Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30002655
Length (bp)2418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30002655) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30002655) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30002655) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30002655) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002655

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30002655SMESG000079770.1 dd_Smed_v6_1914_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002655SMESG000079770.1 dd_Smed_v6_1914_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002655SMESG000079770.1 dd_Smed_v4_1914_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 123.25 bits (308), Expect = 5.765e-28
Identity = 88/307 (28.66%), Postives = 138/307 (44.95%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVIC---IKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E+ +W+ CS TCG G + + V C   + +      +++DELC+  P  S T++ CN  NC     W P +W  CS+TCG  G + R+V C      G+ +     +C  S +P    +C   DCP   +  +W +C  +  C  GTQ R   C  +LK G    +     +ST+ PP+    S R C      +      +  P I   +   +Q R+ + L+  VG  AY+   T +++ CP        I W+        H  S   + V   G L+I + +  D G +TC AGP     +IK+
Sbjct:  671 EIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQ-PKPS-TVQACNRFNCPP--AWYPAQWQPCSRTCG-GGVQKREVLCKQRMADGSFLELPETFCSAS-KPACQQACKKDDCPSEWLLSDWTECSTS--CGEGTQTRSAICRKMLKTGLSTVV-----NSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQ----HLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIKL 960          

HSP 2 Score: 63.929 bits (154), Expect = 1.326e-9
Identity = 60/221 (27.15%), Postives = 92/221 (41.63%), Query Frame = 2
Query:  230 FLVLISETFKVNAKIKESQTQTF---WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            F+V I  +   ++ ++    Q     W E D +  CS TCG G +     C      +  +V+D+ C   P      P ++ECNL  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G++ + +   C  + +   +  CNI DCP  L   EW  C     C  G + R + CI        + M    CS   KP +
Sbjct:  275 FIVKIRNSGSADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY--DLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLA-QEWSPCTVT--CGQGLRYRVVLCIDH------RGMHTGGCSPKTKPHI 482          

HSP 3 Score: 63.1586 bits (152), Expect = 2.011e-9
Identity = 77/358 (21.51%), Postives = 134/358 (37.43%), Query Frame = 2
Query:  998 MINCPVTYFVPRDIVWKHGNT-IYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAV---------------------GFQDWKLRTTLWNKEMLNEDPEVGMTRNEV-----------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNI-LDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            ++ CP+      +I W HG   I    G +   +   +   L++       QG ++C+A  +N + ++  +   V                     G Q  +LR  L N   +N     G  R  V            +W+   WS C+ +CG  G Q+R V C++ +    +  + + +C +   K+P+  + C     C +W  +      C   CI          + C    G  + +  C    +      C +E C V W+ S W+ C+ +CG  G  +R + C+   T         S   P P   + C    C N++C D    C+     K C  S ++  CC +C +
Sbjct: 1415 LLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQI--LQVANLSGGSQGEFSCLA--QNEAGVLMQKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLL-NSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCTQVA-KRPVDTQACNQQL-CVEWAFSSWG--QCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWG-PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTCGK 1761          

HSP 4 Score: 58.151 bits (139), Expect = 7.799e-8
Identity = 58/201 (28.86%), Postives = 90/201 (44.78%), Query Frame = 2
Query: 1253 WNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKC 1852
            W K+   ++ E G   +E   +I + WS C+VTCGV G Q R V C+       ++ D  + E +G  KP ++R C  A  C   ++   NPD          FG ++                 D  E Y+           W+   ++KCS SCGG G+    + C+ K T +PA  +LC + + P P+++KSC    C
Sbjct:  507 WFKQA--QELEEGAAVSEEPSFIPEAWSACTVTCGV-GTQVRIVRCQVLLSFSQSVADLPIDECEG-PKPASQRAC-YAGPC-SGEIPEFNPDETDGL-----FGGLQ-----------------DFDELYD-----------WEYEGFTKCSESCGG-GVQEAVVSCLNKQTREPAEENLCVTSRRP-PQLLKSCNLDPC 666          

HSP 5 Score: 54.299 bits (129), Expect = 1.011e-6
Identity = 50/157 (31.85%), Postives = 67/157 (42.68%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYN---ILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC---IHQGQIIE--ASACD-KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            +W    WS CS+TCGV G Q+R+V C     +  N   IL D +C    Q KP T + C      P W      P  C+  C   G G  +  + C   +  G  +E   + C   K      C  + C   W  S+W++CS SCG  G   R  IC
Sbjct:  669 RWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNRFNCPPAWYPAQWQP--CSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 108.612 bits (270), Expect = 2.462e-23
Identity = 89/312 (28.53%), Postives = 135/312 (43.27%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS--SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLK---------DLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
             V  W  CS TCG G + + V C+      E     E C+     +  ++ CN  +C     W   +W +CS+TCG  G + R V C      G+ +N   + C+    P+ASS  SC   DCP  L  G+W KC  +  C  G QRR   C  +   G+   +    C      P+  R C       EC K           + P I+ +++   +Q R+ K +N+ +G  AY+   T ++I CPV  F    I W K G  + N        + + K G L+I    + D G + CIAG    + ++K+
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPG---ETPAPPEECRDEKPHA--LQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELCQ---GPKASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLV-RSC----QMPECSKIKSEMKTKLGEQGPQILSVQR-VYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQN-----SKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL 995          

HSP 2 Score: 78.9518 bits (193), Expect = 3.420e-14
Identity = 62/217 (28.57%), Postives = 97/217 (44.70%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQH-YNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNME--CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDP-AGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCK--PHAKKCIQSIYRYTCCKSC 1945
            +W    WSQCSV+CG EG+ SR+V C++++      ++    C  K   +PL R+ C     C +W+     P  C  + +R+     + +  C H       S CD +++  +   C +  C V W T  W  C+ +CG  G  +R + CI   +  P A   C  +K P+    + C  P C+  C D    C    H   C    Y+  CC+SC
Sbjct: 1486 RWFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPK--DRPLGRKPC-FGHPCVQWEPGNRCPGRCMGRAVRMQ----QRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKRHCVQKKKPI--SWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSC 1688          

HSP 3 Score: 59.3066 bits (142), Expect = 3.073e-8
Identity = 53/209 (25.36%), Postives = 86/209 (41.15%), Query Frame = 2
Query:  215 VFGIVFLVLISETFKVN-AKIKESQTQTF--------WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
             F I   ++    FK      K+S  Q F        W + D +  C+ TCG G +     C+      + +V D  C   P      P +KEC++  C           YD++     W+   W+ CS +CG  G + R   CV +   G ++  +   C  + +P+   +CN+ DCP   +  EW +C     C  G + R + CI+
Sbjct:  306 TFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTD-FFPCTVTCGGGYQLNSAECV--DIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCG-GGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP-KWIAMEWSQCTVT--CGRGLRYRVVLCIN 507          

HSP 4 Score: 57.7658 bits (138), Expect = 1.008e-7
Identity = 37/123 (30.08%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  488 VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEAS-SSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDH 853
             W+PG WS CS TCG  G + +  +CV   G           C+   +P A    CNI DCP       W +C  +  C  G   R +TC     NG  + +   AC+   + P+  + C+ H
Sbjct: 1427 FWEPGNWSHCSATCGHLGARIQRPQCVMANGQ----EVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR-PLGRKPCFGH 1542          

HSP 5 Score: 54.299 bits (129), Expect = 1.057e-6
Identity = 42/149 (28.19%), Postives = 64/149 (42.95%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQI-IEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W   G++ C+ TC V G Q     C   + Q    ++DS+C+    + P   + C      P+W +    P  C+  C   G G    +++C+H G+       C D+K      C    C  GW    W +CSR+CGG G   R + C
Sbjct:  648 WEYAGFTPCTATC-VGGHQEAIAVCLHIQTQQ--TVNDSLCDMV-HRPPAMSQACNTEPCPPRWHVGSWGP--CSATC---GVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGG-GTQNRRVTC 786          

HSP 6 Score: 51.6026 bits (122), Expect = 6.495e-6
Identity = 45/172 (26.16%), Postives = 74/172 (43.02%), Query Frame = 2
Query:  167 ISTKKIYLRQMKISWNVFGIVFL------VLISETFKVNAKIKESQT---QTFWLEVDEWNSCSTTCGP-GTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSC 652
            ++T  ++L + +  W    IVFL      +L +   + N+     +    + FW E   W+ CS TCG  G R ++  C+       + VS+ LC  +       + CN+ +C     W    WS+CS +CG  G  +R V C   + +G +     + C P  RP     C
Sbjct: 1377 VATSVLHLLERR--WPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFW-EPGNWSHCSATCGHLGARIQRPQCV---MANGQEVSEALCDHLQKPLAGFEPCNIRDCPAR--WFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPC 1539          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 108.227 bits (269), Expect = 2.917e-23
Identity = 89/312 (28.53%), Postives = 135/312 (43.27%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS--SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLK---------DLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
             V  W  CS TCG G + + V C+      E     E C+     +  ++ CN  +C     W   +W +CS+TCG  G + R V C      G+ +N   + C+    P+ASS  SC   DCP  L  G+W KC  +  C  G QRR   C  +   G+   +    C      P+  R C       EC K           + P I+ +++   +Q R+ K +N+ +G  AY+   T ++I CPV  F    I W K G  + N        + + K G L+I    + D G + CIAG    + ++K+
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPG---ETPAPPEECRDEKPHA--LQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELCQ---GPKASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLV-RSC----QMPECSKIKSEMKTKLGEQGPQILSVQR-VYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQN-----SKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL 995          

HSP 2 Score: 65.855 bits (159), Expect = 3.105e-10
Identity = 52/185 (28.11%), Postives = 85/185 (45.95%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQH-YNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNME--CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDP-AGSLCYSQKIPLPEVIKSCRAPKCN 1855
            +W    WSQCSV+CG EG+ SR+V C++++      ++    C  K   +PL R+ C     C +W+     P  C  + +R+     + +  C H       S CD +++  +   C +  C V W T  W  C+ +CG  G  +R + CI   +  P A   C  +K P+    + C  P C+
Sbjct: 1486 RWFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPK--DRPLGRKPC-FGHPCVQWEPGNRCPGRCMGRAVRMQ----QRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKRHCVQKKKPI--SWRHCLGPSCD 1656          

HSP 3 Score: 59.3066 bits (142), Expect = 3.487e-8
Identity = 53/209 (25.36%), Postives = 86/209 (41.15%), Query Frame = 2
Query:  215 VFGIVFLVLISETFKVN-AKIKESQTQTF--------WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
             F I   ++    FK      K+S  Q F        W + D +  C+ TCG G +     C+      + +V D  C   P      P +KEC++  C           YD++     W+   W+ CS +CG  G + R   CV +   G ++  +   C  + +P+   +CN+ DCP   +  EW +C     C  G + R + CI+
Sbjct:  306 TFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTD-FFPCTVTCGGGYQLNSAECV--DIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCG-GGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP-KWIAMEWSQCTVT--CGRGLRYRVVLCIN 507          

HSP 4 Score: 57.3806 bits (137), Expect = 1.135e-7
Identity = 37/123 (30.08%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  488 VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEAS-SSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDH 853
             W+PG WS CS TCG  G + +  +CV   G           C+   +P A    CNI DCP       W +C  +  C  G   R +TC     NG  + +   AC+   + P+  + C+ H
Sbjct: 1427 FWEPGNWSHCSATCGHLGARIQRPQCVMANGQ----EVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR-PLGRKPCFGH 1542          

HSP 5 Score: 54.299 bits (129), Expect = 1.021e-6
Identity = 42/149 (28.19%), Postives = 64/149 (42.95%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQI-IEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W   G++ C+ TC V G Q     C   + Q    ++DS+C+    + P   + C      P+W +    P  C+  C   G G    +++C+H G+       C D+K      C    C  GW    W +CSR+CGG G   R + C
Sbjct:  648 WEYAGFTPCTATC-VGGHQEAIAVCLHIQTQQ--TVNDSLCDMV-HRPPAMSQACNTEPCPPRWHVGSWGP--CSATC---GVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGG-GTQNRRVTC 786          

HSP 6 Score: 51.6026 bits (122), Expect = 7.005e-6
Identity = 45/172 (26.16%), Postives = 74/172 (43.02%), Query Frame = 2
Query:  167 ISTKKIYLRQMKISWNVFGIVFL------VLISETFKVNAKIKESQT---QTFWLEVDEWNSCSTTCGP-GTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSC 652
            ++T  ++L + +  W    IVFL      +L +   + N+     +    + FW E   W+ CS TCG  G R ++  C+       + VS+ LC  +       + CN+ +C     W    WS+CS +CG  G  +R V C   + +G +     + C P  RP     C
Sbjct: 1377 VATSVLHLLERR--WPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFW-EPGNWSHCSATCGHLGARIQRPQCV---MANGQEVSEALCDHLQKPLAGFEPCNIRDCPAR--WFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPC 1539          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTS17 (ADAM metallopeptidase with thrombospondin type 1 motif 17 [Source:HGNC Symbol;Acc:HGNC:17109])

HSP 1 Score: 83.1889 bits (204), Expect = 1.189e-15
Identity = 60/207 (28.99%), Postives = 88/207 (42.51%), Query Frame = 2
Query:  182 IYLRQMKISWNVFGI--VFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPR 796
            ++L  +      +GI   + V ++ T +  ++ ++ Q   F      W  CS  CG G R+  V C +    T  +V+D  C       P ++ CNL  C     W  G WS CS TC   G + R+V CVY   +G  V +   YC P  RP A  SC   DC       EW +C  +  C  G  +R + C +        + PR
Sbjct:  762 LHLMVLLFHDQDYGIHYEYTVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVNDSDCPQASRPEPQVRRCNLHPCQSR--WVAGPWSPCSATC-EKGFQHREVTCVYQLQNGTHVATRPLYC-PGPRPAAVQSCEGQDCLSIWEASEWSQCSAS--CGKGVWKRTVACTNSQGKCDASTRPR 962          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: PAPLN (papilin, proteoglycan like sulfated glycoprotein [Source:HGNC Symbol;Acc:HGNC:19262])

HSP 1 Score: 78.5666 bits (192), Expect = 3.714e-14
Identity = 65/202 (32.18%), Postives = 89/202 (44.06%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYT-EEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPL----TLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEI 907
            W  CS +CG G++ + V CI       +E V +  C  +P   P I+ CNL  C     W P  W ECS +CG   RK R V C  + GS  L+++ +  C    RP  +  C   DCPL        G WG C K+  CS+GT+RR + C            P H  S     PV    C    NT+ C     +P + ++
Sbjct:  371 WAPCSASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACNLQRCA---AWSPEPWGECSVSCGVGVRK-RSVTCRGERGS--LLHTAA--CSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWGLCSKS--CSSGTRRRQVICA--------IGPPSHCGSLQHSKPVDVEPC----NTQPCHLPQEVPSMQDV 550          

HSP 2 Score: 70.0922 bits (170), Expect = 1.460e-11
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEP-SLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVS 832
            W+ CS  CG G + + V C        E   D +C+  P  +   + CNL  C +   WK G W+ CS +CG  G ++R V C+  +G+G     +   C     +P A  +CN+  C     P  WG+C  +  C  G ++R +TC    +  +   +   ACS   +PP++
Sbjct:  313 WSDCSAECGGGHQSRLVFCT----IDHEAYPDHMCQRQPRPA-DRRSCNLHPCPETKRWKAGPWAPCSASCG-GGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACNLQRC-AAWSPEPWGECSVS--CGVGVRKRSVTC----RGERGSLLHTAACSLEDRPPLT 472          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8937718:-1 gene:WBGene00009958.1 transcript:F53B6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 163.31 bits (412), Expect = 1.123e-41
Identity = 157/630 (24.92%), Postives = 259/630 (41.11%), Query Frame = 2
Query:  254 FKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVY-----DEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWK-HGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAG--PKNASAIIKVRN-----------PAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNE--------------------------VIQWIKKGWSQC-SVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRA----PKCNLKCVDLY---ASCKPHAKKC-IQSIY--------RYTCCKSCS 1948
             + ++K+ E +    W   D W  CS +C  G ++  + CI+ S  T + V    C          + CN   C     W   K+S+CS +CGS G   R V+C       D    ++V  D + C    +P+ + +CN++ CP T V  +W +C ++  C +G +RR + C      GK +  P   C +  KP       +   +  E L +               Q  + K L + +G +A +Y  T I I CP   F  + I WK +G  I     K+   I+V   G LR+     +D G + C       N +   K R+           P +     + R  +  +++L E   V    N                           V +W    WS+C   TC V G+Q+R + C+ +       +D+S+CE     +P   R C     CP+W+ +  + +  + +C+     +   N+ C    G  ++   CD   +    M+CPN+ C+  W+TS+W  CS  CG  G+  R L C+W ++  PAG  C  +++  P   ++C A    P C      LY   ASC+  ++ C I  ++        R  CC +C+
Sbjct:  105 LQEDSKLSEDEAPYQWRYGD-WTQCSASCLGGKQKAALKCIQVS--TGKSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDR-CHFK-KPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLSN-----------RVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI-----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQWS-ECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNC--EQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCT 704          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 162.155 bits (409), Expect = 9.563e-41
Identity = 157/630 (24.92%), Postives = 259/630 (41.11%), Query Frame = 2
Query:  254 FKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVY-----DEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWK-HGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAG--PKNASAIIKVRN-----------PAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNE--------------------------VIQWIKKGWSQC-SVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRA----PKCNLKCVDLY---ASCKPHAKKC-IQSIY--------RYTCCKSCS 1948
             + ++K+ E +    W   D W  CS +C  G ++  + CI+ S  T + V    C          + CN   C     W   K+S+CS +CGS G   R V+C       D    ++V  D + C    +P+ + +CN++ CP T V  +W +C ++  C +G +RR + C      GK +  P   C +  KP       +   +  E L +               Q  + K L + +G +A +Y  T I I CP   F  + I WK +G  I     K+   I+V   G LR+     +D G + C       N +   K R+           P +     + R  +  +++L E   V    N                           V +W    WS+C   TC V G+Q+R + C+ +       +D+S+CE     +P   R C     CP+W+ +  + +  + +C+     +   N+ C    G  ++   CD   +    M+CPN+ C+  W+TS+W  CS  CG  G+  R L C+W ++  PAG  C  +++  P   ++C A    P C      LY   ASC+  ++ C I  ++        R  CC +C+
Sbjct:  437 LQEDSKLSEDEAPYQWRYGD-WTQCSASCLGGKQKAALKCIQVS--TGKSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDR-CHFK-KPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLSN-----------RVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI-----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQWS-ECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNC--EQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCT 1036          

HSP 2 Score: 53.9138 bits (128), Expect = 4.738e-7
Identity = 53/209 (25.36%), Postives = 78/209 (37.32%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYV--WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLT------------------------------LVPGEWGKCKKNHKCSAGTQRRPMTCISILK-NGKPKSMPRHACSSTIKP 823
            W+  D W  C   CG GTR+++V C++ +      V D  C+      P  +E    NC       W+ GKWS+C+ +CG  G + R V CV          SD   C+   RP   ++C   I C +                               LV GEW  C     C  G   R + C+++   +  P  +P   C    +P
Sbjct:  237 WMAAD-WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCEN--GTRPAAEE----NCVSTSCGRWEAGKWSKCTASCG-QGVRRRHVACVG--------GSD---CDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSST--CGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP 424          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 161.77 bits (408), Expect = 1.354e-40
Identity = 157/630 (24.92%), Postives = 259/630 (41.11%), Query Frame = 2
Query:  254 FKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVY-----DEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWK-HGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAG--PKNASAIIKVRN-----------PAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNE--------------------------VIQWIKKGWSQC-SVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRA----PKCNLKCVDLY---ASCKPHAKKC-IQSIY--------RYTCCKSCS 1948
             + ++K+ E +    W   D W  CS +C  G ++  + CI+ S  T + V    C          + CN   C     W   K+S+CS +CGS G   R V+C       D    ++V  D + C    +P+ + +CN++ CP T V  +W +C ++  C +G +RR + C      GK +  P   C +  KP       +   +  E L +               Q  + K L + +G +A +Y  T I I CP   F  + I WK +G  I     K+   I+V   G LR+     +D G + C       N +   K R+           P +     + R  +  +++L E   V    N                           V +W    WS+C   TC V G+Q+R + C+ +       +D+S+CE     +P   R C     CP+W+ +  + +  + +C+     +   N+ C    G  ++   CD   +    M+CPN+ C+  W+TS+W  CS  CG  G+  R L C+W ++  PAG  C  +++  P   ++C A    P C      LY   ASC+  ++ C I  ++        R  CC +C+
Sbjct:  439 LQEDSKLSEDEAPYQWRYGD-WTQCSASCLGGKQKAALKCIQVS--TGKSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDR-CHFK-KPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLSN-----------RVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI-----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQWS-ECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNC--EQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCT 1038          

HSP 2 Score: 53.9138 bits (128), Expect = 5.432e-7
Identity = 53/209 (25.36%), Postives = 78/209 (37.32%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYV--WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLT------------------------------LVPGEWGKCKKNHKCSAGTQRRPMTCISILK-NGKPKSMPRHACSSTIKP 823
            W+  D W  C   CG GTR+++V C++ +      V D  C+      P  +E    NC       W+ GKWS+C+ +CG  G + R V CV          SD   C+   RP   ++C   I C +                               LV GEW  C     C  G   R + C+++   +  P  +P   C    +P
Sbjct:  239 WMAAD-WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCEN--GTRPAAEE----NCVSTSCGRWEAGKWSKCTASCG-QGVRRRHVACVG--------GSD---CDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSST--CGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP 426          

HSP 3 Score: 50.8322 bits (120), Expect = 4.965e-6
Identity = 53/204 (25.98%), Postives = 85/204 (41.67%), Query Frame = 2
Query:  239 LISETFKVNA-KIKESQTQT------FWLEVDEWNSCSTTC-------GPG-----TRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS---ILKNGKPK 784
            LIS +F+ +A  +   +  T       W   +E+ +C++ C       G G     T Q  V+C+     T  +V ++LC          + C +  C     W    W+EC   CG   RK R+V CV    +  +   D+ +CE   RP A  +C    C      G+W KC  +  C  G +RR + C+      + G+P+
Sbjct:  138 LISSSFRFDACGVCGGRGDTCDNGKFIWKVSEEYTACASNCDDIVDWSGAGRSIASTSQPIVVCVNA--ITGRVVPEKLCADKLRPKVEARPCPMLICPSRCRWMAADWTECVPHCGEGTRK-REVYCVQTAHNVTVHVPDT-FCENGTRPAAEENCVSTSCG-RWEAGKWSKCTAS--CGQGVRRRHVACVGGSDCDEGGRPR 334          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 73.9442 bits (180), Expect = 4.388e-13
Identity = 47/150 (31.33%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYD----NYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            W+SCS TCG G R+++V C +     + +VSD  C      +P  K  ++ NC+      Y W    WS+C   C    ++TR V C+   G      +  + CE +  P +   C+  +CP   VPG+W  C K+  C  G Q R + C
Sbjct: 1702 WSSCSVTCGRGIRRREVQCYRGR---KNLVSDSEC------NPKTKLNSVANCFPVACPAYRWNVTPWSKCKDECARGQKQTRRVHCISTSGK----RAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKS--CGEGVQTREVRC 1836          

HSP 2 Score: 72.0182 bits (175), Expect = 1.693e-12
Identity = 52/180 (28.89%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPL------TLVPGEWGKCKKNHKCSAGTQRRPMTCISIL--KNGKPKSMPRHACSSTIKPPVS 832
            W +CS TCG GT+++ + C        +   + L K V     + + C L +C     WK  +W EC  TCG++ +++R+V CV  E  G  +  D   C+   RP ++ +C +  CP       + + G+W KC  +  C  G +RR ++C S    +  KPK   +  C+  + PP++
Sbjct: 1376 WTACSATCGNGTQRRLLKCRDHVRDLPDEYCNHLDKEV-----STRNCRLRDCS---YWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVD-CDVQKRPTSARNCRLEPCPKGEEHIGSWIIGDWSKCSAS--CGGGWRRRSVSCTSSSCDETRKPKMFDK--CNEELCPPLT 1542          

HSP 3 Score: 70.8626 bits (172), Expect = 3.284e-12
Identity = 62/197 (31.47%), Postives = 84/197 (42.64%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC--------------PLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            FW   D W++CS +CG G R++   CI    Y E+ V    C     +  T + C+L  C     WKP  WS CS TCGS G +TR V C      G +V  D  +C+ + RP    +C    C              P+    G W  C     C  GTQRR + C   +++     +P   C+   K  VS R C
Sbjct: 1243 FWRNTD-WSACSVSCGIGHRERTTECI----YREQSVDASFCGDTK-MPETSQTCHLLPCTS---WKPSHWSPCSVTCGS-GIQTRSVSCTRGS-EGTIV--DEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTACSAT--CGNGTQRRLLKCRDHVRD-----LPDEYCNHLDK-EVSTRNC 1418          

HSP 4 Score: 70.4774 bits (171), Expect = 4.496e-12
Identity = 46/150 (30.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            ++ EW+ CS +C  G   ++V C+  +    +M    LC T      + + CNLG C     W+   WS CS +CG  G + R  EC+Y E S      D+ +C  +  PE S +C+++ C  +  P  W  C     C +G Q R ++C
Sbjct: 1188 KLGEWSQCSVSCEDGWSSRRVSCVSGNGTEVDM---SLCGTASDRPASHQTCNLGTC---PFWRNTDWSACSVSCGI-GHRERTTECIYREQS-----VDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVT--CGSGIQTRSVSC 1322          

