGCAGTTCAGGAT
TTTATTCACGGTCTTGAGGATGAACTAAAAGCCAAAGGTCAAAATCATTA
TTCTTCCAATCCAACATTAGCTGCCAACTTCGCACATTCCTTAAACGTTC
ATAATAGCAATCCAAATCTTGCTTTTGGTGGACATGGTAATCTTCATTAT
TCAACCGATTATTTGATGCATCAGCATGCCCCAAATAATTCTTCAATGTA
TTTCTCGGCAGCCCCTCCACAAAATGACTTTGATATGCTTCAAGATCCGA
CATATTTACAGGAGCAATTAAATAGTGTTCAATTGGAAAATAAGGTCATA
CAATCTTCAATAGAACGAGAAATTCTGCAAAGTCGGTTACAAAAGATTAA
ACAACAAAAGTATTATCAACAACCTGTTTTAAATCCAAATGTCCCAATGC
AATATCAGCAACAGTATATGCCACATCAGGCTCCTATGACAAATTATCCA
ATTGTCCAACCAACGAATCGGTTTCCAATGTACCCTCATTACCATCAGCA
ACAATATCCTTATCAATTTGTTCATTCTGAACAGTTTTCCAATTCTCCAG
CAAGTGGTCCAAGCTTTCATCAATCGAATCCATTGTCAAATTCTCAGCCA
TATATTCATATGGATAATAATCAGATTACTCGTGATCAAAGTAAATCTCT
AGATCAAAATGACTCAACAACTATTCCCCAAAAACCGCCGAAAAAAGAAC
CTGTTCAACAGACGAATTCAAAGACCATTGACTTACAAAATATCAAATTA
AAGAAAACTACTATTTCGGTTCCAGCACCTCCAGCACCACCTCCCCCTCC
TCCACCGGTTCTTAATGGACATACGCCAAATAATGATTCTGAAGAACGGA
CTCAAAGCGGAGGAAAGATAGTGCCGAAACGACGAACATCTATTGTCAAA
TACTCGGAAGTAGGAAAACCATCGACTACCGTAGTAGACGATAAAGATGT
TTTACCAGGCGAAAAATTGCAGGAAGATAAAAAATCTTATATGAGAGCTG
CAGAAGTTCCAAAAGTCAATGTAACAAATCGAGCTGCTTTTCTCGAAAAT
TTCTTTAAAGAGAAACCTCCACCTGGAGTTGATCCGACAGTTCAAGGAAG
AAAACGTAAAGCGCCAGCCTTGCCAGTGGAGGAAACAAAATTCCCAGAAA
ATCAAGTCAATGCAATTAATTTGCTTGCGTCGATGAATTCTTCTAAAAAA
ATTTTACCAAGACCCAGTATGTCCGGCGATAAACTTCTAGAACTGAAAAC
GAAACAGGTCAAATTGCCGAAGCCTAAACCACAAGTGTCAATAAGTAATG
AGAAAGATGAAATCATGTTCGAAACTCAGTTACCAAGAACTAATCTAAAC
AATGCTAAAACAGAAATCGTTCCGGTTCCATTGCCAAGAAATCTAAGCCA
TAATGGGAAATCGGGGATACCTATTACTCTAAAACCCAGAAAATATGTGT
CAAATACTAAAGCGGATATTTTATGCGGTTTACCTGATATGAGATATTAC
ACATATCAGAAAGTACCTTGGGTTTTTATGTTGAAAAGAGAGATTTATCT
ACCGAATGAAATCCAGAATACAACTATCATGAATCCAATGATATTTTGTC
AGATTGTTCGAGATTTGATTGAATTCCCATGTATTCGTTGGGTTGGAAAC
GAAAAGAGAAAACTTTTATCTGTAATTGGAAATCGAGTGACAAAAGACAT
CAATTCAATTCTCGCAGTGCCAACAAATACAATGTTAAAGGTTATAGATG
AAACCTTAAAATGTGAATTATATTTCTCTCGATTCTATGAAATTAAATGG
GTGAAAACGTCCGAAGTGGGCAATACATATCATTGGATGTCGATATCTCA
CAGTGGTGTACGATTCGTCCAACAGAATTCAAGGTCACCCGAAAACGAAT
TACTGATTGGATCGCATATTTTATATTCGAATATCGACAAAGTCACTTGC
AAAACTCCTGATCAATATAACAATCCCCAAATAATGACAATCACGACAAA
ATCCCGCAAAAAATTCAAAGTCAAAACTATTCATGGAAATTCTGCACGAA
AATTGATAATGGAATTTTCAGAACATCAAAAAGTAGAACAAAGTCATGGA
ACGATAAATCTCACCAGTAATTTGGATATTAAAAAACGAACTCGCGGTCT
TTTAAAAGAAGCTGTACCATTTACAGATTCTGGAACGATGATGCTCGGTG
TAAATAATGAAAGGATCCAATTTACCAGTCATTCTATCACTAATAATATA
TATAAAAATACAGACAAACCAATAAACACAGATAAAGTTTACGACAAGGT
TAAAAAGCAAGGAAATCTCATAGATTTCACTGTGAACTTCTCTAAATATA
AAGATCGACAACATGTGTCAAACGTCATCCTTAGATGGCAACAGGACCCT
ATGAGAGAAGCAATTCTTCAATCCTCAAATAATGGAATTATTCGGCAAGC
TATAGAAATACATAATTTTTTATTGCTTTTAACCGACGAAATATCAAACG