HSP 5 Score: 67.0106 bits (162), Expect = 5.271e-11
Identity = 48/158 (30.38%), Postives = 70/158 (44.30%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCY---DNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCI 757
            T W+  D  +SCS  CG G ++++V C+K     +   S+ LC          K  ++ +CY       W  G+W+ CS+TCGSNG+  R   CV D         D   C    +      CN I CP   V G W +C ++  C  G + R   C+
Sbjct:  960 TRWITEDV-SSCSAKCGSGQKRQRVSCVKMEGDRQTPASEHLCDR------NSKPSDIASCYIDCSGRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNR----RVDESLCGREQKEATERECNRIPCP-RWVYGHWSECSRS--CDGGVKMRHAQCL 1103          

HSP 6 Score: 62.7734 bits (151), Expect = 1.118e-9
Identity = 55/177 (31.07%), Postives = 83/177 (46.89%), Query Frame = 2
Query: 1331 WSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCN 1855
            WSQCSV+C  +G+ SR V C          +D S+C      +P + +TC + T CP W+ T  +   C+  C   G G  E    CI++ Q ++AS C   K  + +  C    C   WK S+WS CS +CG  GI  R + C  + +E       +  +   P + K+C    C+
Sbjct: 1192 WSQCSVSC-EDGWSSRRVSCVSGNGTE---VDMSLC-GTASDRPASHQTCNLGT-CPFWRNTDWSA--CSVSC---GIGHRERTTECIYREQSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVTCGS-GIQTRSVSCT-RGSEGTIVDEYFCDRNTRPRLKKTCEKDTCD 1354          

HSP 7 Score: 58.151 bits (139), Expect = 2.642e-8
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 2
Query:  308 VDEWNSCSTTCGPGTRQ-KKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLV----------NSDSKYCEPSLRPEASSSC--NIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            V  W+ C   C  G +Q ++V CI  S    +  +  +C+     + +I+EC+  NC   Y W PG W  CS++CG  G +TR+V C       + +              + CE   +P  S +C  N  D       G WG+C KN  C  G +RR + C++
Sbjct: 1757 VTPWSKCKDECARGQKQTRRVHCISTS---GKRAAPRMCELARAPT-SIRECDTSNC--PYEWVPGDWQTCSKSCG-EGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKN--CGQGIRRRRVKCVA 1911          

HSP 8 Score: 56.9954 bits (136), Expect = 5.861e-8
Identity = 60/186 (32.26%), Postives = 88/186 (47.31%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVS--DELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPL---TLVPGEWGKCKKNHKCSAGT-QRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            +   W++CS  CG GT+++ V C+  S       +  D+  K V  +    K C          WK   WS CS TCG  G + R+V+C    G  NLV SDS+ C P  +  + ++C  + CP     + P  W KCK   +C+ G  Q R + CIS   +GK ++ PR       + P S R+C
Sbjct: 1641 QTSAWSACSAKCGRGTKRRVVECVNPSLNVTVASTECDQTKKPVEEVRCRTKHCPR--------WKTTTWSSCSVTCG-RGIRRREVQCY--RGRKNLV-SDSE-CNPKTKLNSVANCFPVACPAYRWNVTP--WSKCKD--ECARGQKQTRRVHCIST--SGK-RAAPRMC--ELARAPTSIREC 1804          

HSP 9 Score: 52.7582 bits (125), Expect = 1.228e-6
Identity = 57/219 (26.03%), Postives = 86/219 (39.27%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH-QGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC------------IWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYR 1924
            +W    WS CSVTCG  G + REV C +  K   N++ DS C  K +   +    C     CP ++        C ++C R    K    +HCI   G+      C+  +      EC    C   W   +W  CS+SCG  G+  R + C            I+   ++PA      +  P P   ++C    C+ +    +      +K C Q I R
Sbjct: 1696 RWKTTTWSSCSVTCG-RGIRRREVQCYRGRK---NLVSDSECNPKTKLNSVA--NC-FPVACPAYRWNVTPWSKCKDECAR--GQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKNCGQGIRR 1904          

HSP 10 Score: 51.9878 bits (123), Expect = 1.892e-6
Identity = 50/160 (31.25%), Postives = 70/160 (43.75%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-------WKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKC----QVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W    W +C  TCG    QSR V C  +E     IL D  C+   QK+P + R C++   CPK       W +   +   C+  C   G G    ++ C        +S+CD+  K  M  +C  E C       W+ S W+ CS SCGG G+  R + C
Sbjct: 1426 WKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDCDV--QKRPTSARNCRLEP-CPKGEEHIGSWIIGDWS--KCSASC---GGGWRRRSVSCT-------SSSCDETRKPKMFDKCNEELCPPLTNNSWQISPWTHCSVSCGG-GVQRRKIWC 1569          

HSP 11 Score: 51.2174 bits (121), Expect = 3.541e-6
Identity = 49/179 (27.37%), Postives = 75/179 (41.90%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC-EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVS 832
            W +   W+ CS  CG G + +   C  +      ++ +  C  +  I    K C+  +C     +K G+WS+CS +C  +G  +R V CV    SGN    D   C   S RP +  +CN+  CP      +W  C  +  C  G + R   CI      + +S+    C  T  P  S
Sbjct: 1131 WWQFGVWSDCSAKCGDGVQYRDANCTDRH---RSVLPEHRCLKMEKI--ITKPCHRESCPK---YKLGEWSQCSVSC-EDGWSSRRVSCV----SGNGTEVDMSLCGTASDRPASHQTCNLGTCPF-WRNTDWSACSVS--CGIGHRERTTECIY-----REQSVDASFCGDTKMPETS 1288          

HSP 12 Score: 50.8322 bits (120), Expect = 4.414e-6
Identity = 33/105 (31.43%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-----------EEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEG 580
            W+  D W +CS +CG G + ++V C +K  +            E  V  E C+  P  + + + C L  C   + W  G W ECS+ CG   R+ R V+CV ++G
Sbjct: 1813 WVPGD-WQTCSKSCGEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNES-QTCELNPCDSEFKWSFGPWGECSKNCGQGIRRRR-VKCVANDG 1914          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 73.559 bits (179), Expect = 4.771e-13
Identity = 47/150 (31.33%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYD----NYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            W+SCS TCG G R+++V C +     + +VSD  C      +P  K  ++ NC+      Y W    WS+C   C    ++TR V C+   G      +  + CE +  P +   C+  +CP   VPG+W  C K+  C  G Q R + C
Sbjct: 1687 WSSCSVTCGRGIRRREVQCYRGR---KNLVSDSEC------NPKTKLNSVANCFPVACPAYRWNVTPWSKCKDECARGQKQTRRVHCISTSGK----RAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKS--CGEGVQTREVRC 1821          

HSP 2 Score: 72.0182 bits (175), Expect = 1.706e-12
Identity = 52/180 (28.89%), Postives = 88/180 (48.89%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPL------TLVPGEWGKCKKNHKCSAGTQRRPMTCISIL--KNGKPKSMPRHACSSTIKPPVS 832
            W +CS TCG GT+++ + C        +   + L K V     + + C L +C     WK  +W EC  TCG++ +++R+V CV  E  G  +  D   C+   RP ++ +C +  CP       + + G+W KC  +  C  G +RR ++C S    +  KPK   +  C+  + PP++
Sbjct: 1361 WTACSATCGNGTQRRLLKCRDHVRDLPDEYCNHLDKEV-----STRNCRLRDCS---YWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVD-CDVQKRPTSARNCRLEPCPKGEEHIGSWIIGDWSKCSAS--CGGGWRRRSVSCTSSSCDETRKPKMFDK--CNEELCPPLT 1527          

HSP 3 Score: 70.8626 bits (172), Expect = 3.663e-12
Identity = 62/197 (31.47%), Postives = 84/197 (42.64%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC--------------PLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            FW   D W++CS +CG G R++   CI    Y E+ V    C     +  T + C+L  C     WKP  WS CS TCGS G +TR V C      G +V  D  +C+ + RP    +C    C              P+    G W  C     C  GTQRR + C   +++     +P   C+   K  VS R C
Sbjct: 1228 FWRNTD-WSACSVSCGIGHRERTTECI----YREQSVDASFCGDTK-MPETSQTCHLLPCTS---WKPSHWSPCSVTCGS-GIQTRSVSCTRGS-EGTIV--DEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTACSAT--CGNGTQRRLLKCRDHVRD-----LPDEYCNHLDK-EVSTRNC 1403          

HSP 4 Score: 70.4774 bits (171), Expect = 4.807e-12
Identity = 46/150 (30.67%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            ++ EW+ CS +C  G   ++V C+  +    +M    LC T      + + CNLG C     W+   WS CS +CG  G + R  EC+Y E S      D+ +C  +  PE S +C+++ C  +  P  W  C     C +G Q R ++C
Sbjct: 1173 KLGEWSQCSVSCEDGWSSRRVSCVSGNGTEVDM---SLCGTASDRPASHQTCNLGTC---PFWRNTDWSACSVSCGI-GHRERTTECIYREQS-----VDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVT--CGSGIQTRSVSC 1307          

HSP 5 Score: 67.0106 bits (162), Expect = 5.635e-11
Identity = 48/158 (30.38%), Postives = 70/158 (44.30%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCY---DNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCI 757
            T W+  D  +SCS  CG G ++++V C+K     +   S+ LC          K  ++ +CY       W  G+W+ CS+TCGSNG+  R   CV D         D   C    +      CN I CP   V G W +C ++  C  G + R   C+
Sbjct:  945 TRWITEDV-SSCSAKCGSGQKRQRVSCVKMEGDRQTPASEHLCDR------NSKPSDIASCYIDCSGRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNR----RVDESLCGREQKEATERECNRIPCP-RWVYGHWSECSRS--CDGGVKMRHAQCL 1088          

HSP 6 Score: 62.7734 bits (151), Expect = 1.226e-9
Identity = 55/177 (31.07%), Postives = 83/177 (46.89%), Query Frame = 2
Query: 1331 WSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCN 1855
            WSQCSV+C  +G+ SR V C          +D S+C      +P + +TC + T CP W+ T  +   C+  C   G G  E    CI++ Q ++AS C   K  + +  C    C   WK S+WS CS +CG  GI  R + C  + +E       +  +   P + K+C    C+
Sbjct: 1177 WSQCSVSC-EDGWSSRRVSCVSGNGTE---VDMSLC-GTASDRPASHQTCNLGT-CPFWRNTDWSA--CSVSC---GIGHRERTTECIYREQSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPCSVTCGS-GIQTRSVSCT-RGSEGTIVDEYFCDRNTRPRLKKTCEKDTCD 1339          

HSP 7 Score: 58.151 bits (139), Expect = 2.973e-8
Identity = 48/164 (29.27%), Postives = 74/164 (45.12%), Query Frame = 2
Query:  308 VDEWNSCSTTCGPGTRQ-KKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLV----------NSDSKYCEPSLRPEASSSC--NIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            V  W+ C   C  G +Q ++V CI  S    +  +  +C+     + +I+EC+  NC   Y W PG W  CS++CG  G +TR+V C       + +              + CE   +P  S +C  N  D       G WG+C KN  C  G +RR + C++
Sbjct: 1742 VTPWSKCKDECARGQKQTRRVHCISTS---GKRAAPRMCELARAPT-SIRECDTSNC--PYEWVPGDWQTCSKSCG-EGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKN--CGQGIRRRRVKCVA 1896          

HSP 8 Score: 56.9954 bits (136), Expect = 6.484e-8
Identity = 60/186 (32.26%), Postives = 88/186 (47.31%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVS--DELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPL---TLVPGEWGKCKKNHKCSAGT-QRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            +   W++CS  CG GT+++ V C+  S       +  D+  K V  +    K C          WK   WS CS TCG  G + R+V+C    G  NLV SDS+ C P  +  + ++C  + CP     + P  W KCK   +C+ G  Q R + CIS   +GK ++ PR       + P S R+C
Sbjct: 1626 QTSAWSACSAKCGRGTKRRVVECVNPSLNVTVASTECDQTKKPVEEVRCRTKHCPR--------WKTTTWSSCSVTCG-RGIRRREVQCY--RGRKNLV-SDSE-CNPKTKLNSVANCFPVACPAYRWNVTP--WSKCKD--ECARGQKQTRRVHCIST--SGK-RAAPRMC--ELARAPTSIREC 1789          

HSP 9 Score: 52.7582 bits (125), Expect = 1.324e-6
Identity = 57/219 (26.03%), Postives = 86/219 (39.27%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH-QGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC------------IWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYR 1924
            +W    WS CSVTCG  G + REV C +  K   N++ DS C  K +   +    C     CP ++        C ++C R    K    +HCI   G+      C+  +      EC    C   W   +W  CS+SCG  G+  R + C            I+   ++PA      +  P P   ++C    C+ +    +      +K C Q I R
Sbjct: 1681 RWKTTTWSSCSVTCG-RGIRRREVQCYRGRK---NLVSDSECNPKTKLNSVA--NC-FPVACPAYRWNVTPWSKCKDECAR--GQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKNCGQGIRR 1889          

HSP 10 Score: 51.9878 bits (123), Expect = 2.006e-6
Identity = 50/160 (31.25%), Postives = 70/160 (43.75%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-------WKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKC----QVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W    W +C  TCG    QSR V C  +E     IL D  C+   QK+P + R C++   CPK       W +   +   C+  C   G G    ++ C        +S+CD+  K  M  +C  E C       W+ S W+ CS SCGG G+  R + C
Sbjct: 1411 WKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDCDV--QKRPTSARNCRLEP-CPKGEEHIGSWIIGDWS--KCSASC---GGGWRRRSVSCT-------SSSCDETRKPKMFDKCNEELCPPLTNNSWQISPWTHCSVSCGG-GVQRRKIWC 1554          

HSP 11 Score: 51.2174 bits (121), Expect = 3.787e-6
Identity = 49/179 (27.37%), Postives = 75/179 (41.90%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC-EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVS 832
            W +   W+ CS  CG G + +   C  +      ++ +  C  +  I    K C+  +C     +K G+WS+CS +C  +G  +R V CV    SGN    D   C   S RP +  +CN+  CP      +W  C  +  C  G + R   CI      + +S+    C  T  P  S
Sbjct: 1116 WWQFGVWSDCSAKCGDGVQYRDANCTDRH---RSVLPEHRCLKMEKI--ITKPCHRESCPK---YKLGEWSQCSVSC-EDGWSSRRVSCV----SGNGTEVDMSLCGTASDRPASHQTCNLGTCPF-WRNTDWSACSVS--CGIGHRERTTECIY-----REQSVDASFCGDTKMPETS 1273          

HSP 12 Score: 50.8322 bits (120), Expect = 4.720e-6
Identity = 33/105 (31.43%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-----------EEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEG 580
            W+  D W +CS +CG G + ++V C +K  +            E  V  E C+  P  + + + C L  C   + W  G W ECS+ CG   R+ R V+CV ++G
Sbjct: 1798 WVPGD-WQTCSKSCGEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNES-QTCELNPCDSEFKWSFGPWGECSKNCGQGIRRRR-VKCVANDG 1899          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085902)

HSP 1 Score: 104.375 bits (259), Expect = 1.833e-22
Identity = 91/320 (28.44%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  260 VNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYD--EGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQM--RKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVR 1207
            +   + E      W E   + SCS +C  G  +  + C+++      +VS  LC         ++ CN   C     W    ++ CS++CG  G KTR+V+C+++   G  N +   +  C P   P     CN++DCP+    GEW KC  +H C  G + R + C  I+        P   C S    P   + C    N K C  +    P+I+I  +T +Q   +KTK + + VG    V+  T++ I CPV  +    I W   +       K K    V KKG LRI     +D G ++C AG  +A   I+V+
Sbjct:  616 IKVGVSEPGKTYVWRE-QGYTSCSASCLGGVEELIINCVRED--NGRVVSPFLCSPETKPEARVRTCNDRPCPPR--WNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMC-PQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSA--KPADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTK-ITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 56.6102 bits (135), Expect = 8.492e-8
Identity = 46/152 (30.26%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  236 VLISETFKVNAKIKESQTQT---FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLTL 679
             L S T +  A +++  T +    W+  D+W++CS  CG G R++ V+C ++S   +  V+D +C+T     PT + C +  C     W+   W+ CS +CG  G + R VEC   +GS       S  C+P  +P +   C+  I C  +L
Sbjct:  291 TLCSVTNRPEASVEQCNTHSCPPRWI-ADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCRTPK--PPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSL------SAKCDPLTKPGSMQQCSTGIHCGGSL 429          

HSP 3 Score: 50.447 bits (119), Expect = 6.641e-6
Identity = 46/155 (29.68%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            F  E+   + CS TCG G +  + IC  ++  T   V D LC        ++++CN  +C     W    WS CS+ CG +G + R V C  +E +G         C  + +P    +C I +CP   V  +W  C  +  C  G Q R + C S
Sbjct:  254 FNWEMAPMSQCSVTCGSGYKMSRPIC--RNRLTNADVDDTLCSVTNRPEASVEQCNTHSCPPR--WIADDWSTCSRLCG-HGYRERMVVCA-EESNGIKTRVADIMCR-TPKPPTQETCIIEECPHWEVE-DWTGCSVS--CGQGIQMRGVECKS 398          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0307497)

HSP 1 Score: 104.375 bits (259), Expect = 1.941e-22
Identity = 91/320 (28.44%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  260 VNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYD--EGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQM--RKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVR 1207
            +   + E      W E   + SCS +C  G  +  + C+++      +VS  LC         ++ CN   C     W    ++ CS++CG  G KTR+V+C+++   G  N +   +  C P   P     CN++DCP+    GEW KC  +H C  G + R + C  I+        P   C S    P   + C    N K C  +    P+I+I  +T +Q   +KTK + + VG    V+  T++ I CPV  +    I W   +       K K    V KKG LRI     +D G ++C AG  +A   I+V+
Sbjct:  616 IKVGVSEPGKTYVWRE-QGYTSCSASCLGGVEELIINCVRED--NGRVVSPFLCSPETKPEARVRTCNDRPCPPR--WNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMC-PQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAK--PADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTK-ITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 94.3597 bits (233), Expect = 2.383e-19
Identity = 72/238 (30.25%), Postives = 107/238 (44.96%), Query Frame = 2
Query: 1307 VIQWIKKGWSQCSVTCGV--EGFQSREVHCEQSEKQ---------HYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK--------CVDLYASCKPHAKKCIQSIYRY--TCCKSCSR 1951
            V +W+   WSQCS  CG    G Q R V C+++ K            N++D+S C   G + P   ++C     CP+W      P    + C           + C +     E S CD+ E+  M  EC NE+C+  W+   WS+C+  CG  GI  R L C+W  +  PAG++C  Q  P P V+K C++P C  +        C D    C+      +  ++RY   CC SC +
Sbjct: 1154 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGNEA-CPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1386          

HSP 3 Score: 56.9954 bits (136), Expect = 7.391e-8
Identity = 46/152 (30.26%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  236 VLISETFKVNAKIKESQTQT---FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLTL 679
             L S T +  A +++  T +    W+  D+W++CS  CG G R++ V+C ++S   +  V+D +C+T     PT + C +  C     W+   W+ CS +CG  G + R VEC   +GS       S  C+P  +P +   C+  I C  +L
Sbjct:  291 TLCSVTNRPEASVEQCNTHSCPPRWI-ADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCRT--PKPPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSL------SAKCDPLTKPGSMQQCSTGIHCGGSL 429          

HSP 4 Score: 50.447 bits (119), Expect = 6.772e-6
Identity = 46/155 (29.68%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            F  E+   + CS TCG G +  + IC  ++  T   V D LC        ++++CN  +C     W    WS CS+ CG +G + R V C  +E +G         C  + +P    +C I +CP   V  +W  C  +  C  G Q R + C S
Sbjct:  254 FNWEMAPMSQCSVTCGSGYKMSRPIC--RNRLTNADVDDTLCSVTNRPEASVEQCNTHSCPPR--WIADDWSTCSRLCG-HGYRERMVVCA-EESNGIKTRVADIMCR-TPKPPTQETCIIEECPHWEVE-DWTGCSVS--CGQGIQMRGVECKS 398          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0110959)

HSP 1 Score: 104.375 bits (259), Expect = 1.941e-22
Identity = 91/320 (28.44%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  260 VNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYD--EGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQM--RKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVR 1207
            +   + E      W E   + SCS +C  G  +  + C+++      +VS  LC         ++ CN   C     W    ++ CS++CG  G KTR+V+C+++   G  N +   +  C P   P     CN++DCP+    GEW KC  +H C  G + R + C  I+        P   C S    P   + C    N K C  +    P+I+I  +T +Q   +KTK + + VG    V+  T++ I CPV  +    I W   +       K K    V KKG LRI     +D G ++C AG  +A   I+V+
Sbjct:  616 IKVGVSEPGKTYVWRE-QGYTSCSASCLGGVEELIINCVRED--NGRVVSPFLCSPETKPEARVRTCNDRPCPPR--WNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMC-PQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAK--PADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTK-ITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 94.3597 bits (233), Expect = 2.383e-19
Identity = 72/238 (30.25%), Postives = 107/238 (44.96%), Query Frame = 2
Query: 1307 VIQWIKKGWSQCSVTCGV--EGFQSREVHCEQSEKQ---------HYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK--------CVDLYASCKPHAKKCIQSIYRY--TCCKSCSR 1951
            V +W+   WSQCS  CG    G Q R V C+++ K            N++D+S C   G + P   ++C     CP+W      P    + C           + C +     E S CD+ E+  M  EC NE+C+  W+   WS+C+  CG  GI  R L C+W  +  PAG++C  Q  P P V+K C++P C  +        C D    C+      +  ++RY   CC SC +
Sbjct: 1154 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGNEA-CPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1386          

HSP 3 Score: 56.9954 bits (136), Expect = 7.391e-8
Identity = 46/152 (30.26%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  236 VLISETFKVNAKIKESQTQT---FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLTL 679
             L S T +  A +++  T +    W+  D+W++CS  CG G R++ V+C ++S   +  V+D +C+T     PT + C +  C     W+   W+ CS +CG  G + R VEC   +GS       S  C+P  +P +   C+  I C  +L
Sbjct:  291 TLCSVTNRPEASVEQCNTHSCPPRWI-ADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCRT--PKPPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSL------SAKCDPLTKPGSMQQCSTGIHCGGSL 429          

HSP 4 Score: 50.447 bits (119), Expect = 6.772e-6
Identity = 46/155 (29.68%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            F  E+   + CS TCG G +  + IC  ++  T   V D LC        ++++CN  +C     W    WS CS+ CG +G + R V C  +E +G         C  + +P    +C I +CP   V  +W  C  +  C  G Q R + C S
Sbjct:  254 FNWEMAPMSQCSVTCGSGYKMSRPIC--RNRLTNADVDDTLCSVTNRPEASVEQCNTHSCPPR--WIADDWSTCSRLCG-HGYRERMVVCA-EESNGIKTRVADIMCR-TPKPPTQETCIIEECPHWEVE-DWTGCSVS--CGQGIQMRGVECKS 398          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0301000)

HSP 1 Score: 104.375 bits (259), Expect = 2.040e-22
Identity = 91/320 (28.44%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  260 VNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYD--EGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQM--RKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVR 1207
            +   + E      W E   + SCS +C  G  +  + C+++      +VS  LC         ++ CN   C     W    ++ CS++CG  G KTR+V+C+++   G  N +   +  C P   P     CN++DCP+    GEW KC  +H C  G + R + C  I+        P   C S    P   + C    N K C  +    P+I+I  +T +Q   +KTK + + VG    V+  T++ I CPV  +    I W   +       K K    V KKG LRI     +D G ++C AG  +A   I+V+
Sbjct:  616 IKVGVSEPGKTYVWRE-QGYTSCSASCLGGVEELIINCVRED--NGRVVSPFLCSPETKPEARVRTCNDRPCPPR--WNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMC-PQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSA--KPADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTK-ITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 94.3597 bits (233), Expect = 2.504e-19
Identity = 72/238 (30.25%), Postives = 107/238 (44.96%), Query Frame = 2
Query: 1307 VIQWIKKGWSQCSVTCGV--EGFQSREVHCEQSEKQ---------HYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK--------CVDLYASCKPHAKKCIQSIYRY--TCCKSCSR 1951
            V +W+   WSQCS  CG    G Q R V C+++ K            N++D+S C   G + P   ++C     CP+W      P    + C           + C +     E S CD+ E+  M  EC NE+C+  W+   WS+C+  CG  GI  R L C+W  +  PAG++C  Q  P P V+K C++P C  +        C D    C+      +  ++RY   CC SC +
Sbjct: 1148 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGNEA-CPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1380          

HSP 3 Score: 56.9954 bits (136), Expect = 7.904e-8
Identity = 46/152 (30.26%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  236 VLISETFKVNAKIKESQTQT---FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLTL 679
             L S T +  A +++  T +    W+  D+W++CS  CG G R++ V+C ++S   +  V+D +C+T     PT + C +  C     W+   W+ CS +CG  G + R VEC   +GS       S  C+P  +P +   C+  I C  +L
Sbjct:  291 TLCSVTNRPEASVEQCNTHSCPPRWI-ADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCRT--PKPPTQETCIIEECPH---WEVEDWTGCSVSCG-QGIQMRGVECKSTDGSL------SAKCDPLTKPGSMQQCSTGIHCGGSL 429          

HSP 4 Score: 50.447 bits (119), Expect = 6.942e-6
Identity = 46/155 (29.68%), Postives = 69/155 (44.52%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
            F  E+   + CS TCG G +  + IC  ++  T   V D LC        ++++CN  +C     W    WS CS+ CG +G + R V C  +E +G         C  + +P    +C I +CP   V  +W  C  +  C  G Q R + C S
Sbjct:  254 FNWEMAPMSQCSVTCGSGYKMSRPIC--RNRLTNADVDDTLCSVTNRPEASVEQCNTHSCPPR--WIADDWSTCSRLCG-HGYRERMVVCA-EESNGIKTRVADIMCR-TPKPPTQETCIIEECPHWEVE-DWTGCSVS--CGQGIQMRGVECKS 398          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339132)

HSP 1 Score: 103.99 bits (258), Expect = 2.306e-22
Identity = 91/320 (28.44%), Postives = 141/320 (44.06%), Query Frame = 2
Query:  260 VNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYD--EGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQM--RKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVR 1207
            +   + E      W E   + SCS +C  G  +  + C+++      +VS  LC         ++ CN   C     W    ++ CS++CG  G KTR+V+C+++   G  N +   +  C P   P     CN++DCP+    GEW KC  +H C  G + R + C  I+        P   C S    P   + C    N K C  +    P+I+I  +T +Q   +KTK + + VG    V+  T++ I CPV  +    I W   +       K K    V KKG LRI     +D G ++C AG  +A   I+V+
Sbjct:  609 IKVGVSEPGKTYVWRE-QGYTSCSASCLGGVEELIINCVRED--NGRVVSPFLCSPETKPEARVRTCNDRPCPPR--WNYSDYTPCSKSCGI-GIKTREVQCIHEVTRGGDNTMVVPNSMC-PQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSA--KPADKKPC----NVKPCPPE-DPKPVIQINNSTHIQHDPKKTK-ITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKYK----VSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 907          

HSP 2 Score: 94.3597 bits (233), Expect = 2.741e-19
Identity = 72/238 (30.25%), Postives = 107/238 (44.96%), Query Frame = 2
Query: 1307 VIQWIKKGWSQCSVTCGV--EGFQSREVHCEQSEKQ---------HYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK--------CVDLYASCKPHAKKCIQSIYRY--TCCKSCSR 1951
            V +W+   WSQCS  CG    G Q R V C+++ K            N++D+S C   G + P   ++C     CP+W      P    + C           + C +     E S CD+ E+  M  EC NE+C+  W+   WS+C+  CG  GI  R L C+W  +  PAG++C  Q  P P V+K C++P C  +        C D    C+      +  ++RY   CC SC +
Sbjct: 1106 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGNEA-CPQWSKGDWTPCQ-RSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQ 1338          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 109.383 bits (272), Expect = 7.412e-24
Identity = 90/308 (29.22%), Postives = 141/308 (45.78%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKK--SFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLT-LVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            EV  WN CS +CG G + + V C++      TE + S +  +  P     ++ CN   C  +  W+  +W +CS +CG  G + R V C     +G+      + C    +P+    C   DC L  L  GEW KC     C  G QRR   C     +G+  ++ R +CS    PP+        C  H ++K+     R P +I +K+   +Q R  K L+  +G  AY+   T ++I CPV +F    I W K G+ +      S   + + K G LRI   E++D G + C A   + + I+K+
Sbjct:  709 EVSVWNLCSVSCGVGLQTRSVSCVRSVAGNRTESLSSKDCVEKRPN---ELQACNQVACPPS--WEAEEWQQCSHSCG-RGSQWRKVYCKQRLATGSYRRLRDEDCS-GPKPDVHRICTNADCLLPRLEGGEWSKCSVT--CGKGVQRREPVCRRQTASGQLVTLDRTSCSDLPLPPLIRSCRMSPCNKHKHSKK-----RCPQVIGLKR-IYIQNRPEKRLSFTIGGRAYLLPKTTVIIKCPVRHFPKAQIRWEKDGDEL-----TSSKRLSITKSGALRIYNLEAEDIGVYRCWANQDSDTFILKL 996          

HSP 2 Score: 69.707 bits (169), Expect = 1.337e-11
Identity = 58/177 (32.77%), Postives = 83/177 (46.89%), Query Frame = 2
Query:  287 TQTFWLEVDEWNSCSTTCG-PGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKC---SAGTQRRPMTCI----SILKNGKPKSMP 793
            +Q F   + +W++CS++CG  GT+ KK+ C+          S   C  +P  S   + CNL +C  +  W    WS CS +CG  G + R V C   E SG++    S  CE S RPE    C+   C +  + G WGKC    +C   +  TQ R ++C     S  K   PK  P
Sbjct: 1484 SQEFEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRES---SHAACHYLPKPSSQTRPCNLLHCPPS--WVSTVWSRCSSSCG-RGFRERRVSCQQVEASGSVKVLPSSECEGSPRPEDRQECSSQAC-VEWISGPWGKCAG--RCLGPAMATQTRTVSCRLFSNSTSKTCDPKERP 1651          

HSP 3 Score: 69.3218 bits (168), Expect = 1.878e-11
Identity = 55/195 (28.21%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            W E D +  CS TCG G +     C+   +     V++ LC + P     +P +KECN+  C           YD++     W+   W+ CS +CG  G + R + CV ++  G +V  +   C  S RP +  +CN  DCP  +   EW +C     C  G + R + C+    NG+        C+  +KP +
Sbjct:  343 WRETD-FFPCSVTCGGGYQLNSADCVDIRY--NRSVAEHLCHSFPENTKPTPKLKECNMEPCPESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCG-GGSQERSIVCVEEDVHGQIVQVEDWKCTHSPRPISKQNCNTFDCPQWMA-MEWSQCTVT--CGPGLRYRVVLCVDY--NGQHAG----GCNPHLKPHI 524          

HSP 4 Score: 67.781 bits (164), Expect = 4.621e-11
Identity = 63/218 (28.90%), Postives = 97/218 (44.50%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQ-HYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINP-DNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWK-NTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKK---CIQSIYRYTCCKSC 1945
            W+   WS+CS +CG  GF+ R V C+Q E      +L  S CE  G  +P  R+ C  +  C +W ++G  P   C  +C+          + C        +  CD KE+ +    C +E C V WK   W  C+ +CG  G  +R + C+ + N +      C  Q+ P+    + C    C  +C D    C P  K+   C   +YR  CC++C
Sbjct: 1548 WVSTVWSRCSSSCG-RGFRERRVSCQQVEASGSVKVLPSSECE--GSPRPEDRQECS-SQACVEW-ISG--PWGKCAGRCLGPAMATQTRTVSCRLFSNST-SKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVACGS-GFQSRRVECVHRQNKKTLPDQHCAWQRRPV--TWQHCNITSCGSECKDRTHYC-PAVKRLKLCSVDLYRQRCCQTC 1753          

HSP 5 Score: 59.3066 bits (142), Expect = 1.807e-8
Identity = 32/114 (28.07%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS-SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            + W+ G WS CS +CG+ G + + ++CV  EG      S    C    +P + +  CN++ CP + V   W +C  +  C  G + R ++C  +  +G  K +P   C  + +P
Sbjct: 1487 FEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGR----ESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVWSRCSSS--CGRGFRERRVSCQQVEASGSVKVLPSSECEGSPRP 1594          

HSP 6 Score: 55.4546 bits (132), Expect = 3.074e-7
Identity = 51/180 (28.33%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVIC--IKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTC--GSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            W+ CS++CG G R+++V C  ++ S   + + S E C+  P      +EC+   C +   W  G W +C+  C   +   +TR V C          NS SK C+P  RP A  +C+   C +      W  C     C +G Q R + C+        K++P   C+   + PV+W+ C
Sbjct: 1553 WSRCSSSCGRGFRERRVSCQQVEASGSVKVLPSSE-CEGSPRPEDR-QECSSQACVE---WISGPWGKCAGRCLGPAMATQTRTVSCRL------FSNSTSKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTV--ACGSGFQSRRVECV---HRQNKKTLPDQHCAWQRR-PVTWQHC 1715          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts2 (ADAM metallopeptidase with thrombospondin type 1 motif, 2 [Source:ZFIN;Acc:ZDB-GENE-070816-3])

HSP 1 Score: 88.9669 bits (219), Expect = 1.663e-17
Identity = 60/177 (33.90%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  284 QTQTFWLE--VDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC------ISILKNGKPKSM 790
            Q  T + E  + +W+ CS  CG G +  +  C +KS    +MV   LC  +P      + CN   C +  +W  G+W ECS++CG  G +TR V CV  E  G+    ++KYC    RPE    CN   CP     G W +C  +  C  GTQ R + C      I I  + KP+S+
Sbjct:  831 QDDTIYFEWALRKWSHCSKPCGGGKQYTRFGCRRKS--DGKMVHRTLCANIPKPRAISRACNQKECSEP-IWVTGEWEECSKSCGKTGSQTRPVRCVRPELDGSYKAINAKYCNDD-RPEGRRPCNRQLCPAHWRTGPWSQCSVS--CGNGTQERQVMCSTPDNAIGICMDTKPQSV 1001          

HSP 2 Score: 51.9878 bits (123), Expect = 3.519e-6
Identity = 61/244 (25.00%), Postives = 105/244 (43.03%), Query Frame = 2
Query: 1169 AGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDP----EVGMTRNEVI--QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFG---------KIEGNLHCIHQGQIIEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC 1852
             GP     +I V++ ++       + T+  K +L EDP    E  + +++ I  +W  + WS CS  CG  G Q     C +  K    ++  ++C    + + ++R   Q     P W +TG   + C+  C + G           +++G+       + I A  C D + +    C  + C   W+T  WS+CS SCG  G   R ++C   +T D A  +C   K   P+ ++SC    C
Sbjct:  790 TGPLRYGVLIMVQSHSIS------KVTISYKYILPEDPLSSMENTLPQDDTIYFEWALRKWSHCSKPCG-GGKQYTRFGCRR--KSDGKMVHRTLCANIPKPRAISRACNQKECSEPIW-VTG-EWEECSKSCGKTGSQTRPVRCVRPELDGSY------KAINAKYCNDDRPEGRRPCNRQLCPAHWRTGPWSQCSVSCGN-GTQERQVMC---STPDNAIGICMDTK---PQSVRSCLPAPC 1009          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts2 (ADAM metallopeptidase with thrombospondin type 1 motif, 2 [Source:ZFIN;Acc:ZDB-GENE-070816-3])

HSP 1 Score: 88.5817 bits (218), Expect = 1.836e-17
Identity = 60/177 (33.90%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  284 QTQTFWLE--VDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC------ISILKNGKPKSM 790
            Q  T + E  + +W+ CS  CG G +  +  C +KS    +MV   LC  +P      + CN   C +  +W  G+W ECS++CG  G +TR V CV  E  G+    ++KYC    RPE    CN   CP     G W +C  +  C  GTQ R + C      I I  + KP+S+
Sbjct:  796 QDDTIYFEWALRKWSHCSKPCGGGKQYTRFGCRRKS--DGKMVHRTLCANIPKPRAISRACNQKECSEP-IWVTGEWEECSKSCGKTGSQTRPVRCVRPELDGSYKAINAKYCNDD-RPEGRRPCNRQLCPAHWRTGPWSQCSVS--CGNGTQERQVMCSTPDNAIGICMDTKPQSV 966          

HSP 2 Score: 51.9878 bits (123), Expect = 3.843e-6
Identity = 75/319 (23.51%), Postives = 124/319 (38.87%), Query Frame = 2
Query: 1169 AGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDP----EVGMTRNEVI--QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFG---------KIEGNLHCIHQGQIIEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCR---------------------APK--------------CNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKM 1972
             GP     +I V++ ++       + T+  K +L EDP    E  + +++ I  +W  + WS CS  CG  G Q     C +  K    ++  ++C    + + ++R   Q     P W +TG   + C+  C + G           +++G+       + I A  C D + +    C  + C   W+T  WS+CS SCG  G   R ++C   +T D A  +C   K   P+ ++SC                      APK              C ++ + +Y         C    YR  CCKSCS     S+ 
Sbjct:  755 TGPLRYGVLIMVQSHSIS------KVTISYKYILPEDPLSSMENTLPQDDTIYFEWALRKWSHCSKPCG-GGKQYTRFGCRR--KSDGKMVHRTLCANIPKPRAISRACNQKECSEPIW-VTG-EWEECSKSCGKTGSQTRPVRCVRPELDGSY------KAINAKYCNDDRPEGRRPCNRQLCPAHWRTGPWSQCSVSCGN-GTQERQVMC---STPDNAIGICMDTK---PQSVRSCLPAPCPSNFLIQWLSRADPEFPAPKISSRSRCKGDKSVFCRMEVLSMY---------CSNPGYRQMCCKSCSETNYTSQF 1040          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts17 (ADAM metallopeptidase with thrombospondin type 1 motif, 17 [Source:ZFIN;Acc:ZDB-GENE-121030-7])

HSP 1 Score: 84.3445 bits (207), Expect = 3.504e-16
Identity = 59/207 (28.50%), Postives = 92/207 (44.44%), Query Frame = 2
Query:  182 IYLRQMKISWNVFGIVF---LVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMP 793
            ++L  +      +GI +   + L       +  +KE +    W     W  CS  CG G R+  V C++    T   V+D  C+     SP I++CN+  C   Y W  G W++CS TCG  G + R+V C+Y   +G  + +   YC  S +P +   C    C       EW +C    +C  G++RR +TC +      P S P
Sbjct:  692 LHLMVLLFHDQTYGIHYEYTVALNHSQENSSDLVKEPEHMYLWTH-SSWEDCSVHCGGGERRTVVSCMRIINKTMTPVNDSSCQVENKPSPQIRQCNIHPC--QYRWVTGDWTQCSLTCG-KGLQQREVGCIYQLQNGTYIPTRDLYCLSS-KPASVQHCEGRHCLTVWEASEWSQCSS--ECGHGSRRRTVTCTNPHGLCDPVSRP 891          

HSP 2 Score: 50.8322 bits (120), Expect = 8.045e-6
Identity = 40/128 (31.25%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDN---YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC 667
            T W E  EW+ CS+ CG G+R++ V C              LC   PV  P   E     C D+   Y WK G+WS+CS +CG  G ++R V+C++      +       C   L+P     C+   C
Sbjct:  853 TVW-EASEWSQCSSECGHGSRRRTVTCTNPH---------GLCD--PVSRPAEVEA----CEDHSKCYEWKTGEWSKCSSSCG-RGLQSRVVQCMH-----RVSGRHGSDCPAVLKPATYRQCHQSTC 958          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts17 (ADAM metallopeptidase with thrombospondin type 1 motif, 17 [Source:ZFIN;Acc:ZDB-GENE-121030-7])

HSP 1 Score: 84.3445 bits (207), Expect = 3.521e-16
Identity = 59/207 (28.50%), Postives = 92/207 (44.44%), Query Frame = 2
Query:  182 IYLRQMKISWNVFGIVF---LVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMP 793
            ++L  +      +GI +   + L       +  +KE +    W     W  CS  CG G R+  V C++    T   V+D  C+     SP I++CN+  C   Y W  G W++CS TCG  G + R+V C+Y   +G  + +   YC  S +P +   C    C       EW +C    +C  G++RR +TC +      P S P
Sbjct:  719 LHLMVLLFHDQTYGIHYEYTVALNHSQENSSDLVKEPEHMYLWTH-SSWEDCSVHCGGGERRTVVSCMRIINKTMTPVNDSSCQVENKPSPQIRQCNIHPC--QYRWVTGDWTQCSLTCG-KGLQQREVGCIYQLQNGTYIPTRDLYCLSS-KPASVQHCEGRHCLTVWEASEWSQCSS--ECGHGSRRRTVTCTNPHGLCDPVSRP 918          

HSP 2 Score: 50.8322 bits (120), Expect = 7.370e-6
Identity = 40/128 (31.25%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDN---YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC 667
            T W E  EW+ CS+ CG G+R++ V C              LC   PV  P   E     C D+   Y WK G+WS+CS +CG  G ++R V+C++      +       C   L+P     C+   C
Sbjct:  880 TVW-EASEWSQCSSECGHGSRRRTVTCTNPH---------GLCD--PVSRPAEVEA----CEDHSKCYEWKTGEWSKCSSSCG-RGLQSRVVQCMH-----RVSGRHGSDCPAVLKPATYRQCHQSTC 985          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 121.709 bits (304), Expect = 1.618e-27
Identity = 136/556 (24.46%), Postives = 205/556 (36.87%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC---VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPP----------------VSWRKCY------DHMNTKECLKDLRI-----------------------------------PPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV---RNPAVGFQDWKLRTTLWNKEMLNED-PEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCP-----KWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNME---CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            E + +  CS +CG G ++  V+C+ K   T   V + LC       P +K CN+  C     W+ G WS CS TCG  G +TRDV C   +  E +  +V  D    +P  +P    +CN  DCP      EW +C +   C  G   R + C   L +G    +P   CSS+ KPP                  W +C         +    C K L+                                     P I   +   +Q R+ K L   VG  AY+   T +++ CPV  F    I+W+        H  S + + V   G ++I      D G +TC+AGP     IIK+    N  +          +  K   NE        +N  +    K   Q  +T     + S   H    +K  Y I        +     ++     +A  C      +W   G  P  C+  C   G    +  L C+   + +  S C +K + +++   C    C   W  ++WS CS+SCGG G   R + C
Sbjct:  623 EYEGFTECSESCGGGLQEAIVVCLNKQ--TRVTVGESLCVASRRPPPLLKSCNMEACPPR--WEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP--KPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIKLIGDNNKIISHSSRTREEEVAKKGRKNEAYHRTEKQQNASLFNRSKTEKQGQITDPSSVYDSIVSHLLALKKFLYTITISKWSYHEILHSCVSPIMICVAFVCTASREYQWSAVGFTP--CSASCGNRGIQHPQ--LRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSCGG-GFQTRRVTC 1159          

HSP 2 Score: 77.7962 bits (190), Expect = 5.846e-14
Identity = 132/547 (24.13%), Postives = 216/547 (39.49%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYV-YLYTRIMINCPVTY---FVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGT-WTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH-------QGQIIEASACDK-KEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAP 1846
            W E D +  CS +CG G +     C      +  +V+D+ C   P      P ++ECN+  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G + + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + +    CSS  KP +   +C  H+    C K     P +E K     Q ++ + +     + +++   ++   ++C V      V   ++     TI +                L + + E     T  TC +GP N  A+    NP    +D      L + E L +             W  +G+++CS +CG  G Q   V C    KQ    + +S+C    +  PL  ++C M    P+W++   N   C+  C   G G    ++ C H       +  ++    C + K      C    C   W +S W +CS++CGG GI  R ++C  + ++   GS+     + LPE   S   P
Sbjct:  312 WRETD-FFPCSASCGGGYQLTSAECY--DLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLASDGYKQIMPYDLYHPLPRWENTPWTACSSSCG-GGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPKWLA-QEWSPCTVT--CGHGLRYRVVLCID------HRGIHTGGCSSKTKPHIK-EECTVHI---PCYKAKEKLP-VEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSVSCGVGIQHRTVKCQVLLTFAQTIAD----------------LPLEECEGTKPATQQTCYSGPCNGEAMD--YNPD---EDELSYGGLKDIEELYD-------------WEYEGFTECSESCG-GGLQEAIVVC--LNKQTRVTVGESLCVASRRPPPLL-KSCNMEACPPRWEIG--NWSTCSLTC---GVGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWYSSEWKQCSQTCGG-GIHTREVLCKQRLSD---GSI-----LELPETFCSSSKP 788          

HSP 3 Score: 56.6102 bits (135), Expect = 2.103e-7
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC----EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            Y W    ++ CS +CG+ G +   + CV D+   N+      YC     PS++P A   CN  DCP   +   W  C ++  C  G Q R +TC  +   G P ++   AC+   K PV  + C
Sbjct: 1076 YQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNI-----SYCLEKPRPSIKPTA---CNRRDCPARWMVTSWSSCSQS--CGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC 1189          

HSP 4 Score: 54.299 bits (129), Expect = 8.331e-7
Identity = 63/262 (24.05%), Postives = 102/262 (38.93%), Query Frame = 2
Query: 1220 GFQDWKLRTTLWNKEMLN-----EDPEVGMT------RNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKCNL---KCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            G Q  +LR  L +KE +N     E P   +       R+   +W+   WS CS +CG  GFQ+R V C++       +   +       K+P+  ++C     C +W  +      C   CI          ++C    G I+    C         C  + C V W+ S W+ C+ +CG  G  +R + C+   T       LC  +  P+          +CN+    C D    C+     K C  + +R  CC +C +
Sbjct: 1094 GIQHPQLRCVL-DKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTSPWG--QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQN-------CWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRSRPI-------NWQRCNITPFDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTCGK 1336          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 117.087 bits (292), Expect = 5.162e-26
Identity = 90/300 (30.00%), Postives = 131/300 (43.67%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKEC----LKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            W+ CS TCG G + + V C   S       S++ C         I+ CN  +C     W    W +CS+TCG  G + R V C      G+ +    + C+   +P +   C   DCP  L  GEW KC    KCS G QRR M C+ I   G    +    C   +  P   R C  HM   +     L D   P I+ I +   +Q R+ K +N  +G  AY+   T ++I CPV       I W+  +    Y  K    + V K G L+I   E++D G + CIA   + + ++K+
Sbjct:  691 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECGAEK--PSAIQPCNQIDCPP--AWHTEDWQQCSRTCG-GGVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKCSA--KCSVGIQRRKMICLKITAKGHLIPINDSHCHG-LPSPALVRSC--HMGVCQSKTSKLGDPESPEILSIHR-VYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYSKK----LGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLKL 972          

HSP 2 Score: 90.8929 bits (224), Expect = 6.623e-18
Identity = 95/406 (23.40%), Postives = 165/406 (40.64%), Query Frame = 2
Query:  893 PIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIA----GPKNASAIIKVR-------NPAVGFQDWKLRTTLWNK----------------------EMLN----EDPEVGMTRNEV-------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSE-KQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQ-GQIIEASACDKKEKYNME-----CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIW-KNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDL--YASCKPHAKKCIQSIYRYTCCKSCS 1948
            P I+  +  +  +    ++ + VG          +M+ CPV  F    + W     +   +  + +S  +   G L +      ++GT+ CIA    G   A +++++        N   G   ++L    W +                        +N    E     + R++         +W    WS CS +CG  GFQ R+V C+Q++      +L    C+     +P+T++ C  +  C  W         C N+CI  G G     + C H  G  +  ++CD+K++Y        CP+E C V W+T  W  C+ +CG  G  +R + C+  KN++  A   C  ++   P   + C+A  C  KC D   Y +   H K C   +Y+  CC+SC+
Sbjct: 1256 PAIQSSEKNITYLEDGSIIAL-VGGTVMARRGVNVMVQCPVKGFPQPKLTW-----LKKEYALANNSFLLSN-GSLLLTNVSDGNEGTYFCIATNALGKTVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSCGT-GFQQRQVICQQTKLDGSIKVLPSGSCQYA--DRPVTQKPCS-SDACVDWIPQPWG--QCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACGN-GFQSRKVDCMHKKNSKAVADQYCVWKR--RPTTWQHCKATSCG-KCKDTTHYCTFVKHLKLCHIDLYKQRCCESCN 1644          

HSP 3 Score: 62.7734 bits (151), Expect = 2.617e-9
Identity = 49/170 (28.82%), Postives = 76/170 (44.71%), Query Frame = 2
Query:  203 ISWNVFG--IVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCG-PGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKC 703
            I+ N  G  +   VL    FK  A         + LE  +W  CS+TCG  GT+     C+    +    V+D  C+ +  +    + CN  +C     W PG WS+CS +CG+ G + R V C   +  G++    S  C+ + RP     C+   C +  +P  WG+C
Sbjct: 1340 IATNALGKTVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGH---RVNDSWCEHLHPLVIRSQACNRKDCPAR--WFPGAWSDCSTSCGT-GFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDAC-VDWIPQPWGQC 1502          

HSP 4 Score: 59.6918 bits (143), Expect = 2.321e-8
Identity = 43/128 (33.59%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEA--SSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP----PVSWRKCYD 850
            Y  + G W++CS TCG+NG ++    CV     G+ VN    +CE  L P    S +CN  DCP    PG W  C  +  C  G Q+R + C     +G  K +P  +C    +P    P S   C D
Sbjct: 1373 YQLEYGDWTQCSSTCGNNGTQSSTQHCV--NVKGHRVNDS--WCE-HLHPLVIRSQACNRKDCPARWFPGAWSDCSTS--CGTGFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDACVD 1493          

HSP 5 Score: 56.9954 bits (136), Expect = 1.345e-7
Identity = 45/170 (26.47%), Postives = 72/170 (42.35%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            W + D +  C+ TCG G +     C+         V+D  C   P      P +KECN+  C           YD++     W+   W+ CS +CG  G + R + CV +   G ++  +   C  + +P    +CN+ DCP  +   EW +C     C  G + R + C
Sbjct:  322 WRQTD-FFPCTVTCGGGYQLNSAECV--DIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCG-GGIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDCPKWMA-MEWSQCTVT--CGRGLRYRVVLC 484          