GACAAAATCCTGACCCGATCAAATCAGCAAATTTGATATTCAAAATGCTT
TTGCAAAACGCCGAGTTAAACGAAGAGATTTTTCTGCAAGTATTCAAACA
AATTAATGGAAATCCATCAGTTAAATCGAGGAATTATTTATGGAATTTCC
TCTCTATTCTGATTATGTTTATTGGCGTGAATCAGAGAATGCAACCTTTT
CTTTTAGAGCACTTGAATCAAATTGTAAAAAATGTCTCAAATGAAGACCA
GCATTTGGCAGCTTTCGCTTTAAAAAATTATAAAATATTCTCAAAATTTG
GACCAAGAAAAGAACTTCCATTGGATAGTGAATTCGACCAATTAATGAAT
GGTTCAAGAGAAATGAATACCTCAATCTTTGTTCCAAATGATTCTTATCA
GTTCAATATTCCATTCAATGCCACAGTGGAAGATGTAATCAAGATCATTT
GTGAAACTCTTAATGTCCTATCAAAACTCGAAATAACCGAATATTCTCTA
ATTGTTTTCGAAATGACGAAAGCCGGTCCTACGAAGACCGCTACAAATTA
TTTATTATTTAATAATTTTTATTTTGACGAGATTAGTCCATTATTAAAAC
AAAAGAAACCGAATTTATTCATAAAATTTCTTCGACTGACTTGGATTGCT
CCTCTGAATTTGGATTACAGAACTCCGAATTTTGTCAGTTTTCATTTTAT
TCAATTGTCAAAAAGTATTCTCGACGAGGACTGGTTGGTTCCATCGAAGA
ATCAGTCTGTTGATTCAAATGAATTATCAGTAATTTCAAAAATCGCATAT
TACAACATGAGGGGACAGGGACAGACTAAACTGAAAAACGATGACAGTTT
GAAATCACTTTTACCCAGTAAACTGTTAGACCAGAAAAAGAAGACCATTT
CCAAAAAGAGTATAATGAAAATAATGAATTTAGAATCCACCGAAAAACAG
ACTCTCGGAACAAATGAATTTCAAAAATTGTTTTTGGAATATTGTGAAAG
GCTGCCTCGATTTGGATTGATAAAATGTCAAATTACTGATGTGAAACCTC
TTTCAAAGCCGGGACAATATTTTGTCGTTTTCAGTTCCCATTCGATTTCA
ATTGTAGAAAACGAATCTCAAGAACCAATTATCAACTTTTTGATTTCAGA
ATTTAGTTCATTTCAAGTTTCAATAGAAAATTCTACAAAATCCCATTTTA
TCATACGGTATAAAAATAAAGAAGAAATCCAGTTTGATTCAATTCATGGG
GAGAAATTAAAATTTCTATTCATTCAATACGAAATGACAAAGAAGTTGCG
ATTGATAGACAAATGAAGATCCAACTTTCCAATTAATAATTCAACATATC
TTAAAAATATTATATATCTGTAACTTTATTTTGTGCCTTTTCTGTTGAAA
TTTGATTACCGTAGATTTTATTGAGAACTCTTTCAGTAAAGGTGTTTTTT
GTTTTTACATCATAAATAATTTTTTTATACCAG
back to top

protein sequence of SMED30002656-orf-1

>SMED30002656-orf-1 ID=SMED30002656-orf-1|Name=SMED30002656-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2502bp
MDKIGKLHLSDQGIDNMTNLVELSDQSLLSNLQIRYAQKLIYTYIGSILI
SINPYTELGIYDKKYIVSYQNKLIQDMPPHLFGIGETNYTKMMRDNENQV
IVISGESGAGKTESFKRLLKYFAFVSGGFKEVKQNSDQLSSDIATRILDS
TPLLESFGNAQTIRNDNSSRFGKYVEIFFDNGNICGSRITNYLLEKSRIV
NINPRERGYHIFYEVLLGLDSFNKSQYYFKGIKDYSYLNNSKEFTIKDRN
DAANLKEFMSQWDSLGLTSEDLDVAMRILSAVLHLGNIKFMEEQETSYLV
ETENIGIVSKMLKVDQDSLKHCLTMKTTETVKDASISPLNKEQSINYRDT
LSKHLYSELFNWIVTKVNTGLNQNNLIVRRQSVVDRSLLSAGSNFRSIAM
LDIYGFENFPDNSLEQLCINYANETLQQFFNRYVFELEQEEYKKEGISWH
YIAYPDNQPIIDLLSAKPNGIIQILNDECSIPQGSDVSFLNKCHNVHGKN
DNYEKPKKTHPPQFIIHHFAGNISYSVAGFLEKNRDVLRKEILNVIENCE
VVEIATIFRKKRELQTKNPTAKARTPAVMGDFQSSLTTLLAKMKTCQPWF
IRCLKPNTTKEALKFNKDIVMDQMKYTGILETVKIRKSGFPIQILFSVFL
SRFYLLVTKEIRKASLKDQQAACLKLMIKFKGVKNKHFELGKTKLFLKED
FARHLEKQVQIIRNRSAVIIQRKWRAYWKIRLVIIQNQAATKIQSIVRGF
IDRRRIRKLHIGIVKLQAFVRMQIARKRFLRAHPEFTKLSIYNKPIEPKG
QDNSKLTVYKAPVSEIPKKTKRNKKKTTIGNAFNYDLLKIPIELAFLLDK