HSP 6 Score: 53.9138 bits (128), Expect = 1.352e-6
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 2
Query:  245 SETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDEL-CKTVPVISPTIKE-CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI 658
            S+ FK        Q    W E + W +CS +CG G +++ ++C++++ + E +  +E  C   P   PTI + CNL +C     W   +WS+C+ TCG  G + R V C    G        +  C P L+P     C +
Sbjct:  383 SDGFKEIMPYDHFQPLPRW-EHNPWTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKCMYAP--KPTIMQTCNLFDCPK---WMAMEWSQCTVTCG-RGLRYRVVLCNDHRG------QHTGGCNPQLKPHIKEECVV 509          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 114.775 bits (286), Expect = 2.718e-25
Identity = 88/299 (29.43%), Postives = 131/299 (43.81%), Query Frame = 2
Query:  317 WNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCY---DHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            W+ CS TCG G + + V C   S       S++ C         I+ CN  +C     W    W +CS+TCG  G + R V C      G+ +    + C+   +P +   C   DCP  L  GEW KC    KCS G QRR M C+ I   G    +    C     P +  R C+    H   +E   +   P I+ I +   +Q R+ K +N  +G  AY+   T ++I CPV       I W+  +    Y  K    + V K G L+I   E++D G + CIA   + + ++K+
Sbjct:  630 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECGAEK--PSAIQPCNQIDCPP--AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKCSA--KCSVGIQRRKMICLKITAKGHLIPINDSHCHGLPSPALV-RSCHMAKQHNPNRETSPE--SPEILSIHR-VYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYSKK----LGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLKL 910          

HSP 2 Score: 75.485 bits (184), Expect = 2.769e-13
Identity = 64/216 (29.63%), Postives = 97/216 (44.91%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSE-KQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQG--QIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIW-KNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCS 1948
            +W    WS CS +CG  GFQ R+V C+Q++      +L    C+     +P+T++ C  +  C  W         C N+CI  G G     + C H     + EAS+  K       CP+E C V W+T  W  C+ +CG  G  +R + C+  KN++  A   C  ++ P        R    NL     Y +   H K C   +Y+  CC+SC+
Sbjct: 1391 RWFPGAWSDCSTSCGT-GFQQRQVICQQTKLDGSIKVLPSGSCQYA--DRPVTQKPCS-SDACVDWIPQPWG--QCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASSARKT------CPSEMCDVYWRTGPWRPCTAACGN-GFQSRKVDCMHKKNSKAVADQYCVWKRRP---TTWQARQHSHNLDTTH-YCTFVKHLKLCHIDLYKQRCCESCN 1589          

HSP 3 Score: 59.6918 bits (143), Expect = 2.469e-8
Identity = 43/155 (27.74%), Postives = 68/155 (43.87%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            W + D +  C+ TCG G +     C+         V+D  C   P      P +KECN+  C     W+   W+ CS +CG  G + R + CV +   G ++  +   C  + +P    +CN+ DCP  +   EW +C     C  G + R + C
Sbjct:  278 WRQTD-FFPCTVTCGGGYQLNSAECV--DIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPSR--WEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDCPKWMA-MEWSQCTVT--CGRGLRYRVVLC 423          

HSP 4 Score: 53.9138 bits (128), Expect = 1.145e-6
Identity = 36/120 (30.00%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDEL-CKTVPVISPTIKE-CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI 658
            E + W +CS +CG G +++ ++C++++ + E +  +E  C   P   PTI + CNL +C     W   +WS+C+ TCG  G + R V C    G        +  C P L+P     C +
Sbjct:  341 EHNPWTACSVSCGGGIQRRSIVCVEETMHGEILQVEEWKCMYAP--KPTIMQTCNLFDCPK---WMAMEWSQCTVTCG-RGLRYRVVLCNDHRG------QHTGGCNPQLKPHIKEECVV 448          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 112.464 bits (280), Expect = 1.333e-24
Identity = 96/360 (26.67%), Postives = 139/360 (38.61%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC---VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPP----------------VSWRKCY------DHMNTKECLKDLRI-----------------------------------PPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E + +  CS +CG G ++  V+C+ K   T   V + LC       P +K CN+  C     W+ G WS CS TCG  G +TRDV C   +  E +  +V  D    +P  +P    +CN  DCP      EW +C +   C  G   R + C   L +G    +P   CSS+ KPP                  W +C         +    C K L+                                     P I   +   +Q R+ K L   VG  AY+   T +++ CPV  F    I+W+        H  S + + V   G ++I      D G +TC+AGP     IIK+
Sbjct:  593 EYEGFTECSESCGGGLQEAIVVCLNKQ--TRVTVGESLCVASRRPPPLLKSCNMEACPPR--WEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP--KPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIKL 938          

HSP 2 Score: 72.4034 bits (176), Expect = 2.924e-12
Identity = 132/547 (24.13%), Postives = 213/547 (38.94%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYV-YLYTRIMINCPVTY---FVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGT-WTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH-------QGQIIEASACDK-KEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAP 1846
            W E D +  CS +CG G +     C      +  +V+D+ C   P      P ++ECN+  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G + + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + +    CSS  KP +   +C  H+    C K     P +E K     Q ++ + +     + +++   ++   ++C V      V   ++     TI +                L + + E     T  TC +GP N  A+    NP    +D      L + E L +    G T             +CS +CG  G Q   V C    KQ    + +S+C    +  PL  ++C M    P+W++   N   C+  C   G G    ++ C H       +  ++    C + K      C    C   W +S W +CS++CGG GI  R ++C  + ++   GS+     + LPE   S   P
Sbjct:  282 WRETD-FFPCSASCGGGYQLTSAECY--DLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLASDGYKQIMPYDLYHPLPRWENTPWTACSSSCG-GGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPKWLA-QEWSPCTVT--CGHGLRYRVVLCID------HRGIHTGGCSSKTKPHIK-EECTVHI---PCYKAKEKLP-VEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPCSVSCGVGIQHRTVKCQVLLTFAQTIAD----------------LPLEECEGTKPATQQTCYSGPCNGEAMDY--NPD---EDELSYGGLKDIEELYDWEYEGFT-------------ECSESCG-GGLQEAIVVC--LNKQTRVTVGESLCVASRRPPPLL-KSCNMEACPPRWEIG--NWSTCSLTC---GVGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWYSSEWKQCSQTCGG-GIHTREVLCKQRLSD---GSI-----LELPETFCSSSKP 758          

HSP 3 Score: 63.929 bits (154), Expect = 1.085e-9
Identity = 84/372 (22.58%), Postives = 142/372 (38.17%), Query Frame = 2
Query:  950 NIDVGQLAYVYLYTRI-MINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV----------RNPAVGF------------QDWKLRTTLWNKEMLN-----EDPEVGMT------RNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            NI VG +  ++L   I +  CP+   +  +I W H +     + + +  + ++    LR+       QG + CI    + S I +           +  AVGF            Q  +LR  L +KE +N     E P   +       R+   +W+   WS CS +CG  GFQ+R V C++       +   +       K+P+  ++C     C +W  +      C   CI          ++C             K     + C  + C V W+ S W+ C+ +CG  G  +R + C+   T       LC  +  P+    + C    C N+ C D    C+     K C  + +R  CC +C +
Sbjct: 1244 NIKVGNIYDLHLSLFICLTGCPLKGHIMPNISWIHESQPLGTNVRLRHEL-LENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVL-DKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTSPWG--QCHGPCIGPRMALQHRQVYC-------------KTRDGTINCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRSRPIN--WQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTCGK 1594          

HSP 4 Score: 56.9954 bits (136), Expect = 1.408e-7
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC----EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            Y W    ++ CS +CG+ G +   + CV D+   N+      YC     PS++P A   CN  DCP   +   W  C ++  C  G Q R +TC  +   G P ++   AC+   K PV  + C
Sbjct: 1338 YQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNI-----SYCLEKPRPSIKPTA---CNRRDCPARWMVTSWSSCSQS--CGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC 1451          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 112.079 bits (279), Expect = 1.557e-24
Identity = 96/360 (26.67%), Postives = 139/360 (38.61%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC---VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPP----------------VSWRKCY------DHMNTKECLKDLRI-----------------------------------PPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E + +  CS +CG G ++  V+C+ K   T   V + LC       P +K CN+  C     W+ G WS CS TCG  G +TRDV C   +  E +  +V  D    +P  +P    +CN  DCP      EW +C +   C  G   R + C   L +G    +P   CSS+ KPP                  W +C         +    C K L+                                     P I   +   +Q R+ K L   VG  AY+   T +++ CPV  F    I+W+        H  S + + V   G ++I      D G +TC+AGP     IIK+
Sbjct:  601 EYEGFTECSESCGGGLQEAIVVCLNKQ--TRVTVGESLCVASRRPPPLLKSCNMEACPPR--WEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCRQP--KPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSS-KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAGPSQEHFIIKL 946          

HSP 2 Score: 65.0846 bits (157), Expect = 5.545e-10
Identity = 84/371 (22.64%), Postives = 140/371 (37.74%), Query Frame = 2
Query:  959 VGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV----------RNPAVGF------------QDWKLRTTLWNKEMLN-----EDPEVGMT------RNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
             G    V L    +I CP+   +  +I W H +     + + +  + ++    LR+       QG + CI    + S I +           +  AVGF            Q  +LR  L +KE +N     E P   +       R+   +W+   WS CS +CG  GFQ+R V C++       +   +       K+P+  ++C     C +W  +      C   CI          ++C    G I+    C    +      C  + C V W+ S W+ C+ +CG  G  +R + C+   T       LC  +  P+    + C    C N+ C D    C+     K C  + +R  CC +C +
Sbjct: 1386 TGNNLMVNLGGSALIGCPLKGHIMPNISWIHESQPLGTNVRLRHEL-LENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVL-DKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSCG-GGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTSPWG--QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRSRPIN--WQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTCGK 1748          

HSP 3 Score: 59.3066 bits (142), Expect = 2.848e-8
Identity = 54/195 (27.69%), Postives = 81/195 (41.54%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            W E D +  CS +CG G +     C      +  +V+D+ C   P      P ++ECN+  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G + + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + +    CSS  KP +
Sbjct:  290 WRETD-FFPCSASCGGGYQLTSAECY--DLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLASDGYKQIMPYDLYHPLPRWENTPWTACSSSCG-GGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPKWLA-QEWSPCTVT--CGHGLRYRVVLCID------HRGIHTGGCSSKTKPHI 471          

HSP 4 Score: 57.3806 bits (137), Expect = 1.268e-7
Identity = 38/124 (30.65%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC----EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            Y W    ++ CS +CG+ G +   + CV D+   N+      YC     PS++P A   CN  DCP   +   W  C ++  C  G Q R +TC  +   G P ++   AC+   K PV  + C
Sbjct: 1476 YQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNI-----SYCLEKPRPSIKPTA---CNRRDCPARWMVTSWSSCSQS--CGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC 1589          

HSP 5 Score: 51.2174 bits (121), Expect = 7.889e-6
Identity = 44/146 (30.14%), Postives = 64/146 (43.84%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYN---ILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC---IHQGQIIE--ASACDKKEKYNME-CPNEKCQVGWKTSNWSKCSRSCG 1723
            +W    WS CS+TCGV G Q+R+V C     +  N   +L D  C    Q KP   + C      P W  +      C+  C   G G     + C   +  G I+E   + C   +  + + C NE C   W  ++WS+CS +CG
Sbjct:  658 RWEIGNWSTCSLTCGV-GLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNRFDCPPAWYSSEWK--QCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCG 794          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 131.339 bits (329), Expect = 1.433e-30
Identity = 92/307 (29.97%), Postives = 140/307 (45.60%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVIC---IKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E+ +W+ CS TCG G + + V+C   + +      +++DELC   P  S T++ CN  NC     W P +W  CS+TCG  G + RDV C      G+ +     +C  S +P +   C   DCP   +  EW +C  +  C  GTQ R   C  +LK G    +     +ST+ PP+    S R C      +      +  P I   +N  +Q R+ + L+  VG  AY+   T +++ CP   F    I W+        H  S   + V   G L+I + +  D G +TC AGP     +IK+
Sbjct:  654 EIGKWSPCSLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHH-PKPS-TVQACNRFNCPP--AWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVV-----NSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIKL 943          

HSP 2 Score: 80.4925 bits (197), Expect = 6.951e-15
Identity = 56/173 (32.37%), Postives = 83/173 (47.98%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVY---DEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSST 814
            E + +  CS +CG G ++  V C+ K   T E+  + LC T       +K CNL  C     W+ GKWS CS TCG  G +TRDV C +    E +  +V +D     P  +P    +CN  +CP    P +W  C +   C  G Q+R + C   + +G    +P   CS++
Sbjct:  595 EYEGFTKCSESCGGGVQEAVVSCLNKQ--TRELADENLCVTSRRPPQLLKSCNLDPCPAR--WEIGKWSPCSLTCGV-GLQTRDVVCSHLLSREMNEVVVLADELCHHP--KPSTVQACNRFNCPPAWYPAQWQLCSRT--CGGGIQKRDVLCKQRMADGSFLELPETFCSAS 758          

HSP 3 Score: 65.4698 bits (158), Expect = 2.679e-10
Identity = 56/206 (27.18%), Postives = 89/206 (43.20%), Query Frame = 2
Query:  230 FLVLISETFKVNAKIKESQTQTF---WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            F++ I +    ++ ++    Q     W E D +  CS TCG G +     C      +  +V+D+ C   P      P ++ECNL  C     W+   W+ CS +CG  G ++R V CV ++  G++ + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + M    CS+  KP +
Sbjct:  275 FIIKIHDLGPADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY--DLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCPAR--WEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPKWLA-QEWSPCTVT--CGQGLRYRVVLCIDH------RGMHTGGCSAKTKPHI 465          

HSP 4 Score: 57.7658 bits (138), Expect = 6.503e-8
Identity = 82/359 (22.84%), Postives = 136/359 (37.88%), Query Frame = 2
Query:  998 MINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGR-LRIRKFESKDQGTWTCIAGP------KNASAIIK-----VRNPAV--------GFQDWKLRTTLWNKEMLNEDPE--VGMTRNEV-----------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNI-LDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCKP--HAKKCIQSIYRYTCCKSCSR 1951
            ++ CP+      +I W ++G  I    G +     +   G+ LR+       QG ++C+A        + AS +I+     V   A         G    +LR  L   E+   DPE   G  R  V            +W+   WS C+ +CG  G Q+R V C++ +    +  + + +C +   K+P+  + C     C +W  +      C   CI          + C    G  + +  C    +      C +E C V W+ S W+ C+ +CG  G  +R + C+   T         S   P P   + C    C N +C D    C+     K C    +R  CC +C +
Sbjct: 1406 LLGCPIKGHPTPNITWFQNGQPIATAPGLTH---HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEV---DPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLA-KRPVDTQACNQQL-CVEWAFSSWG--QCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWG-PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1752          

HSP 5 Score: 53.5286 bits (127), Expect = 1.277e-6
Identity = 59/201 (29.35%), Postives = 89/201 (44.28%), Query Frame = 2
Query: 1253 WNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAG-SLCYSQKIPLPEVIKSCRAPKC 1852
            W K+   ++ E G   +E   +I + WS C+VTCGV G Q R + C+       ++ D    E +G  KP ++R C  A  C   +    NPDN        G G + G L              D  E Y+           W+   ++KCS SCGG G+    + C+ K T + A  +LC + + P P+++KSC    C
Sbjct:  490 WFKQA--QELEEGAAVSEEPSFIPEAWSACTVTCGV-GTQVRIIRCQVLLPFSQSVADLPADECEG-PKPASQRAC-YAGPC-NGETPEFNPDN--------GDGLL-GGLQ-------------DLDELYD-----------WEYEGFTKCSESCGG-GVQEAVVSCLNKQTRELADENLCVTSRRP-PQLLKSCNLDPC 649          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 117.857 bits (294), Expect = 2.329e-26
Identity = 90/339 (26.55%), Postives = 137/339 (40.41%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYV-----------------------------------WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E + +  CS +CG G ++  V C+ K   T E+  + LC T       +K CNL  C  +++                                   W P +W  CS+TCG  G + RDV C      G+ +     +C  S +P +   C   DCP   +  EW +C  +  C  GTQ R   C  +LK G    +     +ST+ PP+    S R C      +      +  P I   +N  +Q R+ + L+  VG  AY+   T +++ CP   F    I W+        H  S   + V   G L+I + +  D G +TC AGP     +IK+
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQ--TRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVV-----NSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIKL 935          

HSP 2 Score: 63.929 bits (154), Expect = 8.211e-10
Identity = 59/221 (26.70%), Postives = 92/221 (41.63%), Query Frame = 2
Query:  230 FLVLISETFKVNAKIKESQTQTF---WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            F++ I +    ++ ++    Q     W E D +  CS TCG G +     C      +  +V+D+ C   P      P ++ECNL  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G++ + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + M    CS+  KP +
Sbjct:  275 FIIKIHDLGPADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY--DLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPKWLA-QEWSPCTVT--CGQGLRYRVVLCIDH------RGMHTGGCSAKTKPHI 482          

HSP 3 Score: 57.7658 bits (138), Expect = 7.015e-8
Identity = 82/359 (22.84%), Postives = 136/359 (37.88%), Query Frame = 2
Query:  998 MINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGR-LRIRKFESKDQGTWTCIAGP------KNASAIIK-----VRNPAV--------GFQDWKLRTTLWNKEMLNEDPE--VGMTRNEV-----------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNI-LDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCKP--HAKKCIQSIYRYTCCKSCSR 1951
            ++ CP+      +I W ++G  I    G +     +   G+ LR+       QG ++C+A        + AS +I+     V   A         G    +LR  L   E+   DPE   G  R  V            +W+   WS C+ +CG  G Q+R V C++ +    +  + + +C +   K+P+  + C     C +W  +      C   CI          + C    G  + +  C    +      C +E C V W+ S W+ C+ +CG  G  +R + C+   T         S   P P   + C    C N +C D    C+     K C    +R  CC +C +
Sbjct: 1398 LLGCPIKGHPTPNITWFQNGQPIATAPGLTH---HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEV---DPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLA-KRPVDTQACNQQL-CVEWAFSSWG--QCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWG-PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1744          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl3 (ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499])

HSP 1 Score: 114.39 bits (285), Expect = 2.764e-25
Identity = 90/309 (29.13%), Postives = 141/309 (45.63%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS--SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCY------DHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
             +  W +CS TCG G + + V C+    +         C+     +  ++ CN  +C  +  W   +W +CS+TCG  G + R V C      G+ +N   + C+    P+ASS  SC   DCP  L  G+W KC     C  G QRR   C  +   G+  S+    C      P+  R C         + TK  L + R P I+ +++   +Q R+ K +N+ VG  AY+ L T ++I CPV  F    I W K G+ +     K+   + + K G L+I    + D G + CIAG    + ++K+
Sbjct:  721 HMGSWGACSATCGVGIQTRDVYCLHPEEFPAPPEE---CREEKPHA--LRACNQFDCPPS--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELCQ---GPKASSHKSCARTDCPPQLAAGDWSKCSVT--CGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLV-RPCQMPICSKAKLGTKTKLGE-RGPQILGVRR-VYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWEKDGHCL-----KNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKL 1008          

HSP 2 Score: 72.7886 bits (177), Expect = 1.420e-12
Identity = 59/218 (27.06%), Postives = 93/218 (42.66%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQH-YNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDN-CTNKCIRIGFGKIEGNLHCIHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNT-EDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCK--PHAKKCIQSIYRYTCCKSC 1945
            +W    WS+CS +CG EGF SR+V C+Q++      ++    C  K   +PL R+ C +     +     I+P N C  +C+         +  C H      +S C+  ++  +   C    C+  W+   W  C+  CG  G  +R + CI   + +  A   C   K   P   + C  P C+  C D    C    H   C  ++YR  CC+SC
Sbjct: 1500 RWFTSMWSECSASCG-EGFHSRQVTCKQTKANGTVQVVSPRACAPK--DRPLGRKPCSIRPCVQQ----AIDPGNQCPGRCMGHATRMQHHHTACSHNS---SSSDCEDGRRPAFGRNCTLGPCEACWRVGPWKPCTAVCGR-GFQSRKVDCIHTGSCKIVADRYCVQVK---PAAWRHCLGPSCDRNCTDTTHYCMFVKHLNLCSLAVYRQRCCQSC 1703          

HSP 3 Score: 61.2326 bits (147), Expect = 4.948e-9
Identity = 40/125 (32.00%), Postives = 53/125 (42.40%), Query Frame = 2
Query:  485 YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEAS-SSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP----PVSWRKC 844
            + W+PG W+ CS TCG  G + +   CV   G           C P  +P A   SCNI DCP       W +C  +  C  G   R +TC     NG  + +   AC+   +P    P S R C
Sbjct: 1440 HFWEPGNWTHCSATCGPLGFRLQRPRCVMASGQ----EVSEALCGPHRKPLAGFQSCNIRDCPARWFTSMWSECSAS--CGEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPC 1558          

HSP 4 Score: 58.5362 bits (140), Expect = 3.959e-8
Identity = 43/136 (31.62%), Postives = 59/136 (43.38%), Query Frame = 2
Query:  263 NAKIKESQTQTFWLEVDEWNSCSTTCGP-GTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC 667
            N   K    + FW E   W  CS TCGP G R ++  C+  S    + VS+ LC          + CN+ +C     W    WSECS +CG  G  +R V C   + +G +     + C P  RP     C+I  C
Sbjct: 1430 NLTGKSLPQEHFW-EPGNWTHCSATCGPLGFRLQRPRCVMAS---GQEVSEALCGPHRKPLAGFQSCNIRDCPAR--WFTSMWSECSASCG-EGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPC 1558          

HSP 5 Score: 53.1434 bits (126), Expect = 1.600e-6
Identity = 61/222 (27.48%), Postives = 83/222 (37.39%), Query Frame = 2
Query: 1268 LNEDPEVGMTR--NEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTC--QMATQCP------------------KWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH--QGQIIEASACD---KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC 1852
            L +  E+  TR   E  ++I + WS CS TCG  G Q REV C           +    E +G K P T R C  Q   Q P                   W+  G  P  CT  C+    G  E    C+H    Q +  S CD   +    +  C  E C   W   +W  CS +C G+GI  R + C+           C  +K   P  +++C    C
Sbjct:  562 LKQAQELEETRIATEEPKFIPEPWSACSTTCG-PGIQVREVRCRVLLTFTQTEAELPEEECEGPKPP-TDRPCLRQACDQSPVSRELGGRLQEKDSEMTYDWEYAGFTP--CTATCLG---GHQEAIAVCLHTQTHQTVNDSLCDTVHRPPPMSQACNMEPCPPRWHMGSWGACSATC-GVGIQTRDVYCLHPEEFPAPPEECREEK---PHALRACNQFDC 772          

HSP 6 Score: 52.7582 bits (125), Expect = 2.099e-6
Identity = 36/114 (31.58%), Postives = 58/114 (50.88%), Query Frame = 2
Query:  245 SETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDEL-CKTVPVISPTI-KECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEG 580
            S+ FK        Q    W E + W +CS +CG G +++  +C+++S + E +  +E  C   P   PT+ + CNL +C     W   +WS+C+ TCG  G + R V C+   G
Sbjct:  416 SDGFKEIMPYDHFQPLPRW-EHNPWTACSVSCGGGIQRRSFVCVEESMHAEILQVEEWKCMYAP--KPTVMQACNLFDCPK---WVAMEWSQCTVTCG-RGLRYRVVLCINHRG 522          

HSP 7 Score: 50.8322 bits (120), Expect = 9.740e-6
Identity = 39/149 (26.17%), Postives = 66/149 (44.30%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNM--ECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W   G++ C+ TC + G Q     C  +  Q +  ++DS+C+   +  P+++  C M    P+W M       C+  C   G G    +++C+H  +        ++EK +    C    C   W    W +CSR+CGG G   R + C
Sbjct:  661 WEYAGFTPCTATC-LGGHQEAIAVCLHT--QTHQTVNDSLCDTVHRPPPMSQ-ACNMEPCPPRWHMGSWG--ACSATC---GVGIQTRDVYCLHPEEFPAPPEECREEKPHALRACNQFDCPPSWHIEEWQQCSRTCGG-GTQNRRVTC 799          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts18 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 18 [Source:MGI Symbol;Acc:MGI:2442600])

HSP 1 Score: 83.5741 bits (205), Expect = 7.842e-16
Identity = 62/185 (33.51%), Postives = 88/185 (47.57%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICI-KKSFYTEEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
             +WL   EW++CS +C  G + +K+ C+ KK F  EE V   LC   PV +PT ++ CN   C     W P  WS+CS+TCG  G + R+V C     +  L  S    C  S RPEA   C +  CP    L  +   W +C     C  G ++R + C+     GK  + P   C +  KP +
Sbjct:  933 AYWLP-GEWSACSKSCAGGQQSRKIRCVQKKPFQKEEAVLHSLC---PVSTPTQVQVCNSHACPPE--WSPSPWSQCSKTCG-RGVRRREVLCK-SPAAETLPES---LCSSSPRPEAQEGCVLGRCPKNNRLQWIASAWSECSAT--CGLGVRKRELKCVEKTLQGKLITFPERRCRNIKKPSL 1104          

HSP 2 Score: 66.6254 bits (161), Expect = 1.020e-10
Identity = 58/203 (28.57%), Postives = 86/203 (42.36%), Query Frame = 2
Query:  221 GIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELC--KTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            GI +   + +   V     +    T W  V   + CS TCG G    K IC++        V+   C  +T P   P I  CN  +C     W PG+WS CS++C + G+++R + CV  +            C P   P     CN   CP    P  W +C K   C  G +RR + C    K+   +++P   CSS+ +P
Sbjct:  853 GIAWKYALPKVMNVTQPATKRYHHT-WRTVQ--SDCSVTCGGGYISIKAICLRDQ---HTQVNSSFCSVRTKPATEPKI--CNAFSC--PAYWLPGEWSACSKSC-AGGQQSRKIRCVQKKPFQKEEAVLHSLC-PVSTPTQVQVCNSHACPPEWSPSPWSQCSKT--CGRGVRRREVLC----KSPAAETLPESLCSSSPRP 1037          

HSP 3 Score: 63.5438 bits (153), Expect = 1.007e-9
Identity = 69/239 (28.87%), Postives = 105/239 (43.93%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-----WKMTGINPDNCTNKCIRIGFGKIEGNLHCIH---QGQIIEASA--CDKKEKYNME----CPNEKCQV------GWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKS--CRAP--KCNLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            +W    WSQCS TCG  G + REV C+    +    L +S+C      +P  +  C +  +CPK     W  +  +   C+  C   G G  +  L C+    QG++I      C   +K ++E    C    C V       W +S W +C+ +CGG G+  R + C+ +    P+ S    QK P+     +  C AP  K +  CVD ++ C   P    C    Y   CC+SC+R
Sbjct:  994 EWSPSPWSQCSKTCG-RGVRRREVLCKSPAAE---TLPESLCSSS--PRPEAQEGCVLG-RCPKNNRLQWIASAWS--ECSATC---GLGVRKRELKCVEKTLQGKLITFPERRCRNIKKPSLELEEACNQRTCPVYSMAVASWYSSPWQQCTVTCGG-GVQTRSVHCMQQGR--PSSSCLLHQKPPVLRACNTNFCPAPEKKDDPSCVDFFSWCHLVPQHGVCNHKFYGKQCCRSCTR 1217          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts17 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 [Source:MGI Symbol;Acc:MGI:3588195])

HSP 1 Score: 82.0333 bits (201), Expect = 1.968e-15
Identity = 59/198 (29.80%), Postives = 88/198 (44.44%), Query Frame = 2
Query:  170 STKKIYLRQMKISWNVFGI--VFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYC-EPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            +T  ++L  +      +GI   + + ++++ +  ++  + Q   F      W  CS  CG G R+  V C +    T  +V+D  C       P ++ CN   C     W  G+WS CS TC   G + R+V CVY   +G  V +   YC EP  RP    SC   DC       EW +C  N  C  G Q+R +TC
Sbjct:  756 TTVPLHLMVLLFHDQNYGIHYEYTIPVNQSSENQSEPAKPQDALFLWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVNDSDCPQASRPEPQVRRCNSHPCQSR--WVTGQWSPCSATC-EKGVQHREVTCVYQLQNGTHVTTRPIYCSEP--RPTPVQSCEGQDCLSIWEASEWSECSAN--CGKGIQKRTVTC 946          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P90884|MADD4_CAEEL (Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5)

HSP 1 Score: 161.77 bits (408), Expect = 1.723e-39
Identity = 157/630 (24.92%), Postives = 259/630 (41.11%), Query Frame = 2
Query:  254 FKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVY-----DEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWK-HGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAG--PKNASAIIKVRN-----------PAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNE--------------------------VIQWIKKGWSQC-SVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACD--KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRA----PKCNLKCVDLY---ASCKPHAKKC-IQSIY--------RYTCCKSCS 1948
             + ++K+ E +    W   D W  CS +C  G ++  + CI+ S  T + V    C          + CN   C     W   K+S+CS +CGS G   R V+C       D    ++V  D + C    +P+ + +CN++ CP T V  +W +C ++  C +G +RR + C      GK +  P   C +  KP       +   +  E L +               Q  + K L + +G +A +Y  T I I CP   F  + I WK +G  I     K+   I+V   G LR+     +D G + C       N +   K R+           P +     + R  +  +++L E   V    N                           V +W    WS+C   TC V G+Q+R + C+ +       +D+S+CE     +P   R C     CP+W+ +  + +  + +C+     +   N+ C    G  ++   CD   +    M+CPN+ C+  W+TS+W  CS  CG  G+  R L C+W ++  PAG  C  +++  P   ++C A    P C      LY   ASC+  ++ C I  ++        R  CC +C+
Sbjct:  439 LQEDSKLSEDEAPYQWRYGD-WTQCSASCLGGKQKAALKCIQVS--TGKSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDR-CHFK-KPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLSN-----------RVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKI-----KNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQWS-ECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNC--EQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTCT 1038          

HSP 2 Score: 53.9138 bits (128), Expect = 6.910e-6
Identity = 53/209 (25.36%), Postives = 78/209 (37.32%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYV--WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDCPLT------------------------------LVPGEWGKCKKNHKCSAGTQRRPMTCISILK-NGKPKSMPRHACSSTIKP 823
            W+  D W  C   CG GTR+++V C++ +      V D  C+      P  +E    NC       W+ GKWS+C+ +CG  G + R V CV          SD   C+   RP   ++C   I C +                               LV GEW  C     C  G   R + C+++   +  P  +P   C    +P
Sbjct:  239 WMAAD-WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCEN--GTRPAAEE----NCVSTSCGRWEAGKWSKCTASCG-QGVRRRHVACVG--------GSD---CDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSST--CGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQP 426          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N6G6|ATL1_HUMAN (ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4)

HSP 1 Score: 123.25 bits (308), Expect = 2.768e-27
Identity = 88/307 (28.66%), Postives = 138/307 (44.95%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVIC---IKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E+ +W+ CS TCG G + + V C   + +      +++DELC+  P  S T++ CN  NC     W P +W  CS+TCG  G + R+V C      G+ +     +C  S +P    +C   DCP   +  +W +C  +  C  GTQ R   C  +LK G    +     +ST+ PP+    S R C      +      +  P I   +   +Q R+ + L+  VG  AY+   T +++ CP        I W+        H  S   + V   G L+I + +  D G +TC AGP     +IK+
Sbjct:  671 EIGKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILADELCRQ-PKPS-TVQACNRFNCPP--AWYPAQWQPCSRTCG-GGVQKREVLCKQRMADGSFLELPETFCSAS-KPACQQACKKDDCPSEWLLSDWTECSTS--CGEGTQTRSAICRKMLKTGLSTVV-----NSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQ----HLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIKL 960          

HSP 2 Score: 63.929 bits (154), Expect = 6.370e-9
Identity = 60/221 (27.15%), Postives = 92/221 (41.63%), Query Frame = 2
Query:  230 FLVLISETFKVNAKIKESQTQTF---WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            F+V I  +   ++ ++    Q     W E D +  CS TCG G +     C      +  +V+D+ C   P      P ++ECNL  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G++ + +   C  + +   +  CNI DCP  L   EW  C     C  G + R + CI        + M    CS   KP +
Sbjct:  275 FIVKIRNSGSADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY--DLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPKWLA-QEWSPCTVT--CGQGLRYRVVLCIDH------RGMHTGGCSPKTKPHI 482          

HSP 3 Score: 63.1586 bits (152), Expect = 9.656e-9
Identity = 77/358 (21.51%), Postives = 134/358 (37.43%), Query Frame = 2
Query:  998 MINCPVTYFVPRDIVWKHGNT-IYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAV---------------------GFQDWKLRTTLWNKEMLNEDPEVGMTRNEV-----------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNI-LDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            ++ CP+      +I W HG   I    G +   +   +   L++       QG ++C+A  +N + ++  +   V                     G Q  +LR  L N   +N     G  R  V            +W+   WS C+ +CG  G Q+R V C++ +    +  + + +C +   K+P+  + C     C +W  +      C   CI          + C    G  + +  C    +      C +E C V W+ S W+ C+ +CG  G  +R + C+   T         S   P P   + C    C N++C D    C+     K C  S ++  CC +C +
Sbjct: 1415 LLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQI--LQVANLSGGSQGEFSCLA--QNEAGVLMQKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLL-NSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCTQVA-KRPVDTQACNQQL-CVEWAFSSWG--QCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWG-PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTCGK 1761          

HSP 4 Score: 58.151 bits (139), Expect = 3.745e-7
Identity = 58/201 (28.86%), Postives = 90/201 (44.78%), Query Frame = 2
Query: 1253 WNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKC 1852
            W K+   ++ E G   +E   +I + WS C+VTCGV G Q R V C+       ++ D  + E +G  KP ++R C  A  C   ++   NPD          FG ++                 D  E Y+           W+   ++KCS SCGG G+    + C+ K T +PA  +LC + + P P+++KSC    C
Sbjct:  507 WFKQA--QELEEGAAVSEEPSFIPEAWSACTVTCGV-GTQVRIVRCQVLLSFSQSVADLPIDECEG-PKPASQRAC-YAGPC-SGEIPEFNPDETDGL-----FGGLQ-----------------DFDELYD-----------WEYEGFTKCSESCGG-GVQEAVVSCLNKQTREPAEENLCVTSRRP-PQLLKSCNLDPC 666          

HSP 5 Score: 54.299 bits (129), Expect = 4.854e-6
Identity = 50/157 (31.85%), Postives = 67/157 (42.68%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYN---ILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC---IHQGQIIE--ASACD-KKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            +W    WS CS+TCGV G Q+R+V C     +  N   IL D +C    Q KP T + C      P W      P  C+  C   G G  +  + C   +  G  +E   + C   K      C  + C   W  S+W++CS SCG  G   R  IC
Sbjct:  669 RWEIGKWSPCSLTCGV-GLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNRFNCPPAWYPAQWQP--CSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BLI0|ATL1_MOUSE (ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 1.629e-25
Identity = 90/339 (26.55%), Postives = 137/339 (40.41%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYV-----------------------------------WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV----SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E + +  CS +CG G ++  V C+ K   T E+  + LC T       +K CNL  C  +++                                   W P +W  CS+TCG  G + RDV C      G+ +     +C  S +P +   C   DCP   +  EW +C  +  C  GTQ R   C  +LK G    +     +ST+ PP+    S R C      +      +  P I   +N  +Q R+ + L+  VG  AY+   T +++ CP   F    I W+        H  S   + V   G L+I + +  D G +TC AGP     +IK+
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQ--TRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCG-GGIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVV-----NSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPHIAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIKL 935          

HSP 2 Score: 63.929 bits (154), Expect = 5.743e-9
Identity = 59/221 (26.70%), Postives = 92/221 (41.63%), Query Frame = 2
Query:  230 FLVLISETFKVNAKIKESQTQTF---WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNY----VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            F++ I +    ++ ++    Q     W E D +  CS TCG G +     C      +  +V+D+ C   P      P ++ECNL  C           YD Y     W+   W+ CS +CG  G ++R V CV ++  G++ + +   C  + +      CNI DCP  L   EW  C     C  G + R + CI        + M    CS+  KP +
Sbjct:  275 FIIKIHDLGPADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY--DLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCG-GGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPKWLA-QEWSPCTVT--CGQGLRYRVVLCIDH------RGMHTGGCSAKTKPHI 482          

HSP 3 Score: 57.7658 bits (138), Expect = 4.907e-7
Identity = 82/359 (22.84%), Postives = 136/359 (37.88%), Query Frame = 2
Query:  998 MINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGR-LRIRKFESKDQGTWTCIAGP------KNASAIIK-----VRNPAV--------GFQDWKLRTTLWNKEMLNEDPE--VGMTRNEV-----------IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNI-LDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEK--YNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC-NLKCVDLYASCKP--HAKKCIQSIYRYTCCKSCSR 1951
            ++ CP+      +I W ++G  I    G +     +   G+ LR+       QG ++C+A        + AS +I+     V   A         G    +LR  L   E+   DPE   G  R  V            +W+   WS C+ +CG  G Q+R V C++ +    +  + + +C +   K+P+  + C     C +W  +      C   CI          + C    G  + +  C    +      C +E C V W+ S W+ C+ +CG  G  +R + C+   T         S   P P   + C    C N +C D    C+     K C    +R  CC +C +
Sbjct: 1398 LLGCPIKGHPTPNITWFQNGQPIATAPGLTH---HIWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYWWSVDRLATCSASCGNRGIHQPRLRCLLNTTEV---DPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSCG-GGVQTRRVTCQKLKASGISTPVSNDMCSQLA-KRPVDTQACNQQL-CVEWAFSSWG--QCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWG-PRPANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1744          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P82987|ATL3_HUMAN (ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4)

HSP 1 Score: 108.612 bits (270), Expect = 1.183e-22
Identity = 89/312 (28.53%), Postives = 135/312 (43.27%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS--SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLK---------DLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
             V  W  CS TCG G + + V C+      E     E C+     +  ++ CN  +C     W   +W +CS+TCG  G + R V C      G+ +N   + C+    P+ASS  SC   DCP  L  G+W KC  +  C  G QRR   C  +   G+   +    C      P+  R C       EC K           + P I+ +++   +Q R+ K +N+ +G  AY+   T ++I CPV  F    I W K G  + N        + + K G L+I    + D G + CIAG    + ++K+
Sbjct:  708 HVGSWGPCSATCGVGIQTRDVYCLHPG---ETPAPPEECRDEKPHA--LQACNQFDCPPG--WHIEEWQQCSRTCG-GGTQNRRVTCRQLLTDGSFLNLSDELCQ---GPKASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPLV-RSC----QMPECSKIKSEMKTKLGEQGPQILSVQR-VYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQN-----SKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL 995          

HSP 2 Score: 78.9518 bits (193), Expect = 1.642e-13
Identity = 62/217 (28.57%), Postives = 97/217 (44.70%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQH-YNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNME--CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDP-AGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCK--PHAKKCIQSIYRYTCCKSC 1945
            +W    WSQCSV+CG EG+ SR+V C++++      ++    C  K   +PL R+ C     C +W+     P  C  + +R+     + +  C H       S CD +++  +   C +  C V W T  W  C+ +CG  G  +R + CI   +  P A   C  +K P+    + C  P C+  C D    C    H   C    Y+  CC+SC
Sbjct: 1486 RWFTSVWSQCSVSCG-EGYHSRQVTCKRTKANGTVQVVSPRACAPK--DRPLGRKPC-FGHPCVQWEPGNRCPGRCMGRAVRMQ----QRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKRHCVQKKKPI--SWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSC 1688          

HSP 3 Score: 59.3066 bits (142), Expect = 1.476e-7
Identity = 53/209 (25.36%), Postives = 86/209 (41.15%), Query Frame = 2
Query:  215 VFGIVFLVLISETFKVN-AKIKESQTQTF--------WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS 760
             F I   ++    FK      K+S  Q F        W + D +  C+ TCG G +     C+      + +V D  C   P      P +KEC++  C           YD++     W+   W+ CS +CG  G + R   CV +   G ++  +   C  + +P+   +CN+ DCP   +  EW +C     C  G + R + CI+
Sbjct:  306 TFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTD-FFPCTVTCGGGYQLNSAECV--DIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCG-GGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP-KWIAMEWSQCTVT--CGRGLRYRVVLCIN 507          

HSP 4 Score: 57.7658 bits (138), Expect = 4.842e-7
Identity = 37/123 (30.08%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  488 VWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEAS-SSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDH 853
             W+PG WS CS TCG  G + +  +CV   G           C+   +P A    CNI DCP       W +C  +  C  G   R +TC     NG  + +   AC+   + P+  + C+ H
Sbjct: 1427 FWEPGNWSHCSATCGHLGARIQRPQCVMANGQ----EVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDR-PLGRKPCFGH 1542          

HSP 5 Score: 54.299 bits (129), Expect = 5.078e-6
Identity = 42/149 (28.19%), Postives = 64/149 (42.95%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQI-IEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            W   G++ C+ TC V G Q     C   + Q    ++DS+C+    + P   + C      P+W +    P  C+  C   G G    +++C+H G+       C D+K      C    C  GW    W +CSR+CGG G   R + C
Sbjct:  648 WEYAGFTPCTATC-VGGHQEAIAVCLHIQTQQ--TVNDSLCDMV-HRPPAMSQACNTEPCPPRWHVGSWGP--CSATC---GVGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGG-GTQNRRVTC 786          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4VC17|ATS18_MOUSE (A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 5.485e-15
Identity = 62/185 (33.51%), Postives = 88/185 (47.57%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICI-KKSFYTEEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
             +WL   EW++CS +C  G + +K+ C+ KK F  EE V   LC   PV +PT ++ CN   C     W P  WS+CS+TCG  G + R+V C     +  L  S    C  S RPEA   C +  CP    L  +   W +C     C  G ++R + C+     GK  + P   C +  KP +
Sbjct:  933 AYWLP-GEWSACSKSCAGGQQSRKIRCVQKKPFQKEEAVLHSLC---PVSTPTQVQVCNSHACPPE--WSPSPWSQCSKTCG-RGVRRREVLCK-SPAAETLPES---LCSSSPRPEAQEGCVLGRCPKNNRLQWIASAWSECSAT--CGLGVRKRELKCVEKTLQGKLITFPERRCRNIKKPSL 1104          

HSP 2 Score: 66.6254 bits (161), Expect = 7.132e-10
Identity = 58/203 (28.57%), Postives = 86/203 (42.36%), Query Frame = 2
Query:  221 GIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELC--KTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            GI +   + +   V     +    T W  V   + CS TCG G    K IC++        V+   C  +T P   P I  CN  +C     W PG+WS CS++C + G+++R + CV  +            C P   P     CN   CP    P  W +C K   C  G +RR + C    K+   +++P   CSS+ +P
Sbjct:  853 GIAWKYALPKVMNVTQPATKRYHHT-WRTVQ--SDCSVTCGGGYISIKAICLRDQ---HTQVNSSFCSVRTKPATEPKI--CNAFSC--PAYWLPGEWSACSKSC-AGGQQSRKIRCVQKKPFQKEEAVLHSLC-PVSTPTQVQVCNSHACPPEWSPSPWSQCSKT--CGRGVRRREVLC----KSPAAETLPESLCSSSPRP 1037          

HSP 3 Score: 63.5438 bits (153), Expect = 7.043e-9
Identity = 69/239 (28.87%), Postives = 105/239 (43.93%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-----WKMTGINPDNCTNKCIRIGFGKIEGNLHCIH---QGQIIEASA--CDKKEKYNME----CPNEKCQV------GWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKS--CRAP--KCNLKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSR 1951
            +W    WSQCS TCG  G + REV C+    +    L +S+C      +P  +  C +  +CPK     W  +  +   C+  C   G G  +  L C+    QG++I      C   +K ++E    C    C V       W +S W +C+ +CGG G+  R + C+ +    P+ S    QK P+     +  C AP  K +  CVD ++ C   P    C    Y   CC+SC+R
Sbjct:  994 EWSPSPWSQCSKTCG-RGVRRREVLCKSPAAE---TLPESLCSSS--PRPEAQEGCVLG-RCPKNNRLQWIASAWS--ECSATC---GLGVRKRELKCVEKTLQGKLITFPERRCRNIKKPSLELEEACNQRTCPVYSMAVASWYSSPWQQCTVTCGG-GVQTRSVHCMQQGR--PSSSCLLHQKPPVLRACNTNFCPAPEKKDDPSCVDFFSWCHLVPQHGVCNHKFYGKQCCRSCTR 1217          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A504YRS1 (AdamTS protein 3 OS=Fasciola gigantica OX=46835 GN=FGIG_00549 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 3.041e-162
Identity = 253/605 (41.82%), Postives = 347/605 (57.36%), Query Frame = 2
Query:  191 RQMKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMV-SDELCKTVPVISPT--------IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSK---YCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV-SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAEL 1963
            R   ++W    ++ LVL S       +        +W E D+W+SCS+TCGPG ++++  C+ +  Y    V  D +C + P    T         + CNLG+C+  Y W+   W  CSQTCG  G  TRDV+CVY    G ++  + +   +C    RPE   SCN IDC    VP +WGKC +++ C  G Q R ++CIS+  NG  + +P+ AC  T +P   +WR+C+   +T  C       P I+    T+VQMRK K+LN+ VGQ AYV  +TR+ + CPV YF   D+VWKH N     Y G S + ++VDK+GRLRIR F ++D G WTCIAG KNA+     R PA GF DW  R  LW K M+++DP+     + ++QW++  WS CSV+CG  G Q R V CE+ + + Y ILDD  C  K   KPL+RR C  + +CP W + G +   CT+ C+ +  G I GNL C    Q +E   CD  EK +M CPN  CQV W  S WS+CSRSCGG+G+ AR LIC+W +   PAG LCY+ +IP+PEVI+ C AP C L+CVD    C    + C  ++YRY CC SC   A +
Sbjct:    8 RFQSVTWTYPYLLLLVLGSTPLHAFTE------PPYWQETDQWSSCSSTCGPGVQRRQYRCVSRDMYNILTVHEDSVCSSQPHPLTTNAGGDHVIERICNLGDCH-GYHWRTSPWGHCSQTCGGFGTMTRDVDCVYIGQDGEVIVQEQEAGYFCGHYPRPEKHGSCNRIDCKPEFVPEQWGKCIQSNPCQPGRQVRQVSCISVQVNGTHRQLPKAACYMTGRPQARTWRRCFV-ASTSNCESQ---EPTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRLNVRCPVHYFSVHDLVWKHRNHGEIRYTGLSNERVQVDKRGRLRIRSFRNEDAGEWTCIAGQKNATVTFSPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAIVQWVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVDGADSSVCTDNCLAVDQGSIRGNLTCRIGSQRVEDKLCDSSEKPDMTCPNSVCQVKWNVSAWSQCSRSCGGVGVRARQLICVWSHNGSPAGPLCYANQIPVPEVIEQCEAPPCQLECVDFSKHCPKRVELCKFTLYRYQCCASCRDFANI 601          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4E0R7Q3 (AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D915_004461 PE=4 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 4.113e-162
Identity = 253/605 (41.82%), Postives = 347/605 (57.36%), Query Frame = 2
Query:  191 RQMKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMV-SDELCKTVPVISPT--------IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSK---YCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV-SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAEL 1963
            R   ++W    ++ LVL S       +        +W E D+W+SCS+TCGPG ++++  C+ +  Y    V  D +C + P    T         + CNLG+C+  Y W+   W  CSQTCG  G  TRDV+CVY    G ++  + +   +C    RPE  SSCN IDC    VP +WGKC +++ C  G Q R ++CIS+  NG  + +P+ AC    +P   +WR+C+   +T  C       P I+    T+VQMRK K+LN+ VGQ AYV  +TR+ + CPV YF   D+VWKH N     Y G S + ++VDK+GRLRIR F ++D G WTCIAG KNA+     R PA GF DW  R  LW K M+++DP+     + ++QW++  WS CSV+CG  G Q R V CE+ + + Y ILDD  C  K   KPL+RR C  + +CP W + G +   CT+ C+ +  G I GNL C    Q +E   CD  EK +M CPN  CQV W  S WS+CSRSCGG+G+ AR LIC+W +   PAG LCY+ +IP+PEVI+ C AP C L+CVD    C    + C  ++YRY CC SC   A +
Sbjct:    8 RFQSVTWTYPYLLLLVLGSTPLHAFTE------PPYWQETDQWSSCSSTCGPGVQRRQYRCVSRDMYNILTVHEDSVCSSQPHPLTTNAGGDHVIERICNLGDCH-GYHWRISPWGHCSQTCGGFGTMTRDVDCVYIGQDGEVIVQEQEAGYFCGHYPRPEKHSSCNRIDCKPEFVPEQWGKCIQSNPCQPGRQVRQVSCISVQVNGTHRQLPKAACYMAGRPQARTWRRCFV-ASTSNCESQ---EPTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRLNVRCPVHYFSVHDLVWKHRNHGEIRYTGLSNERVQVDKRGRLRIRSFRNEDAGEWTCIAGQKNATVTFSPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAIVQWVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVDGADSSVCTDNCLAVDQGSIRGNLTCRIGSQRVEDKLCDSSEKPDMTCPNSVCQVKWNVSAWSQCSRSCGGVGVRARQLICVWSHNGSPAGPLCYANQIPVPEVIEQCEAPPCQLECVDFSKHCPKRVELCKFTLYRYQCCASCRDFANI 601          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183JCE1 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS349 PE=4 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 3.497e-155
Identity = 241/581 (41.48%), Postives = 337/581 (58.00%), Query Frame = 2
Query:  287 TQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDE-LCKTVPVISPTIKE-----CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSD---SKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC---SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALE 1990
            T  FW+  + W+SCS  CG G   ++ +C++   Y    + DE  C+ +P  S    E     C LG C   Y W+   W  CSQTCG  G  +RDV+CVY    G+LV SD   S YC    +PE  +SCN   C    VP +WGKC ++  C  G Q R ++CIS+  NG  + +P  AC     TI+P  +WR+C++  ++++C      PP+I     T+VQMRK K++++ VGQ A+V  +TR+ + CPV YF  +++ W + N  I  Y G   D IRVDK+GRL IR F   D+G WTCIAG  NA+  +  R PA GF DW  R  LW K ML++DP+     +E+IQW+   WS CS +CG  G Q R V CE+ + + Y IL D VC  K   KP + R C  + +CP W +   +   CT++C+ +G G I GNL C+   + +    CDK +K NMEC N  CQ+ W  SNWS+CSRSCGG+G+ AR+L+C W +  + AGSLCYS ++ +P+VI+SC  P C L CVD+   C    + C  +IYRY CC+SC R  ++     D+L+
Sbjct:   20 TPPFWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKGYRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQP--TWRRCFEE-SSRKCDSK---PPMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCQSCQRYVQMISSAKDSLK 594          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A094ZL01 (ADAMTS-like protein 3 OS=Schistosoma haematobium OX=6185 GN=MS3_02878 PE=4 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.277e-154
Identity = 241/587 (41.06%), Postives = 338/587 (57.58%), Query Frame = 2
Query:  269 KIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDE-LCKTVPVISPTIKE-----CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSK---YCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC---SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALE 1990
            +I    T  FW+  + W+SCS  CG G   ++ +C++   Y    + DE  C+ +P  S    E     C LG C   Y W+   W  CSQTCG  G  +RDV+CVY    G+LV SD     YC    +PE  +SCN   C    VP +WGKC ++  C  G Q R ++CIS+  NG  + +P  AC     TI+P  +WR+C++  ++++C      PP+I     T+VQMRK K++++ VGQ A+V  +TR+ + CPV YF  +++ W + N  I  Y G   D IRVDK+GRL IR F   D+G WTCIAG  NA+  +  R PA GF DW  R  LW K ML++DP+     +E+IQW+   WS CS +CG  G Q R V CE+ + + Y IL D VC  K   KP + R C  + +CP W +   +   CT++C+ +G G I GNL C+   + +    CDK +K NMEC N  CQ+ W  SNWS+CSRSCGG+G+ AR+L+C W +  + AGSLCYS ++ +P+VI+SC  P C L CVD+   C    + C  +IYRY CC+SC R  ++     D+L+
Sbjct:    2 EISAIVTPPFWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKGYRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDAFYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQP--TWRRCFEE-SSRKCDSK---PPMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCESCQRYVQMISSAKDSLK 582          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183A6D2 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2517 PE=4 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 4.868e-153
Identity = 239/565 (42.30%), Postives = 331/565 (58.58%), Query Frame = 2
Query:  206 SWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDE-LCKTVPVISPT--------IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSK---YCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV-SWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNL 1858
            +++ F    L+L S   + + K        +WLE D+W+SCS+TCGPG ++++  C+ +  Y    V D+ +C + P    T         + CNLG C   Y W+   W  CSQTCG  G  TRDV+CVY    G++V  + +   +C    +PE  ++CN IDC    VP +WGKC ++  C  G Q R ++CIS+  NG  + +P+ AC  + +P   +WR+C+    T  C       P I+    T+VQMRK K+LN+ VGQ AYV  +TRI + CPV YF   D+VWKH N     Y G S + ++VDK+GRLRIR F + D G WTCIAG KNA+     R PA GF DW  R  LW K M+++DP+     + ++QW++  WS CSV+CG  G Q R V CE+ + + Y ILDD  C  K   KPL+RR C  + +CP W + G +P  CTN C+ +  G I+GNL C    Q ++   CD  EK +M CPN  CQV W  S WS+CSRSCGG+G+ AR L+C+W + + PAG LCY+ +IP+PEVI+ C AP C L
Sbjct:   17 TYSYFLFCILLLGSRCIQADPK------SPYWLETDQWSSCSSTCGPGVQRRQYKCVSRDMYDILTVHDDSMCASQPHPITTNAGGNHVVERLCNLGAC-QGYRWRVSPWGHCSQTCGGFGTMTRDVDCVYTGPDGDVVVQEHEAGYFCGHYPQPEKHAACNRIDCKPEFVPEQWGKCIQSDPCRPGRQVRQVSCISVQVNGTHRQLPKAACYLSGRPQARTWRRCFVE-GTSSCESQ---EPTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRINVRCPVHYFSVHDLVWKHANHGEVRYTGVSNERVQVDKRGRLRIRSFRNVDAGEWTCIAGQKNATVFFTPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAIVQWVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVEGADPSVCTNNCLAVDQGSIKGNLTCRIGSQHVDEKLCDSSEKPDMTCPNPICQVKWNVSAWSQCSRSCGGVGVRARQLVCVWSHNDRPAGPLCYANQIPVPEVIEQCEAPPCQL 570          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamtsl3 (ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028701])