TEGKFSPESSLPFQEQVIQTGRAQHLWNRGEYKLPNDIDLFVLENFLDDF
GNHIPFESKSRPLTVPYLNENVFQDHKDDSLTAHKLILRIMYAKSMPWFH
KFLTNSYLQFLATKSPELQKEILVQILAETLPSKSIRTKYQSDHEEIRLT
RAWTLLGNLLSFIIPSPDIYNYVLKFVSDCIGVDQANTCQEKLLQFASSG
HPQIPRLFPATNLENCANKKGSKTCLNVLHPDNKSNSVHINSFTVGEDLA
SHSLCFRMKRFKLMKGWSVSVIYSDRVYDCSGQNYVLDIISALELPQHWS
EITGQLLEQNFLMSKRSRLNGDPVDIASRGFIKNVSRPQGLTSNKGPSTV
NSLHSMDTWVEQVFESSFRNEDDGNSAVQDFIHGLEDELKAKGQNHYSSN
PTLAANFAHSLNVHNSNPNLAFGGHGNLHYSTDYLMHQHAPNNSSMYFSA
APPQNDFDMLQDPTYLQEQLNSVQLENKVIQSSIEREILQSRLQKIKQQK
YYQQPVLNPNVPMQYQQQYMPHQAPMTNYPIVQPTNRFPMYPHYHQQQYP
YQFVHSEQFSNSPASGPSFHQSNPLSNSQPYIHMDNNQITRDQSKSLDQN
DSTTIPQKPPKKEPVQQTNSKTIDLQNIKLKKTTISVPAPPAPPPPPPPV
LNGHTPNNDSEERTQSGGKIVPKRRTSIVKYSEVGKPSTTVVDDKDVLPG
EKLQEDKKSYMRAAEVPKVNVTNRAAFLENFFKEKPPPGVDPTVQGRKRK
APALPVEETKFPENQVNAINLLASMNSSKKILPRPSMSGDKLLELKTKQV
KLPKPKPQVSISNEKDEIMFETQLPRTNLNNAKTEIVPVPLPRNLSHNGK
SGIPITLKPRKYVSNTKADILCGLPDMRYYTYQKVPWVFMLKREIYLPNE
IQNTTIMNPMIFCQIVRDLIEFPCIRWVGNEKRKLLSVIGNRVTKDINSI
LAVPTNTMLKVIDETLKCELYFSRFYEIKWVKTSEVGNTYHWMSISHSGV
RFVQQNSRSPENELLIGSHILYSNIDKVTCKTPDQYNNPQIMTITTKSRK
KFKVKTIHGNSARKLIMEFSEHQKVEQSHGTINLTSNLDIKKRTRGLLKE
AVPFTDSGTMMLGVNNERIQFTSHSITNNIYKNTDKPINTDKVYDKVKKQ
GNLIDFTVNFSKYKDRQHVSNVILRWQQDPMREAILQSSNNGIIRQAIEI
HNFLLLLTDEISNGQNPDPIKSANLIFKMLLQNAELNEEIFLQVFKQING
NPSVKSRNYLWNFLSILIMFIGVNQRMQPFLLEHLNQIVKNVSNEDQHLA
AFALKNYKIFSKFGPRKELPLDSEFDQLMNGSREMNTSIFVPNDSYQFNI
PFNATVEDVIKIICETLNVLSKLEITEYSLIVFEMTKAGPTKTATNYLLF
NNFYFDEISPLLKQKKPNLFIKFLRLTWIAPLNLDYRTPNFVSFHFIQLS
KSILDEDWLVPSKNQSVDSNELSVISKIAYYNMRGQGQTKLKNDDSLKSL
LPSKLLDQKKKTISKKSIMKIMNLESTEKQTLGTNEFQKLFLEYCERLPR
FGLIKCQITDVKPLSKPGQYFVVFSSHSISIVENESQEPIINFLISEFSS
FQVSIENSTKSHFIIRYKNKEEIQFDSIHGEKLKFLFIQYEMTKKLRLID
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016459myosin complex
GO:0005856cytoskeleton
GO:0005737cytoplasm
GO:0032420stereocilium
GO:0032421stereocilium bundle
GO:0042995cell projection
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038185MyTH4_dom_sf
IPR036961Kinesin_motor_dom_sf
IPR011993PH-like_dom_sf
IPR035487MYO15A
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR000857MyTH4_dom
IPR019749Band_41_domain
IPR000299FERM_domain
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007605sensory perception of sound
GO:0007626locomotory behavior
GO:0042472inner ear morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 397..425
score: 63.62
coord: 152..179
score: 71.29
coord: 42..61
score: 53.57
coord: 450..478
score: 26.45
coord: 98..123
score: 60.32
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 7..711
e-value: 9.7E-269