HSP 1 Score: 107.457 bits (267), Expect = 2.345e-23
Identity = 87/307 (28.34%), Postives = 139/307 (45.28%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKK--SFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVP----GEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            +  EW+ CS +CG G + ++V C++   S  TE +   E   + P   P ++ CN  +C     W+  +W +CS  C   G + R V C      G+      + C+  ++P     C     PL L P    GEW KC     C  G QRR   C  +  +G+  ++ R AC+  ++PP   R C      K      R P ++ +K+   +Q R+ K L+  +G  AY+   T ++I CPV +F    I W K G  + N        + + K G LR+   E++D G + C A   +   I+K+
Sbjct:  709 DFSEWSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSECKGSRP---PELQACNQHHCPP--AWEAEEWQQCSHAC-VRGTQWRKVYCRQRLAGGSFRKLPDEECD-GVKPATQRPCTD---PLCLQPHLDGGEWSKCSVT--CGKGIQRREPVCRRLSVSGQLVTLDRSACNG-LQPPPLIRSCRMTPCNKHKYSKKRCPQVLGLKR-IYIQTRQEKRLSFTIGGRAYLLPKTSVVIKCPVRHFPKAQIRWEKDGQDLQN-----SKHLSITKSGALRLYSLETRDIGEYRCWANQASDIFILKL 996          

HSP 2 Score: 84.3445 bits (207), Expect = 3.268e-16
Identity = 116/498 (23.29%), Postives = 190/498 (38.15%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVIS---PTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQ-----GQIIEASACDKKEKYNME-CPNEKCQVGWKTSNWSKCSRSC 1720
            W E D +  CS TCG G +     C++  +   + V D  C + P  +   P +KECN+  C           YD++     W+   W+ CS +CG  G + R V CV ++  G +V  +   C  S RP     CN  DCP   V  EW +C     C  G + R + CI    NG+        CSS++KP +      D +    C K     P +E K   L Q ++ +   +      ++        +C V+  V     W     + ++     D    + +G   + +         TC  GP           P    Q        W  E+     ++G        W  +G++ CSV+C V G Q   V C ++ +Q   +++D  C++  ++ P   R C       +W  +  +   C+  C   G G     + C+        + +E S C       ++ C    C   W+   W +CS +C
Sbjct:  343 WRETD-FFPCSVTCGGGYQLNSADCVEIRY--NKTVPDHHCHSYPENNKPKPKLKECNMDPCLESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCG-GGSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQPCNTFDCP-KWVAMEWSQCTVT--CGRGLRYRVVLCID--HNGQHTG----GCSSSLKPHIK----EDCLVPIACHKPRESVP-VEAKLPWLKQAQELEETKVATEDPTFI---PGPWSSCSVSCGVGLQKRWVKCRVLLSFTQAEVDLPEEECEGEKPVLQR--------TCSMGP--------CSGPGGSLQ--------WPVEVPANPTQLGFL------WEYRGFTACSVSCAV-GRQVAVVRCVRAGRQE--VVEDFFCDEL-RRPPAMVRICNPQPCPARWDFSEWS--QCSESC---GVGLQTRRVRCVRSVGSNLTESVELSECKGSRPPELQACNQHHCPPAWEAEEWQQCSHAC 780          

HSP 3 Score: 55.0694 bits (131), Expect = 3.057e-7
Identity = 110/482 (22.82%), Postives = 173/482 (35.89%), Query Frame = 2
Query:  239 LISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNI-IDC-------PL-----------------------TLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPK-SMPRHACSSTIKPPVSWRKCYDHMNTKECL---KDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNP-------------------AVGFQDWKLRTTLWNKEMLNEDPEVGM---TRNEVIQ----------WIKKGWSQCSVTCGVEGFQSREVHCEQS-EKQHYNILDDSVCEKKGQKKPLTRRTC 1480
            L S+ FK        Q    W E + W SCS +CG G++Q+ V+C+++    + +  +E   T      T + CN  +C     W   +WS+C+ TCG  G + R V C+   G        +  C  SL+P     C + I C       P+                       T +PG W  C  +  C  G Q+R + C  +L   + +  +P   C    + PV  R C    +   C      L+ P  +E+  N                QL +++ Y R    C V+  V R +                  +R  + GR  + +    D+         +   A++++ NP                    VG Q  ++R        L E  E+     +R   +Q          W  + W QCS  C V G Q R+V+C Q      +  L D  C+     KP T+R C
Sbjct:  402 LESDGFKEVMPYDHFQPLPRW-EQNPWTSCSVSCGGGSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQPCNTFDCPK---WVAMEWSQCTVTCG-RGLRYRVVLCIDHNG------QHTGGCSSSLKPHIKEDCLVPIACHKPRESVPVEAKLPWLKQAQELEETKVATEDPTFIPGPWSSCSVS--CGVGLQKRWVKCRVLLSFTQAEVDLPEEECEG--EKPVLQRTC----SMGPCSGPGGSLQWP--VEVPANPT--------------QLGFLWEY-RGFTACSVSCAVGRQVA----------------VVRCVRAGRQEVVEDFFCDE--------LRRPPAMVRICNPQPCPARWDFSEWSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSECKGSRPPELQACNQHHCPPAWEAEEWQQCSHAC-VRGTQWRKVYCRQRLAGGSFRKLPDEECDG---VKPATQRPC 819          

HSP 4 Score: 51.9878 bits (123), Expect = 2.730e-6
Identity = 50/175 (28.57%), Postives = 73/175 (41.71%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCE--QSEKQHYNILDDSVCEKKGQKKPLTRRTCQMA------------TQCPK--------WKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQG--QIIEASACDKKEKYNME---CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICI 1759
            +I   WS CSV+CGV G Q R V C    S  Q    L +  CE +   KP+ +RTC M              + P         W+  G     C+  C     G+    + C+  G  +++E   CD+  +       C  + C   W  S WS+CS SC G+G+  R + C+
Sbjct:  568 FIPGPWSSCSVSCGV-GLQKRWVKCRVLLSFTQAEVDLPEEECEGE---KPVLQRTCSMGPCSGPGGSLQWPVEVPANPTQLGFLWEYRGFT--ACSVSC---AVGRQVAVVRCVRAGRQEVVEDFFCDELRRPPAMVRICNPQPCPARWDFSEWSQCSESC-GVGLQTRRVRCV 732          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037051.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000074.1:160336:466926:1 gene:ENSAMXG00000043174.1 transcript:ENSAMXT00000037051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 3.082e-17
Identity = 58/189 (30.69%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  242 ISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC------ISILKNGKPKSM 790
            +S+    N  + ++     W+ +  W  CS TCG GT+  +  C K +     MV    C  +       ++C L  C    +W  G+W ECS++CG +G +TR V CV   G G   +  S+YC    RPE+   CN + CP     G W +C     C  GTQ RP+ C      I +  + KP ++
Sbjct:  824 LSDGANENNMVPDNAVPYSWV-LKRWTPCSKTCGGGTQTTRYGCRKNAEM--RMVHRSFCDKIRKPPDFYRDCYLRECVQP-IWVAGEWGECSKSCGRSGTQTRSVRCVQPLGDGKFKSVRSRYCSDE-RPESRRDCNRMLCPAEWKLGPWSQCSVT--CGNGTQERPVLCHTRDNTIGLCLDSKPAAL 1005          

HSP 2 Score: 58.9214 bits (141), Expect = 2.489e-8
Identity = 76/314 (24.20%), Postives = 129/314 (41.08%), Query Frame = 2
Query: 1052 GNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVI--QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH---QGQI--IEASAC-DKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRA-----PKCNLKCVDLYASCKPHA--KKCIQSIYRYTCCKSCS 1948
            G+   N HG   ++  + +KG     ++E+K+        GP     +I +R           +  + N+ + +   E  M  +  +   W+ K W+ CS TCG  G Q+    C ++ +    ++  S C+K  +K P   R C +  +C +          C+  C R G      ++ C+     G+   + +  C D++ +   +C    C   WK   WS+CS +CG  G   R ++C   +T D    LC   K   P  ++ CR      P+CN    D    CK     + C    ++  CCKSCS
Sbjct:  755 GDFFLNSHGDYPETRSIIEKGVEW--EYENKNNKDTIQTTGPLKNDVVIMIRMHGSTRTKVSAKYIIDNERLSDGANENNMVPDNAVPYSWVLKRWTPCSKTCG-GGTQTTRYGCRKNAEM--RMVHRSFCDKI-RKPPDFYRDCYLR-ECVQPIWVAGEWGECSKSCGRSGTQT--RSVRCVQPLGDGKFKSVRSRYCSDERPESRRDCNRMLCPAEWKLGPWSQCSVTCGN-GTQERPVLC---HTRDNTIGLCLDSK---PAALRPCRMDPCPRPRCN---TDRSVFCKMEVLYQYCSLPSFQRICCKSCS 1049          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts2 (A disintegrin and metalloproteinase with thrombospondin motifs 2 [Source:NCBI gene;Acc:103038015])

HSP 1 Score: 85.5001 bits (210), Expect = 1.592e-16
Identity = 61/188 (32.45%), Postives = 84/188 (44.68%), Query Frame = 2
Query:  284 QTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP-PVSWRKC 844
            +T  F   + +W+ CS  CG G +  +  C +KS    +MV   LC  +       + CN   C +  VW  G W ECS++CG  G +TR V CV  +  G     +SKYC    RPE   +CN   CP     G W +C     C  GTQ R + C          S P +   + ++P P   RKC
Sbjct:  839 ETAYFEWALKKWSHCSKPCGGGKQYTRFGCRRKS--DGKMVHRTLCSNISKPRAISRACNQKQCSEP-VWVTGDWEECSKSCGKTGTQTRPVRCVRPQADGTQKTINSKYCSDD-RPEGRRTCNRNLCPAQWRTGPWSQCSVT--CGNGTQERQVMC----------STPDNTIGACLEPKPEIIRKC 1010          

HSP 2 Score: 53.9138 bits (128), Expect = 7.820e-7
Identity = 81/340 (23.82%), Postives = 129/340 (37.94%), Query Frame = 2
Query: 1055 NTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRN------EVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH------QGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCR------------------------APKCNLKCV---DLYASCKPHA--KKCIQSIYRYTCCKSCSR 1951
            +   N  G+  +S  V +KG L   ++ + D        GP     +I V++ +        + TL  K +L +DP   M  +         +W  K WS CS  CG  G Q     C +  K    ++  ++C    + + ++R   Q     P W +TG + + C+  C + G       + C+       Q  I      D + +    C    C   W+T  WS+CS +CG  G   R ++C   +T D     C     P PE+I+ C+                        APK + +     D    C+     + C  S YR  CCKSCS+
Sbjct:  760 HLFLNDEGEFPESRAVIEKGVLW--EYSNDDDMETVQTTGPLRYGVLIMVQSHSTS------KVTLSYKYILPKDPPSSMENSLPVDETAYFEWALKKWSHCSKPCG-GGKQYTRFGCRR--KSDGKMVHRTLCSNISKPRAISRACNQKQCSEPVW-VTG-DWEECSKSCGKTGTQTRP--VRCVRPQADGTQKTINSKYCSDDRPEGRRTCNRNLCPAQWRTGPWSQCSVTCGN-GTQERQVMC---STPDNTIGACLE---PKPEIIRKCQLMPCSGDRGNFLIQWLSRADPEFPAPKISSRSRCKGDKSVFCRMEVLNQYCANSGYRQMCCKSCSQ 1077          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts2 (A disintegrin and metalloproteinase with thrombospondin motifs 2 [Source:NCBI gene;Acc:103038015])

HSP 1 Score: 85.1149 bits (209), Expect = 1.799e-16
Identity = 61/188 (32.45%), Postives = 84/188 (44.68%), Query Frame = 2
Query:  284 QTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP-PVSWRKC 844
            +T  F   + +W+ CS  CG G +  +  C +KS    +MV   LC  +       + CN   C +  VW  G W ECS++CG  G +TR V CV  +  G     +SKYC    RPE   +CN   CP     G W +C     C  GTQ R + C          S P +   + ++P P   RKC
Sbjct:  849 ETAYFEWALKKWSHCSKPCGGGKQYTRFGCRRKS--DGKMVHRTLCSNISKPRAISRACNQKQCSEP-VWVTGDWEECSKSCGKTGTQTRPVRCVRPQADGTQKTINSKYCSDD-RPEGRRTCNRNLCPAQWRTGPWSQCSVT--CGNGTQERQVMC----------STPDNTIGACLEPKPEIIRKC 1020          

HSP 2 Score: 53.5286 bits (127), Expect = 9.125e-7
Identity = 81/340 (23.82%), Postives = 129/340 (37.94%), Query Frame = 2
Query: 1055 NTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRN------EVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIH------QGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCR------------------------APKCNLKCV---DLYASCKPHA--KKCIQSIYRYTCCKSCSR 1951
            +   N  G+  +S  V +KG L   ++ + D        GP     +I V++ +        + TL  K +L +DP   M  +         +W  K WS CS  CG  G Q     C +  K    ++  ++C    + + ++R   Q     P W +TG + + C+  C + G       + C+       Q  I      D + +    C    C   W+T  WS+CS +CG  G   R ++C   +T D     C     P PE+I+ C+                        APK + +     D    C+     + C  S YR  CCKSCS+
Sbjct:  770 HLFLNDEGEFPESRAVIEKGVLW--EYSNDDDMETVQTTGPLRYGVLIMVQSHSTS------KVTLSYKYILPKDPPSSMENSLPVDETAYFEWALKKWSHCSKPCG-GGKQYTRFGCRR--KSDGKMVHRTLCSNISKPRAISRACNQKQCSEPVW-VTG-DWEECSKSCGKTGTQTRP--VRCVRPQADGTQKTINSKYCSDDRPEGRRTCNRNLCPAQWRTGPWSQCSVTCGN-GTQERQVMC---STPDNTIGACLE---PKPEIIRKCQLMPCSGDRGNFLIQWLSRADPEFPAPKISSRSRCKGDKSVFCRMEVLNQYCANSGYRQMCCKSCSQ 1087          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: paplna (papilin, proteoglycan like sulfated glycoprotein [Source:NCBI gene;Acc:103046715])

HSP 1 Score: 80.4925 bits (197), Expect = 5.113e-15
Identity = 68/216 (31.48%), Postives = 99/216 (45.83%), Query Frame = 2
Query:  290 QTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVP---GEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIK--KNTL 922
            Q +  ++ EWN CS  CG G++ ++V CI        +V D LC+       + + CN+  C    V     WS+CS TCGS G + RDV CV   GSG     DS  C    +P  + +C +  C   LV    G+WG C K+  CS+G + R + C    +N          CS+  KPP       +  NT+ C     +P + + +   NTL
Sbjct:  383 QVYSWKIGEWNQCSVACGGGSQVRRVECISHDASGMRVVEDSLCEAYSARPLSQQNCNIQQCAQYTV---SSWSQCSVTCGS-GEQMRDVMCV---GSGGTRLEDSM-CVNLPKPPTTQTCEMPAC-RNLVGWHIGDWGLCSKS--CSSGLRERQVICSDTQRN----LYGAEHCSAHPKPPT-----VESCNTQPCYSPQEVPSMQDPRGHDNTL 578          

HSP 2 Score: 65.855 bits (159), Expect = 1.697e-10
Identity = 60/219 (27.40%), Postives = 88/219 (40.18%), Query Frame = 2
Query:  248 ETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNC---------YDNYVWKP---------------GKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVS 832
            E +  N + +E     ++     W+ CS  CG G + + V C   +    E   D LC ++P  S   + CN   C         Y   +W+P               G+W++CS  CG  G + R VEC+  + SG  V  DS     S RP +  +CNI  C    V   W +C     C +G Q R + C+         SM    C +  KPP +
Sbjct:  291 EYYLPNGRSREG----YYWSYGSWSGCSRECGSGYQSRLVFCTVDN----EAYPDYLCASLPRPS-NNRTCNEQQCPLTRRMAYVYQPQMWRPKDPPRVYVQVYSWKIGEWNQCSVACG-GGSQVRRVECISHDASGMRVVEDSLCEAYSARPLSQQNCNIQQCAQYTV-SSWSQCSVT--CGSGEQMRDVMCVGSGGTRLEDSM----CVNLPKPPTT 492          

HSP 3 Score: 61.6178 bits (148), Expect = 3.041e-9
Identity = 53/188 (28.19%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 1304 EVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQI-IEASACDK--KEKYNMECPNEKCQ--VGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC 1852
            +V  W    W+QCSV CG  G Q R V C   +     +++DS+CE     +PL+++ C +  QC ++ ++  +   C+  C   G G+   ++ C+  G   +E S C    K      C    C+  VGW   +W  CS+SC   G+  R +IC            C +   P P  ++SC    C
Sbjct:  383 QVYSWKIGEWNQCSVACG-GGSQVRRVECISHDASGMRVVEDSLCEAY-SARPLSQQNCNI-QQCAQYTVSSWS--QCSVTC---GSGEQMRDVMCVGSGGTRLEDSMCVNLPKPPTTQTCEMPACRNLVGWHIGDWGLCSKSCSS-GLRERQVICSDTQRNLYGAEHCSAH--PKPPTVESCNTQPC 559          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 98.5969 bits (244), Expect = 2.873e-21
Identity = 81/306 (26.47%), Postives = 131/306 (42.81%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISP---TIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSC--NIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVW-KHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKV 1204
            E  EW +CS +CG G R + V C  ++   E   S+E  +      P    ++ C   +C     W    W  CS+TCGS+G ++R + C      G+  + D + C P  RP A  +C     +CP   V  EWG+   +      TQ R ++C       +  S+   +  S++  P++ R C      ++        P I   +   +      LL   VG  AY++  + +++ CPV  F    + W K G ++        D   V + G L+IR  +  D G +TC+AG    S  IK+
Sbjct:  679 ETSEWGACSASCGAGLRARSVGC-ARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPP--AWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLC-PDSRPLAQQACGGGQSECPAEWVASEWGQINTHQ--GNYTQHRDVSC-QFSTAAEATSVANASQCSSLPKPLASRACTLPPCNRKGGSSANGGPQILGVRRIYIPSPWENLLAFPVGGTAYLFPKSMVVLKCPVARFQHSRVRWEKDGRSLAE-----SDRHSVTRWGCLKIRCLQPDDIGVYTCVAGQARESFTIKL 972          

HSP 2 Score: 72.4034 bits (176), Expect = 3.461e-13
Identity = 61/223 (27.35%), Postives = 90/223 (40.36%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDKKEKYN--MECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPA-GSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKC--IQSI-------YRYTCCKSC 1945
            W+   WS CS  CG  G + R V C          L D  C  +G ++P     C+    CP+W +       CT +C+ +G G     + C +H G       C  K +      C  E C V W+T  W+ C+ SCG  G  AR + C    T  PA  + C  Q  P           +CN+      + C+  ++ C  +Q +       YR  CC++C
Sbjct: 1570 WVTGPWSDCSEACGA-GVRVRSVVCRSPAGA--TALPDYSC--RGAERPARAEPCKRHG-CPEWAVGAWA--ECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTHGFQARRVECAHVRTARPAPDAHCAWQHKPA-------TWQRCNITPCATTSECRDSSRYCEMVQKLNLCQLPTYRLRCCQAC 1777          

HSP 3 Score: 65.855 bits (159), Expect = 3.672e-11
Identity = 55/198 (27.78%), Postives = 83/198 (41.92%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV-------WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPV 829
            W E D +  CS++CG G +     C+        + SD  C   P      P ++EC++  C           YD+Y        W+   W+ CS +CG  G ++R V CV ++  G+L   +   C   LRP  +  CN+ DCP  +   EW  C     C  G + R + CI        +      C++ IKP V
Sbjct:  303 WRETD-FFPCSSSCGGGYQLTSAECVD--MRNARIASDHFCNYYPENKKPKPRLRECSMEPCPSSDGFKQIMSYDHYQPLPRPCRWEGSPWTACSSSCG-GGVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQPCNLYDCPKWMA-QEWSSCTVT--CGRGLKYRVVLCIDH------RGQHTGGCNTKIKPHV 487          

HSP 4 Score: 56.225 bits (134), Expect = 3.155e-8
Identity = 47/174 (27.01%), Postives = 70/174 (40.23%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC---VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC 805
             F  E   ++ CS +C  G R+  VIC+ K   T E   + LC          + C+   C     W+  +W  CS +CG+ G + R V C   V  E  G+     +  C    RP     C   DCP      +W  C +    S+G Q R + C  +L +G  + +    C
Sbjct:  616 AFDWEYGGFSHCSVSCAGGNREAIVICVNKE--TGEAEDESLCDADARPPQIQRPCHTLPCPSR--WETSEWGACSASCGA-GLRARSVGCARTVAREADGSEERQRATDCT-GPRPPDVEPCARSDCPPAWHARDWQPCSRTCG-SSGVQSRSLRCRRLLADGSSRDVDEQLC 782          

HSP 5 Score: 49.2914 bits (116), Expect = 4.241e-6
Identity = 47/176 (26.70%), Postives = 70/176 (39.77%), Query Frame = 2
Query:  311 DEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVS--DELCKTVPVISPTIKECNLGNCYD-------------------------NYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLR-PEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTC 754
            D W+ CS +CGPG R + V C     ++  +V   D  C+     S   + C LG C +                          + W+ G +S CS +C + G +   V CV  E +G     D   C+   R P+    C+ + CP      EWG C  +  C AG + R + C
Sbjct:  534 DAWSPCSRSCGPGVRTRAVRCRVLLPFSRSVVELPDGECEGERPASE--RPCALGPCVEAADGLLTDEEAQALEERGQGGDEALAFDWEYGGFSHCSVSC-AGGNREAIVICVNKE-TGEA--EDESLCDADARPPQIQRPCHTLPCPSRWETSEWGACSAS--CGAGLRARSVGC 701          

HSP 6 Score: 48.9062 bits (115), Expect = 5.953e-6
Identity = 46/184 (25.00%), Postives = 74/184 (40.22%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKT--RDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            W     W+ CS  CG G R + V+C   +  T   + D  C+     +   + C    C +   W  G W+EC+  C   G  T  R V C    G+     +    C    RP +  +C++  C +    G W  C  +   + G Q R + C  + +  +P   P   C+   K P +W++C
Sbjct: 1569 WWVTGPWSDCSEACGAGVRVRSVVCRSPAGAT--ALPDYSCRGAERPA-RAEPCKRHGCPE---WAVGAWAECTGRCVGLGIGTQHRRVLCFLHNGTA----APEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCG-THGFQARRVECAHV-RTARP--APDAHCAWQHK-PATWQRC 1737          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000756.1 (pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 5.655e-15
Identity = 90/393 (22.90%), Postives = 144/393 (36.64%), Query Frame = 2
Query:  902 EIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGN-TIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIA----GPKNASAIIKVRNPA---------------VGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVI------------QWIKKGWSQCSVTCGVEGFQSREVHCEQ-SEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDK-----KEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCN-LKCVDLYASCK--PHAKKCIQSIYRYTCCKSCSRL 1954
            E +   +V +R    LN+  G          +++ CPV      ++ W  G+  + +  G S   +  +K   LR+R       G   C+A    G   A+  I V   +                G Q W+LR    + E ++     G+ +  +              W  + W  CS +CG  G + R V C+  S       L   +CE     +P    +C     CP W    ++   CT +C+    G     + C    G ++  SACDK     +   +  C  E C   W+   WS+C+ +CG  G  +R L C     +   G    + + P P   + C    C   +C D    C      K C   +Y+  CC+SC  L
Sbjct:  234 EREHAGMVSLRGDTSLNVPTGH--------DLIVGCPVAGNTKPNMTWYLGSQPVQSLPGLSYQLLAGEKV--LRLRGVVGPWDGPVRCVAQNEAGTLTATLHIAVGELSWTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCSRSCG-GGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW--VALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLECAGAAADAAGGEHSCAWQ-PKPITWQRCNIIPCEKGECKDTTRYCHLVKRLKLCQLMMYKLRCCESCKDL 612          

HSP 2 Score: 55.8398 bits (133), Expect = 2.862e-8
Identity = 35/113 (30.97%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  491 WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPE--ASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            W PG+ S CS +CG+ G ++  + CV D    +L   D+  C+   +P   A   CN  DCP +    EWG C ++  C  G + R +TC  +  +G+   +P   C     P
Sbjct:  334 WTPGEPSPCSASCGNTGVQSWRLRCVRD----DLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCSRS--CGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGP 440          

HSP 3 Score: 51.6026 bits (122), Expect = 5.483e-7
Identity = 43/146 (29.45%), Postives = 65/146 (44.52%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTC---GPGTRQKKVICIKKSFYTEEMVSDELC-KTVPVISPTIKE-CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHK 718
             W+ +D W  C+  C     GT+ ++V C   +     +V D  C K+  V  P + + C+   C     W+PG+WSEC+ TCGS+G ++R +EC                C    +P     CNII C       E G+CK   +
Sbjct:  456 HWVALD-WGQCTGRCVGWMTGTKHRRVSCRTTNGT---LVPDSACDKSSSVARPALSQNCSAEACAGE--WRPGRWSECTATCGSHGFQSRRLECAGAA---ADAAGGEHSCAWQPKPITWQRCNIIPC-------EKGECKDTTR 585          

HSP 4 Score: 48.1358 bits (113), Expect = 7.121e-6
Identity = 50/182 (27.47%), Postives = 76/182 (41.76%), Query Frame = 2
Query:  308 VDEWNSCSTTCGPGTRQKKVICIKKSFYTEEM-VSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGS--NGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            V+EW +CS +CG G R + V C   S   E   +   LC+      PT +E +    +D   W    W +C+  C     G K R V C    G+  + +S         RP  S +C+   C     PG W +C      S G Q R + C     +    +   H+C+   K P++W++C
Sbjct:  396 VEEWGTCSRSCGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEE-SCAATHDCPHWVALDWGQCTGRCVGWMTGTKHRRVSCRTTNGT-LVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCG-SHGFQSRRLECAGAAAD---AAGGEHSCAWQPK-PITWQRC 570          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002439.1 (pep scaffold:Pmarinus_7.0:GL476354:10256:34034:-1 gene:ENSPMAG00000002227.1 transcript:ENSPMAT00000002439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.971e-12
Identity = 54/187 (28.88%), Postives = 79/187 (42.25%), Query Frame = 2
Query:  251 TFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPV---ISPTIKECNLGNC-----------YDNYV----WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCI 757
            T   N  +        W E D +  CS TCG G +     C+        +V+D+ C   P      P ++ECN+  C           YD++     W  G W+ CS +CG  G ++R V CV ++    L  ++   C  +LRP AS  CN+ DCP  L   EW  C     C  G +   + C+
Sbjct:  259 TVHANMSVPTQPLSHQWRETD-FFPCSVTCGGGYQLTSAECVDVRL--GRVVADQYCHYYPENKKPKPILRECNMEPCPASDGYKQIMSYDHFQPIPRWDGGPWTTCSSSCG-GGLQSRTVACVEEDLHSILHPAEDWKCMYTLRPVASQPCNLFDCPRWLAQ-EWSSCTAT--CGRGLRFSFIHCL 438          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000757.1 (pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000757.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 2.952e-12
Identity = 50/199 (25.13%), Postives = 78/199 (39.20%), Query Frame = 2
Query: 1217 VGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVI------------QWIKKGWSQCSVTCGVEGFQSREVHCEQ-SEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHC-IHQGQIIEASACDK-----KEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
             G Q W+LR    + E ++     G+ +  +              W  + W  CS +CG  G + R V C+  S       L   +CE     +P    +C     CP W    ++   CT +C+    G     + C    G ++  SACDK     +   +  C  E C   W+   WS+C+ +CG  G  +R L C
Sbjct:  527 TGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCSRSCG-GGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW--VALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLEC 722          

HSP 2 Score: 55.8398 bits (133), Expect = 3.176e-8
Identity = 35/113 (30.97%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  491 WKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPE--ASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            W PG+ S CS +CG+ G ++  + CV D    +L   D+  C+   +P   A   CN  DCP +    EWG C ++  C  G + R +TC  +  +G+   +P   C     P
Sbjct:  512 WTPGEPSPCSASCGNTGVQSWRLRCVRD----DLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTCSRS--CGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGP 618          

HSP 3 Score: 51.6026 bits (122), Expect = 7.509e-7
Identity = 32/95 (33.68%), Postives = 51/95 (53.68%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTC---GPGTRQKKVICIKKSFYTEEMVSDELC-KTVPVISPTIKE-CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC 565
             W+ +D W  C+  C     GT+ ++V C   +     +V D  C K+  V  P + + C+   C     W+PG+WSEC+ TCGS+G ++R +EC
Sbjct:  634 HWVALD-WGQCTGRCVGWMTGTKHRRVSCRTTNGT---LVPDSACDKSSSVARPALSQNCSAEACAGE--WRPGRWSECTATCGSHGFQSRRLEC 722          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: adamts17 (ADAM metallopeptidase with thrombospondin type 1 motif, 17 [Source:ZFIN;Acc:ZDB-GENE-121030-7])

HSP 1 Score: 67.781 bits (164), Expect = 5.730e-12
Identity = 61/209 (29.19%), Postives = 83/209 (39.71%), Query Frame = 2
Query:  197 MKISWNVFGIVFL-----VLISETFKVNAKIKESQTQT----FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPR 796
            +K   NV  ++F      +    T  VN   +  +        W  V  W +CS  CG G  +  + C K    ++  V DE C+ V       + CN   C +   WK  +WS CS+TCG  G +TR V C     SG  V +    C P  RP +S  C   DC        W +C    +C  GT+ R   C S        S PR
Sbjct:  241 LKQPLNVMVLLFHDHNVGIHYEFTVPVNRSARHGERPRTPLYMWTHVG-WENCSVQCGGGEVRSILGCTKIVNRSQSCVPDEDCRNVSRPPLQNRHCNSHPCPNR--WKVSEWSPCSRTCG-KGLQTRSVSCHLHLPSGGSVRTRDGRC-PKPRPPSSQGCQGHDCLGVWQATSWSQCSS--RCGKGTRVRTAQCTSPHGRCLATSRPR 442          

HSP 2 Score: 47.7506 bits (112), Expect = 9.333e-6
Identity = 51/184 (27.72%), Postives = 73/184 (39.67%), Query Frame = 2
Query:  305 EVDEWNSCSTTCGPGTRQKKVIC-IKKSFYTEEMVSDELC-KTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRH--ACSSTIKPPVSWRKC 844
            +V EW+ CS TCG G + + V C +           D  C K  P   P+ + C   +C    VW+   WS+CS  CG  G + R  +C    G           C  + RP     C           G+W KC  +  C  G Q R + C+  +         RH   C +  K PV++R+C
Sbjct:  346 KVSEWSPCSRTCGKGLQTRSVSCHLHLPSGGSVRTRDGRCPKPRP---PSSQGCQGHDCLG--VWQATSWSQCSSRCG-KGTRVRTAQCTSPHGR----------CLATSRPREQDGCEDYSQCYEWKTGDWSKCSTS--CGRGLQSRVVHCMHRVSG-------RHGSGCEADGK-PVTYREC 503          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM44])

HSP 1 Score: 75.0998 bits (183), Expect = 8.117e-14
Identity = 68/274 (24.82%), Postives = 121/274 (44.16%), Query Frame = 2
Query:   68 TDLANSITTVVNQQNHYIIYLDHWTL*HQQH*NISTKKIYLRQMKISWNVFGI---------VFLV-------LISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCK-TVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGN-----LVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            T+  +++  + +    Y+I L  W+   +      TK IY  +  +  +   I         +F+V        ++ T+ +      S +   W +   W++CS  CG G++++ V C++K   T   V + LC  + P  +   +EC    C  +  W   +WS CS TCG  G ++R V C  +  +G+     L ++     +P++    +  CN +DCP   +P EW  C K   C+ G Q R ++C     NG    +  + C + IKP
Sbjct:  654 TNADHNVLGIKDASGSYLINLPTWSTTVEA---AGTKVIYKHEDSVYQDTIDIPGPTNEQLGLFMVSVIGSNKAVTWTYLIPGNSSVSSSDVEW-KTGAWSACSKACGTGSQERDVACVRKDDKT--YVRESLCAGSKPAAN---QECETAKCVSS--WYTTEWSPCSATCG-KGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTV--TLNQECNKVDCPPEWMPTEWSACTKT--CAGGRQSRTLSCKLKDLNGAYHEVADYHCHNAIKP 911          

HSP 2 Score: 61.6178 bits (148), Expect = 9.678e-10
Identity = 36/117 (30.77%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  314 EWNSCSTTCGPGTRQKKVICIKKSFYTE---EMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCN 655
            EW+ CS TCG GT+ + VIC +++F      E + D  C          +ECN  +C     W P +WS C++TC + GR++R + C   + +G        +C  +++P    +CN
Sbjct:  805 EWSPCSATCGKGTQSRSVICRRETFTGSKQYETLPDASCTGSKPTVTLNQECNKVDCPPE--WMPTEWSACTKTC-AGGRQSRTLSCKLKDLNGAYHEVADYHCHNAIKPSRQQACN 918          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO36363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU7])

HSP 1 Score: 71.633 bits (174), Expect = 7.557e-13
Identity = 69/274 (25.18%), Postives = 111/274 (40.51%), Query Frame = 2
Query:   74 LANSITTVVNQQNHYIIYLDHWT---------L*HQQH*NISTKKIYLRQMKISWNVFGIVFLVLIS-----ETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPS--LRP---EASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNG--KPKSMPRHACSSTIKPPVS 832
            +  ++  + N    Y+I L  W+         + ++ + N+   +I +        +   V++  ++     + F+  + +  S     W     W SCSTTC  G R + + C++    T    S   C    +   +++ CN   C     W   +W  CS+TCG  G ++R V C     S +    D + C  S   RP   E S  CN I CP   VP  W +C     CS G   R + C  +  +G   P  +P + C   IKPP S
Sbjct:  312 VGYNVLGIQNSDGVYLISLPSWSTTVYAAGTKIVYEHNENLYRDRILIEGPTTEKLLLKFVYVYEVNGGVDIDYFRPVSGVLGSNVSYQW-ATSNWTSCSTTCAGGERSRVLYCVRSDDNT--FASHSACDAA-LRPASVEACNTQTCPPE--WHVTEWDTCSKTCG-RGSQSRAVFCRKKTTSSSHETIDDQICLDSGLTRPNVTEVSRYCNEIPCPPEWVPLAWSECST--TCSTGVTTRQLECRRLEASGVMSPPILPEN-CDHAIKPPTS 575          

HSP 2 Score: 65.0846 bits (157), Expect = 7.682e-11
Identity = 53/147 (36.05%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  266 AKIKESQTQTFWLE--VDEWNSCSTTCGPGTRQKKVICIKKSF-YTEEMVSDELCKTVPVISPTIKE----CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSD-SKYCEPSLRPEASSSCNIIDCPLTLV 682
            A ++   TQT   E  V EW++CS TCG G++ + V C KK+   + E + D++C    +  P + E    CN   C     W P  WSECS TC S G  TR +EC   E SG +      + C+ +++P  S  CN  D P TL+
Sbjct:  445 ASVEACNTQTCPPEWHVTEWDTCSKTCGRGSQSRAVFCRKKTTSSSHETIDDQICLDSGLTRPNVTEVSRYCNEIPCPPE--WVPLAWSECSTTC-STGVTTRQLECRRLEASGVMSPPILPENCDHAIKPPTSEPCN-SDNPCTLL 587          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM43])

HSP 1 Score: 70.8626 bits (172), Expect = 1.719e-12
Identity = 45/132 (34.09%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  299 WLEVDEWNSCSTTCGPGTRQKKVICIKK-SFYTEEMVSDELCK--TVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCN-IIDCPLTLV 682
            W E   W  CS TCG G++Q+ V+C +K +  T E   DE CK    P +S  ++ CN  +C     W P  WSECS TCG +G   R + C     +G         C+ +++P    +CN  ++CP+ L+
Sbjct:  855 WHETG-WRPCSKTCGKGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAE--WVPSSWSECSATCGPDGVTVRTLSCKRLNQNGVYEPVHKIQCKHAVQPSTQEACNQDVNCPMALI 983          

HSP 2 Score: 59.3066 bits (142), Expect = 5.297e-9
Identity = 51/198 (25.76%), Postives = 82/198 (41.41%), Query Frame = 2
Query:  242 ISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS---SCNIIDCPLTLVPGEWGKCKKNHKCSA-GTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            +  +F   +  K +     W E   W++C+  C  G + + V C +    T   VSD++CK       T ++CN   C     W    W  CS+TCG  G + R V C              + C+   +P+ S     CN +DCP   VP  W +C     C   G   R ++C  + +NG  + + +  C   ++P
Sbjct:  777 VDYSFYSPSPSKVTADDVEWTE-GSWSTCTEPCATGYQSRTVECRRTDDKT--WVSDDVCKLKSGKPDTERKCNEQPCASE--WHETGWRPCSKTCG-KGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAEWVPSSWSECSAT--CGPDGVTVRTLSCKRLNQNGVYEPVHKIQCKHAVQP 966          

HSP 3 Score: 57.7658 bits (138), Expect = 1.774e-8
Identity = 46/161 (28.57%), Postives = 72/161 (44.72%), Query Frame = 2
Query: 1310 IQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEAS-------ACDKKEKYNME-----CPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLIC 1756
            ++W +  WS C+  C   G+QSR V C +++ + +  + D VC+ K   KP T R C       +W  TG  P  C+  C     GK     H + + ++  A+        C + +K  +      C    C   W  S+WS+CS +CG  G+  R L C
Sbjct:  794 VEWTEGSWSTCTEPCAT-GYQSRTVECRRTDDKTW--VSDDVCKLK-SGKPDTERKCNEQPCASEWHETGWRP--CSKTC-----GKGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAEWVPSSWSECSATCGPDGVTVRTLSC 943          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO33987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN5])

HSP 1 Score: 70.8626 bits (172), Expect = 1.824e-12
Identity = 53/176 (30.11%), Postives = 80/176 (45.45%), Query Frame = 2
Query:  326 CSTTCGPGTRQKKVICIKKSFYTEEMVSDELCK--TVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKC 844
            CS TC  GT+  KV CI++   ++  +S   C   T P   P    CN   C     W+   W  CS+ CG  G ++R+V CV      + V  D  +C  + +P  SS+CN++DC  +   G+W +C  N      T R+ + C +   NG    +    C   + K P  W+ C
Sbjct: 1154 CSKTCAGGTQPHKVTCIREDDGSQ--ISSIHCNQDTRP---PGYGPCNTQACPAK--WEIHPWGPCSRRCG-GGNRSREVLCVQQVTQQSNVTVDESFCNATKKPTTSSTCNVVDCGPSWEIGDWSQCTGNPGQQGNTSRK-VECRNRFANGSISVLDDETCLEFSTKIPDRWKSC 1320          

HSP 2 Score: 51.6026 bits (122), Expect = 1.631e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query:  350 TRQKKVICIKKSFYTEEMVSDELCK--TVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKC 703
            T+  KV CI++   ++  +S   C   T P   P    CN   C     W+   W  CS+ CG  G ++R+V CV      ++V  D  +C  + +P  SS+CN++DC  +   G+W + 
Sbjct:  856 TQPHKVTCIREDDGSQ--ISSIHCNQDTRP---PGYAPCNTQACPAK--WEIHPWGPCSRRCG-GGNRSREVLCVQQFTQQSIVTVDESFCNATKKPTTSSTCNMVDCGPSWEIGDWSQA 967          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO37724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEZ8])

HSP 1 Score: 65.0846 bits (157), Expect = 3.806e-12
Identity = 47/131 (35.88%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  401 MVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDE-GSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSM 790
            MV  +LC  V    P  ++CN   C  +Y W+  +WS+CS TC SNG + RDV+C+  + G  N   SDS YC    +P  + +C   +C      G WG+C K   C  G Q R + C    ++GKP  +
Sbjct:   21 MVKYKLCYGVTRQKPWKRKCNTKICKASYFWRTYQWSQCSVTC-SNGIQVRDVKCISSKYGEPNKTASDS-YCGED-KPLTTRNCIRDECLAMWKAGPWGECSKT--CGRGLQTRTVECFD--RDGKPSFL 144          

HSP 2 Score: 54.6842 bits (130), Expect = 1.286e-8
Identity = 42/151 (27.81%), Postives = 66/151 (43.71%), Query Frame = 2
Query:  218 FGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSF-YTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDC 667
            + + + V   + +K     K  +   FW    +W+ CS TC  G + + V CI   +    +  SD  C     +  T + C    C    +WK G W ECS+TCG  G +TR VEC   +G  + + +D        R  ++  C + DC
Sbjct:   24 YKLCYGVTRQKPWKRKCNTKICKASYFW-RTYQWSQCSVTCSNGIQVRDVKCISSKYGEPNKTASDSYCGEDKPL--TTRNCIRDECLA--MWKAGPWGECSKTCG-RGLQTRTVECFDRDGKPSFLCTDES------RMRSTKHCTLNDC 162          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: paplna (papilin, proteoglycan like sulfated glycoprotein [Source:NCBI gene;Acc:101162499])

HSP 1 Score: 86.6557 bits (213), Expect = 6.075e-17
Identity = 59/166 (35.54%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  290 QTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLV--PGEWGKCKKNHKCSAGTQRRPMTCISILKNGKP 781
            QT    V +WN+CS TCG G++ + V C+        +V D LC       P+++ CN+  C + +V     WS CS +CGS G +TR V CV   GS  LV  DS  C   LRP A   C +  CP  +    G WG C ++  C +G++ R   C    +N  P
Sbjct:  357 QTRSWTVGDWNACSVTCGGGSQTRSVQCVSHDASGPRVVEDALCAAYAEAPPSLQTCNMQTCAEYHVT---GWSACSVSCGS-GEQTRSVTCV---GSDGLVLQDSS-CGTLLRPPAVQPCVMPACPRHIRWHVGPWGLCSRS--CGSGSRERQAVCSDQDRNLYP 512          

HSP 2 Score: 72.0182 bits (175), Expect = 1.922e-12
Identity = 55/198 (27.78%), Postives = 88/198 (44.44%), Query Frame = 2
Query:  248 ETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCIS----ILKNGKPKSMPRHACSSTIKPPV 829
            E +  N + +E     ++     W++CS  CG G + + V C        E   D LC ++P    + + CN   C     W  G W+ CS TCG  G +TR V+CV  + SG  V  D+     +  P +  +CN+  C    V G W  C  +  C +G Q R +TC+     +L++         +C + ++PP 
Sbjct:  289 EYYLPNGRSREG----YYWSFGSWSACSKECGSGYQSRLVFCT----IDNEAYPDYLCASLPRPQ-SNRTCNPQPCPQTRSWTVGDWNACSVTCG-GGSQTRSVQCVSHDASGPRVVEDALCAAYAEAPPSLQTCNMQTCAEYHVTG-WSACSVS--CGSGEQTRSVTCVGSDGLVLQD--------SSCGTLLRPPA 465          

HSP 3 Score: 58.9214 bits (141), Expect = 2.367e-8
Identity = 50/184 (27.17%), Postives = 83/184 (45.11%), Query Frame = 2
Query: 1316 WIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCI-HQGQIIEASACDK--KEKYNMECPNEKC--QVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKC 1852
            W    W+ CSVTCG  G Q+R V C   +     +++D++C    +  P + +TC M T C ++ +TG +   C+  C   G G+   ++ C+   G +++ S+C    +      C    C   + W    W  CSRSCG  G   R  +C  ++        C +Q  P P  ++ C +  C
Sbjct:  361 WTVGDWNACSVTCG-GGSQTRSVQCVSHDASGPRVVEDALCAAYAEAPP-SLQTCNMQT-CAEYHVTGWS--ACSVSC---GSGEQTRSVTCVGSDGLVLQDSSCGTLLRPPAVQPCVMPACPRHIRWHVGPWGLCSRSCGS-GSRERQAVCSDQDRNLYPVDRCGAQ--PRPATVERCNSQPC 533          

HSP 4 Score: 52.373 bits (124), Expect = 1.954e-6
Identity = 41/128 (32.03%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  467 GNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTL--VPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKC 844
            G   + Y W  G WS CS+ CGS G ++R V C  D    N    D   C    RP+++ +CN   CP T     G+W  C     C  G+Q R + C+S   +G P+ +    C++  + P S + C
Sbjct:  295 GRSREGYYWSFGSWSACSKECGS-GYQSRLVFCTID----NEAYPD-YLCASLPRPQSNRTCNPQPCPQTRSWTVGDWNACSVT--CGGGSQTRSVQCVSHDASG-PRVVEDALCAAYAEAPPSLQTC 413          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif 18 [Source:NCBI gene;Acc:101167025])

HSP 1 Score: 82.4185 bits (202), Expect = 1.299e-15
Identity = 64/190 (33.68%), Postives = 92/190 (48.42%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-EEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC-VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRK 841
             +W   D W  CS +CG G + + + C++K  Y  EE+V+  LC   P ISP  I+ CN   C     W  G WS+CS++CG   RK R V C   D G   +V  DS  C+   RP+A  +C +  CP    L  +   W +C ++  C +G QRR + C     +G     P   C +  KP V  ++
Sbjct:  930 AYWAAAD-WGPCSRSCGGGQQTRTLRCLRKVTYQREEVVALSLC---PAISPAQIQPCNTQACPPE--WSTGSWSQCSKSCGRGLRK-RSVFCRSTDPGIKAVVVPDS-MCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRS--CGSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQ 1109          

HSP 2 Score: 52.7582 bits (125), Expect = 1.576e-6
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 2
Query:  320 NSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKE--CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            + CS  C  G    K IC++     +  V+  +C   P   PT+    CN   C     W    W  CS++CG  G++TR + C+               C P++ P     CN   CP     G W +C K+  C  G ++R + C S     K   +P   C    +P
Sbjct:  880 SDCSAPCAGGRISTKAICLQDQ---KTQVNSSMCN--PHSRPTLGSHLCNTQPC--PAYWAAADWGPCSRSCG-GGQQTRTLRCLRKVTYQREEVVALSLC-PAISPAQIQPCNTQACPPEWSTGSWSQCSKS--CGRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRP 1038          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif 18 [Source:NCBI gene;Acc:101167025])

HSP 1 Score: 81.2629 bits (199), Expect = 2.894e-15
Identity = 64/190 (33.68%), Postives = 92/190 (48.42%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-EEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC-VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRK 841
             +W   D W  CS +CG G + + + C++K  Y  EE+V+  LC   P ISP  I+ CN   C     W  G WS+CS++CG   RK R V C   D G   +V  DS  C+   RP+A  +C +  CP    L  +   W +C ++  C +G QRR + C     +G     P   C +  KP V  ++
Sbjct:  897 AYWAAAD-WGPCSRSCGGGQQTRTLRCLRKVTYQREEVVALSLC---PAISPAQIQPCNTQACPPE--WSTGSWSQCSKSCGRGLRK-RSVFCRSTDPGIKAVVVPDS-MCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRS--CGSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQ 1076          