score: 908.7
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 15..698
e-value: 1.2E-212
score: 707.9
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 12..710
score: 209.728
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 758..780
e-value: 0.46
score: 19.5
coord: 735..757
e-value: 0.011
score: 25.0
coord: 712..734
e-value: 110.0
score: 4.9
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 763..779
e-value: 0.03
score: 14.1
coord: 738..757
e-value: 0.0035
score: 17.0
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 736..765
score: 9.212
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 759..788
score: 7.108
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 2181..2404
e-value: 0.007
score: 6.7
IPR000857MyTH4 domainSMARTSM00139MyTH4_1coord: 2026..2179
e-value: 0.0082
score: -23.1
IPR000857MyTH4 domainPFAMPF00784MyTH4coord: 2073..2176
e-value: 3.4E-14
score: 53.3
coord: 962..1050
e-value: 4.7E-7
score: 30.3
IPR000857MyTH4 domainPROSITEPS51016MYTH4coord: 908..1069
score: 14.571
IPR000857MyTH4 domainPROSITEPS51016MYTH4coord: 2026..2179
score: 24.517
IPR038185MyTH4 domain superfamilyGENE3DG3DSA:1.25.40.530coord: 950..1070
e-value: 6.3E-9
score: 37.9
IPR038185MyTH4 domain superfamilyGENE3DG3DSA:1.25.40.530coord: 2002..2180
e-value: 1.6E-15
score: 59.4
NoneNo IPR availableGENE3DG3DSA:3.30.70.3240coord: 640..712
e-value: 1.4E-9
score: 40.0
NoneNo IPR availableGENE3DG3DSA:1.20.58.530coord: 409..596
e-value: 3.1E-209
score: 698.2
NoneNo IPR availableGENE3DG3DSA:1.10.10.820coord: 207..263
e-value: 3.1E-209
score: 698.2
NoneNo IPR availableGENE3DG3DSA:1.20.120.720coord: 264..370
e-value: 3.1E-209
score: 698.2
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 735..784
e-value: 3.4E-7
score: 31.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1442..1479
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1505..1524
NoneNo IPR availablePANTHERPTHR22692MYOSIN VII, XVcoord: 13..1202
NoneNo IPR availablePANTHERPTHR22692MYOSIN VII, XVcoord: 1728..1856
NoneNo IPR availableCDDcd00124MYSccoord: 27..698
e-value: 0.0
score: 761.36
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 17..639
e-value: 3.1E-209
score: 698.2
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1821..1925
e-value: 2.4E-5
score: 26.4
IPR035487Unconventional myosin-XVPANTHERPTHR22692:SF21coord: 1728..1856
IPR035487Unconventional myosin-XVPANTHERPTHR22692:SF21coord: 13..1202
IPR000299FERM domainPROSITEPS50057FERM_3coord: 2185..2501
score: 10.744
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 12..767