HSP 2 Score: 58.9214 bits (141), Expect = 2.104e-8
Identity = 69/246 (28.05%), Postives = 99/246 (40.24%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQ-HYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-----WKMTGINPDNCTNKCIRIGFGKIEGNLHC----IHQGQI-IEASACDKKEKYNME----CPNEKCQ------------VGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK-----CVDLYASCK--PHAKKCIQSIYRYTCCKSCS 1948
            +W    WSQCS +CG  G + R V C  ++      ++ DS+C  K   +P  + TC +  +CP+     W +T    + C+  C   G G     L C     H G +      C    K  ++    C    CQ            +GW +S W +CS SCGG G+  R + C+ +    PA      QK   P   ++C    C        CVD ++ C   P    C    Y   CCKSCS
Sbjct:  958 EWSTGSWSQCSKSCG-RGLRKRSVFCRSTDPGIKAVVVPDSMC--KQHHRPKAQETCVL-RRCPRNEKLQWMLTPW--EECSRSC---GSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQLCNRGPCQELVPGRASSTVVLGWYSSPWQQCSVSCGG-GVQTRSIQCLRQGR--PAAGCLPHQK---PVTSRACNTHFCPAAQRPELCVDQFSWCHLVPQHGVCNHKFYGQQCCKSCS 1188          

HSP 3 Score: 50.8322 bits (120), Expect = 5.709e-6
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 2
Query:  320 NSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKE--CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            + CS  C  G    K IC++     +  V+  +C   P   PT+    CN   C     W    W  CS++CG  G++TR + C+               C P++ P     CN   CP     G W +C K+  C  G ++R + C S     K   +P   C    +P
Sbjct:  847 SDCSAPCAGGRISTKAICLQDQ---KTQVNSSMCN--PHSRPTLGSHLCNTQPC--PAYWAAADWGPCSRSCG-GGQQTRTLRCLRKVTYQREEVVALSLC-PAISPAQIQPCNTQACPPEWSTGSWSQCSKS--CGRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRP 1005          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif 18 [Source:NCBI gene;Acc:101167025])

HSP 1 Score: 81.2629 bits (199), Expect = 3.023e-15
Identity = 64/190 (33.68%), Postives = 92/190 (48.42%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-EEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC-VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRK 841
             +W   D W  CS +CG G + + + C++K  Y  EE+V+  LC   P ISP  I+ CN   C     W  G WS+CS++CG   RK R V C   D G   +V  DS  C+   RP+A  +C +  CP    L  +   W +C ++  C +G QRR + C     +G     P   C +  KP V  ++
Sbjct:  899 AYWAAAD-WGPCSRSCGGGQQTRTLRCLRKVTYQREEVVALSLC---PAISPAQIQPCNTQACPPE--WSTGSWSQCSKSCGRGLRK-RSVFCRSTDPGIKAVVVPDS-MCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRS--CGSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQ 1078          

HSP 2 Score: 50.8322 bits (120), Expect = 6.193e-6
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 2
Query:  320 NSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKE--CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            + CS  C  G    K IC++     +  V+  +C   P   PT+    CN   C     W    W  CS++CG  G++TR + C+               C P++ P     CN   CP     G W +C K+  C  G ++R + C S     K   +P   C    +P
Sbjct:  849 SDCSAPCAGGRISTKAICLQDQ---KTQVNSSMCN--PHSRPTLGSHLCNTQPC--PAYWAAADWGPCSRSCG-GGQQTRTLRCLRKVTYQREEVVALSLC-PAISPAQIQPCNTQACPPEWSTGSWSQCSKS--CGRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRP 1007          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif 18 [Source:NCBI gene;Acc:101167025])

HSP 1 Score: 81.2629 bits (199), Expect = 3.117e-15
Identity = 64/190 (33.68%), Postives = 92/190 (48.42%), Query Frame = 2
Query:  293 TFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYT-EEMVSDELCKTVPVISPT-IKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVEC-VYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCP----LTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRK 841
             +W   D W  CS +CG G + + + C++K  Y  EE+V+  LC   P ISP  I+ CN   C     W  G WS+CS++CG   RK R V C   D G   +V  DS  C+   RP+A  +C +  CP    L  +   W +C ++  C +G QRR + C     +G     P   C +  KP V  ++
Sbjct:  930 AYWAAAD-WGPCSRSCGGGQQTRTLRCLRKVTYQREEVVALSLC---PAISPAQIQPCNTQACPPE--WSTGSWSQCSKSCGRGLRK-RSVFCRSTDPGIKAVVVPDS-MCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRS--CGSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQ 1109          

HSP 2 Score: 53.9138 bits (128), Expect = 6.475e-7
Identity = 69/259 (26.64%), Postives = 99/259 (38.22%), Query Frame = 2
Query: 1313 QWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQ-HYNILDDSVCEKKGQKKPLTRRTCQMATQCPK-----WKMTGINPDNCTNKCIRIGFGKIEGNLHC----IHQGQI-IEASACDKKEKYNME----CPNEKCQ------------VGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLK------------------CVDLYASCK--PHAKKCIQSIYRYTCCKSCS 1948
            +W    WSQCS +CG  G + R V C  ++      ++ DS+C  K   +P  + TC +  +CP+     W +T    + C+  C   G G     L C     H G +      C    K  ++    C    CQ            +GW +S W +CS SCGG G+  R + C+ +    PA      QK   P   ++C    C                     CVD ++ C   P    C    Y   CCKSCS
Sbjct:  991 EWSTGSWSQCSKSCG-RGLRKRSVFCRSTDPGIKAVVVPDSMC--KQHHRPKAQETCVL-RRCPRNEKLQWMLTPW--EECSRSC---GSGNQRRELRCGERDAHGGFVEFPVRRCRNLAKPLVDLQQLCNRGPCQELVPGRASSTVVLGWYSSPWQQCSVSCGG-GVQTRSIQCLRQGR--PAAGCLPHQK---PVTSRACNTHFCPAAQRPGTRDTAARLTVKEELCVDQFSWCHLVPQHGVCNHKFYGQQCCKSCS 1234          

HSP 3 Score: 51.2174 bits (121), Expect = 5.559e-6
Identity = 45/170 (26.47%), Postives = 67/170 (39.41%), Query Frame = 2
Query:  320 NSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKE--CNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKP 823
            + CS  C  G    K IC++     +  V+  +C   P   PT+    CN   C     W    W  CS++CG  G++TR + C+               C P++ P     CN   CP     G W +C K+  C  G ++R + C S     K   +P   C    +P
Sbjct:  880 SDCSAPCAGGRISTKAICLQDQ---KTQVNSSMCN--PHSRPTLGSHLCNTQPC--PAYWAAADWGPCSRSCG-GGQQTRTLRCLRKVTYQREEVVALSLC-PAISPAQIQPCNTQACPPEWSTGSWSQCSKS--CGRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRP 1038          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000079770.1 (SMESG000079770.1)

HSP 1 Score: 1316.98 bits (3407), Expect = 0.000e+0
Identity = 691/693 (99.71%), Postives = 693/693 (100.00%), Query Frame = 2
Query:  197 MKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALEKTDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKNSQKFEEIRTSIVNANNLTATEKKTQVLVNQTVSISTEKPKGF 2275
            MKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCS+SCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALEKTDLIIPKKSKNSKSNIQNSIKVNEKSFKAKPKNNKKSKNPKEKKNLNKIYKNSQKFEEIRTSIVNANNLTATEKKTQVLVNQTVS+STEKPKGF
Sbjct:    1 MKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSKSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALEKTDLIIPKKSKNSKSNIQNSIKVNEKSFKAKPKNNKKSKNPKEKKNLNKIYKNSQKFEEIRTSIVNANNLTATEKKTQVLVNQTVSVSTEKPKGF 693          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000073134.1 (SMESG000073134.1)

HSP 1 Score: 489.574 bits (1259), Expect = 3.064e-164
Identity = 243/593 (40.98%), Postives = 360/593 (60.71%), Query Frame = 2
Query:  218 FGIVFLVLISET---FKVNAKIKESQTQTFWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGK-CKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGD 1981
            FG + +++++     F   +       + F  E+D W+ CSTTCG G ++K   C KK+ Y  E +  + C+ +P I  T + CN G+C + YVWK   WS+CS TCG  G + R+VEC +   SG +V  D + C+ + +P++   CN  +CP   +  EW K C K   CS G QRR ++C+S+L  GK   +PR AC +  + PP SWR+C+DH++ K+C K     P I  +K TLVQMR+ + LN+ VGQ++YV+  TR+ +NCPV  F+  +++W H    Y Y GKSK+ IRV +KG+L I+ F  +DQG W C+AG  + S +IK ++P+ G++DW +R ++ NK+M NE  ++ M +   ++W+   WSQCSV+C   GFQSR V CE  +K+ Y  L D  C ++   KP  +R C     CP+W    +N + CT+ CI     +  G+L CI Q Q +    CD   K   EC N +C+V WK S W+KCSR+CG  GI ARYLIC+W+N++ PAG+LCY   + +P+V+KSC  PKCNLKCVD++ SCK   + C   IY ++CCK+C    + ++ + D
Sbjct:    4 FGGILIIILNFAICLFDGQSIGNRPIGKVFLEEIDIWSKCSTTCGEGVQEKFQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVV--DQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVVDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWAHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFKFTQKKQD 592          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000042318.1 (SMESG000042318.1)

HSP 1 Score: 476.478 bits (1225), Expect = 2.888e-159
Identity = 230/554 (41.52%), Postives = 321/554 (57.94%), Query Frame = 2
Query:  296 FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHACSSTIKPP-VSWRKCYDHMNTKECLKDLRIPPI---IEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSC 1945
             W +  EW+ CS TCG G + K+  C  K   T    S   C  +      I+ C    C + Y WK   WS+CS +CG+ G + RDVEC ++    N +     +C   ++P   S CN +DCP   V G+WGKC K   C  G Q+R + C  IL++G+ K MP   C +  +PP   WRKCYD +N  +CLK   IPP      +  N   QMR+ K++ + +GQ+AY+  Y+RI+I CPV  F   +I+W H N  + Y+G+    IRVD+ G++RIRK   +DQG W CIA     SAIIK+RNP+ GF+DW +R  LW   ML+ED    + R E++QWI   WS CSVTC  +G Q REVHCE+ E + Y +LDD+ CE K    P   R C  A +CP WK+  I+   CTN+C+ I    +   L CI+  Q +    C++K+K  + C NE C + W+ ++WSKCS+SC G+G  AR + C+WK+T   AGSLCY  K PLP+V++ C    CN+KC+DL   C    K+C Q++Y+Y CC +C
Sbjct:   28 LWQDSGEWSPCSVTCGEGKQTKEKFCAIKVNSTVIKTSKHRCSRLKASHTLIRFCYQTECPEKYRWKTSSWSQCSHSCGNLGFRFRDVECSHNISETNSIGVAEFFCAKFIKPMQRSLCNRVDCPPEFVTGKWGKCVKGQGCHPGNQKRKLNCSQILQSGEIKQMPLFRCYTKKRPPPAQWRKCYDFINIPKCLKG--IPPRKVEFTMSNNNFYQMRRAKIVQLQIGQIAYLLPYSRIIITCPVENFPQHNIIWTHKNDTFKYNGRVSKRIRVDRIGQIRIRKLLFQDQGEWNCIADRSQKSAIIKIRNPSSGFRDWAVRNNLWKTGMLSEDSNKPINRQELVQWITSDWSVCSVTCSGDGLQYREVHCEKVEPRFYLVLDDNDCE-KVTPAPNKMRNCYTAIECPLWKVERIDKSKCTNECVDIRLSSVLVELKCIYMNQDVPLHLCEQKKKPEITCQNEACHLDWRLNSWSKCSKSCDGVGFQARSIACVWKSTRKSAGSLCYENKFPLPKVVRECETKPCNMKCIDLSTKCSSEPKRCHQNLYKYLCCYTC 578          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000073115.1 (SMESG000073115.1)

HSP 1 Score: 420.624 bits (1080), Expect = 1.152e-137
Identity = 211/581 (36.32%), Postives = 326/581 (56.11%), Query Frame = 2
Query:  224 IVFLVLISETFKVNAKIKESQTQT-FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAE 1960
            +VF+  I       A+ +E + +  F  E++ W+SCS TCG G +QK  +C + + Y  E +  E C     + PTI++CN G+C + +VW  G W+ CS +CG+ G +TR+VEC+  EG     + D K+CE   +PEAS +C   +CP   +   W  C  + KC +G Q R + C+S+L NG    +P  AC    +  P + R C+    +++CL +      I+I   TLVQM   K L+I +GQ++++   TR+ + C +  F  R+I+W H +  + Y  ++ D +R+ K GR+ I KF   D+G W C AG  +    +K R    G++DW++R      ++ N   ++ +   ++ +W+   WS+CS++C   G Q R V+CE+     Y  L+D  C K  ++KP ++R C +   CPKW+++ ++   C+N CI IG   +  N+ CI + Q  +   CD K K  MEC N  C+V WK S W++CSRSCG  GI ARYLIC+WK T  PAG +C    + LP+V+KSC  PKC LKC+D+Y  C+   K C   I+ Y CCK+C    +
Sbjct:    7 VVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCH----SRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQ 579          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000068292.1 (SMESG000068292.1)

HSP 1 Score: 355.525 bits (911), Expect = 1.256e-112
Identity = 206/576 (35.76%), Postives = 300/576 (52.08%), Query Frame = 2
Query:  287 TQTF-WLEVDEWNSCSTTCGPGTRQKKVICIKKSFY-TEEMVSDELCKTVPVISPTIKECNLGNCYDN----YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLK----DLRIPPIIEIKKNT--LVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVE----GFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSRSCGGI---GIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAK-KCIQSIYRYTCCKSCSR 1951
            T TF W   +EW  CS  C  G   +  +C+K++ Y T E  +   C+       T + C LG C  N    +VW+ G WS C + CG +G + RDV C+     G  ++S    C+    P    SC   DCP   +  +W KC ++  C    +RR + C++I  +GK K      C     +PP SW  C+   N + CL+    + +    IEIK +   + QMR TK L I VGQ AYV  +TR+ I CP+       I W+HGN  Y YHG S++ IRV++KG L IR+F   D G W C AG   A A + +  P+ GF +W  R    N  MLNE+      R E I WIK  WS CS TC       G+Q+R+V CE+ E Q+Y I++D  C      KP+T + C+   +CPKW +   + + C++ C+ IG  +   N+ C    + +++S CD ++  N+ C N+KCQ+ +    WS+CS SC       I +R + CIWK+T  PA +LC  Q++P   + K CR PKC L C DL  +C   +K +C  S++ + CC  C++
Sbjct:   23 TSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGRCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDNKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTN-QHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPP---LKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGLARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTPACVKQSKYRCRSSLFNHFCCAFCNK 593          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL15.765e-2828.66ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTSL32.462e-2328.53ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL32.917e-2328.53ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTS171.189e-1528.99ADAM metallopeptidase with thrombospondin type 1 m... [more]
PAPLN3.714e-1432.18papilin, proteoglycan like sulfated glycoprotein [... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-41.123e-4124.92pep chromosome:WBcel235:I:8931035:8937718:-1 gene:... [more]
madd-49.563e-4124.92pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
madd-41.354e-4024.92pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
gon-14.388e-1331.33A disintegrin and metalloproteinase with thrombosp... [more]
gon-14.771e-1331.33A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nolo1.833e-2228.44gene:FBgn0051619 transcript:FBtr0085902[more]
nolo1.941e-2228.44gene:FBgn0051619 transcript:FBtr0307497[more]
nolo1.941e-2228.44gene:FBgn0051619 transcript:FBtr0110959[more]
nolo2.040e-2228.44gene:FBgn0051619 transcript:FBtr0301000[more]
nolo2.306e-2228.44gene:FBgn0051619 transcript:FBtr0339132[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl37.412e-2429.22ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
adamts21.663e-1733.90ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts21.836e-1733.90ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts173.504e-1628.50ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts173.521e-1628.50ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL11.618e-2724.46ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
vash15.162e-2630.00vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
vash12.718e-2529.43vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
ADAMTSL11.333e-2426.67ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL11.557e-2426.67ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adamtsl11.433e-3029.97ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl12.329e-2626.55ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl32.764e-2529.13ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499][more]
Adamts187.842e-1633.51a disintegrin-like and metallopeptidase (reprolysi... [more]
Adamts171.968e-1529.80a disintegrin-like and metallopeptidase (reprolysi... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90884|MADD4_CAEEL1.723e-3924.92Protein madd-4 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q8N6G6|ATL1_HUMAN2.768e-2728.66ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8BLI0|ATL1_MOUSE1.629e-2526.55ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|P82987|ATL3_HUMAN1.183e-2228.53ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q4VC17|ATS18_MOUSE5.485e-1533.51A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YRS13.041e-16241.82AdamTS protein 3 OS=Fasciola gigantica OX=46835 GN... [more]
A0A4E0R7Q34.113e-16241.82AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A183JCE13.497e-15541.48Ig-like domain-containing protein OS=Schistosoma c... [more]
A0A094ZL011.277e-15441.06ADAMTS-like protein 3 OS=Schistosoma haematobium O... [more]
A0A183A6D24.868e-15342.30Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl32.345e-2328.34ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000037051.13.082e-1730.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
adamts21.592e-1632.45A disintegrin and metalloproteinase with thrombosp... [more]
adamts21.799e-1632.45A disintegrin and metalloproteinase with thrombosp... [more]
paplna5.113e-1531.48papilin, proteoglycan like sulfated glycoprotein [... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl32.873e-2126.47ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ENSPMAT00000000756.15.655e-1522.90pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 ... [more]
ENSPMAT00000002439.11.971e-1228.88pep scaffold:Pmarinus_7.0:GL476354:10256:34034:-1 ... [more]
ENSPMAT00000000757.12.952e-1225.13pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 ... [more]
adamts175.730e-1229.19ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352028.117e-1424.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363637.557e-1325.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352221.719e-1234.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339871.824e-1230.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377243.806e-1235.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paplna6.075e-1735.54papilin, proteoglycan like sulfated glycoprotein [... [more]
adamts181.299e-1533.68ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts182.894e-1533.68ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts183.023e-1533.68ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts183.117e-1533.68ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079770.10.000e+099.71SMESG000079770.1[more]
SMESG000073134.13.064e-16440.98SMESG000073134.1[more]
SMESG000042318.12.888e-15941.52SMESG000042318.1[more]
SMESG000073115.11.152e-13736.32SMESG000073115.1[more]
SMESG000068292.11.256e-11235.76SMESG000068292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002655 ID=SMED30002655|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2418bp
CAAATTTTGTGACTTATTATTTGGTTTTCGTTTTTTGATACACTTTCTTT
ATAATTGATCATTGTAAACTGATTTAGCAAATTCAATTACGACAGTAGTT
AATCAGCAAAACCATTATATTATCTATCTGGATCATTGGACATTATAGCA
TCAACAGCATTGAAATATTTCAACAAAAAAAATTTATCTTCGACAGATGA
AAATTTCTTGGAACGTTTTTGGAATCGTTTTCCTTGTGTTGATTTCGGAA
ACTTTCAAGGTCAATGCCAAAATTAAAGAAAGTCAAACACAAACTTTTTG
GCTGGAAGTGGATGAATGGAATTCATGCTCCACAACTTGTGGTCCTGGAA
CTCGACAGAAGAAAGTAATTTGTATTAAAAAGTCATTCTATACGGAAGAA
ATGGTTTCCGATGAACTATGCAAAACCGTTCCGGTTATATCTCCAACAAT
AAAAGAGTGTAATTTAGGCAATTGTTATGATAATTATGTTTGGAAACCCG
GAAAATGGAGTGAATGCTCACAAACTTGTGGCAGTAATGGCAGAAAGACA
AGAGACGTTGAGTGTGTATATGATGAAGGATCTGGAAATCTTGTGAACAG
TGATTCGAAATACTGTGAACCGTCATTGAGACCTGAAGCATCGTCTTCGT
GTAACATAATTGACTGTCCGTTAACACTCGTCCCAGGCGAATGGGGAAAA
TGTAAGAAAAATCACAAATGTTCAGCAGGGACTCAAAGACGACCAATGAC
CTGTATTTCAATTCTCAAAAACGGCAAACCTAAATCCATGCCGAGACACG
CGTGCTCATCAACCATAAAGCCTCCAGTTAGTTGGAGAAAATGCTATGAT
CACATGAACACAAAAGAATGTTTGAAAGATCTTCGAATTCCTCCAATAAT
TGAAATAAAAAAGAACACCTTAGTTCAAATGCGTAAAACCAAACTCTTGA
ATATTGACGTTGGACAGTTGGCATATGTATATTTGTATACAAGAATTATG
ATTAATTGCCCAGTTACTTATTTTGTTCCCAGAGATATTGTTTGGAAACA
CGGAAATACAATTTACAATTATCATGGAAAGTCGAAAGACAGTATACGAG
TAGATAAAAAAGGTCGGTTAAGAATAAGAAAGTTTGAATCTAAAGATCAA
GGAACTTGGACATGTATTGCTGGACCAAAAAATGCATCTGCCATTATTAA
AGTTCGTAATCCTGCTGTTGGATTTCAAGATTGGAAATTAAGAACAACAC
TCTGGAATAAAGAAATGCTCAATGAAGATCCAGAAGTAGGAATGACCAGA
AATGAAGTTATTCAGTGGATTAAAAAAGGTTGGAGTCAATGTTCTGTAAC
TTGTGGAGTCGAAGGTTTTCAGAGCAGGGAGGTGCACTGTGAACAATCTG
AGAAACAACATTATAACATTCTTGACGATTCTGTTTGTGAGAAAAAAGGT
CAGAAAAAACCGCTTACTAGAAGAACCTGTCAAATGGCTACACAATGTCC
AAAATGGAAAATGACTGGAATTAATCCAGATAATTGCACAAATAAATGTA
TAAGAATCGGTTTCGGAAAAATAGAAGGAAATCTTCATTGCATTCATCAA
GGTCAGATAATAGAAGCAAGTGCTTGTGATAAAAAAGAAAAGTATAATAT
GGAATGTCCAAATGAAAAATGTCAAGTTGGTTGGAAGACAAGTAATTGGT
CAAAGTGCTCTAGGAGCTGTGGCGGAATTGGAATAATGGCGAGATATTTG
ATTTGTATATGGAAAAATACAGAAGATCCTGCTGGTTCACTATGTTATAG
CCAGAAAATTCCGTTGCCAGAAGTGATAAAATCATGCAGAGCTCCAAAAT
GCAATTTGAAATGCGTTGATTTGTACGCATCTTGCAAGCCTCACGCGAAA
AAGTGCATCCAATCAATTTACCGCTACACTTGCTGTAAATCTTGCTCCCG
ATTGGCTGAGTTGTCGAAAATGCAAGGCGACGCTCTTGAAAAAACTGATT
TAATAATACCAAAAAAATCGAAAAATTCAAAATCAAATATCCAAAATTCA
ATTAAAGTCAATGAGAAATCTTTCAAAGCAAAACCAAAAAATAATAAAAA
ATCAAAAAATCCAAAAGAAAAAAAAAATTTAAATAAAATCTATAAAAATT
CTCAGAAATTTGAGGAAATCAGAACTTCAATTGTTAATGCCAACAATTTG
ACAGCAACAGAAAAAAAGACCCAAGTTTTAGTTAATCAAACTGTTTCCAT
TTCAACAGAAAAACCGAAAGGTTTTTAAACTATTTCATCAAAAGAGCTGT
CCATATTCATGATGCTTTTATAGATATTTTTGCACATTAATTTTCATCCG
TTTAAACATGTTGATATTTTTTTTAAATTTTTATGAAAGAAAAATAAATG
TGAATGTTTTGTTTTCCA
back to top

protein sequence of SMED30002655-orf-1

>SMED30002655-orf-1 ID=SMED30002655-orf-1|Name=SMED30002655-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=694bp
MKISWNVFGIVFLVLISETFKVNAKIKESQTQTFWLEVDEWNSCSTTCGP
GTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWK
PGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASS
SCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPR
HACSSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKL
LNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSI
RVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRT
TLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQ
SEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNK
CIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSN
WSKCSRSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAP
KCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAELSKMQGDALEKT
DLIIPKKSKNSKSNIQNSIKVNEKSFKAKPKNNKKSKNPKEKKNLNKIYK
NSQKFEEIRTSIVNANNLTATEKKTQVLVNQTVSISTEKPKGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036179Ig-like_dom_sf
IPR000884TSP1_rpt
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 374..435
e-value: 0.53
score: 11.7
coord: 35..94
e-value: 0.3
score: 13.9
coord: 495..553
e-value: 0.99
score: 9.3
coord: 98..158
e-value: 0.088
score: 18.7
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 498..552
e-value: 8.1E-4
score: 19.6
coord: 102..131
e-value: 0.001
score: 19.2
coord: 39..63
e-value: 0.0012
score: 19.0
coord: 379..405
e-value: 0.0022
score: 18.2
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 32..94
score: 9.183
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 95..158
score: 9.623
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 370..435
score: 8.765
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 492..553
score: 8.705
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 370..435
e-value: 2.0E-7
score: 33.4
coord: 494..552
e-value: 5.5E-6
score: 28.7
coord: 97..158
e-value: 7.8E-9
score: 37.8
coord: 32..93
e-value: 2.5E-7
score: 33.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 32..93
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 487..552
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 373..430
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 95..157
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 257..339
e-value: 2.0E-7
score: 32.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 610..644
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 19..188
NoneNo IPR availablePANTHERPTHR13723:SF248coord: 412..589
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 172..437
NoneNo IPR availablePANTHERPTHR13723:SF248coord: 172..437
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 412..589
NoneNo IPR availablePANTHERPTHR13723:SF248coord: 19..188
NoneNo IPR availableCDDcd00096Igcoord: 267..325
e-value: 0.0061417
score: 34.1401
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.75
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 232..325
score: 6.796
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 261..335