SMED30002653

Overview
NameSMED30002653
Smed IDSMED30002653
Length (bp)1330
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002653 (SMED30002653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002653 (SMED30002653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30002653 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000643:70359..71603 +5414
Homology
BLAST of SMED30002653 vs. TrEMBL
Match: A0A4S2LZM5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003893 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.235e-19
Identity = 70/317 (22.08%), Postives = 148/317 (46.69%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQF-LSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIV 948
            +E  +P+   P V+   + ++M   +   P +R G+ +E+E ++   +TP+V + +  + QT+  +   P +   F +  E P  + V P+V   ++ TQ+  D+   P V  GF +++E ++   VTP + +  + S++  ++ +   +  GY +  E    + +VP+V+ +++ T+++TE+      R G  S   + +P ++TPM                                 + YK+R+ +    +P   + ++SE +++  + ++P V    + T   TDLT K    PGF S       + ++P+V
Sbjct: 2034 EEHEHPITAVPYVRH--YKTRMERSLVAKPRLRPGYRSEMEHKQTFSVTPMVPEYRTTIEQTLPSV---PRLKPGFATEVERPISMDVVPVVP--EYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMVPE--YESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPM--------------------------------TTEYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV 2309          

HSP 2 Score: 93.9745 bits (232), Expect = 1.643e-16
Identity = 64/326 (19.63%), Postives = 151/326 (46.32%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK-GKNLTRHFS 978
            EV  P+ +  +    ++ +Q+ TD+   P V+ GF +E E  + + +TP+V   ++ S+   ++   P + + + S  E  + ++V P+V+  ++ T++  ++ + P    GF ++  + +P +VTP   +  + +++   +  +  +  GY++ +E  T +E+VPVV  + + T+++T++     V+ G  S ++ M   ++ P++                                  +K+ ++ E    P+  +   + + +E  L     +KQ Q  +   T L  + S T  + +  +    +N++P+V   +  T HF+
Sbjct: 2107 EVERPISMDVVPVVPEYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMV--PEYESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTTE--YKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV--------------------------------PEFKTELSTEVHARPQLTAGHETRLDYERQLQWETELKQYQ--SAVSTRLPSRPSLTSVYSATLEHETSMNVVPVVPYDERFTSHFT 2394          

HSP 3 Score: 85.8853 bits (211), Expect = 8.326e-14
Identity = 48/195 (24.62%), Postives = 107/195 (54.87%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESR 585
            +E +  + +TPMV + +  S++   +   P +  G+ +E E +  + + P+VR++++ ++  TE+   P     F S   +P  + VTP+    ++ T+ME  + ++PI+ +G+ +++E     +V P +    + +++T +++    V  G+ + ++   ++E+VPVV E  F T++STE+     +  G E+R
Sbjct: 2145 REYIRSMSVTPMVPEYE--SKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTT--EYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVVPE--FKTELSTEVHARPQLTAGHETR 2333          
BLAST of SMED30002653 vs. TrEMBL
Match: A0A4S2M563 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003893 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.354e-19
Identity = 70/317 (22.08%), Postives = 148/317 (46.69%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQF-LSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIV 948
            +E  +P+   P V+   + ++M   +   P +R G+ +E+E ++   +TP+V + +  + QT+  +   P +   F +  E P  + V P+V   ++ TQ+  D+   P V  GF +++E ++   VTP + +  + S++  ++ +   +  GY +  E    + +VP+V+ +++ T+++TE+      R G  S   + +P ++TPM                                 + YK+R+ +    +P   + ++SE +++  + ++P V    + T   TDLT K    PGF S       + ++P+V
Sbjct: 2034 EEHEHPITAVPYVRH--YKTRMERSLVAKPRLRPGYRSEMEHKQTFSVTPMVPEYRTTIEQTLPSV---PRLKPGFATEVERPISMDVVPVVP--EYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMVPE--YESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPM--------------------------------TTEYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV 2309          

HSP 2 Score: 93.9745 bits (232), Expect = 1.881e-16
Identity = 64/326 (19.63%), Postives = 151/326 (46.32%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK-GKNLTRHFS 978
            EV  P+ +  +    ++ +Q+ TD+   P V+ GF +E E  + + +TP+V   ++ S+   ++   P + + + S  E  + ++V P+V+  ++ T++  ++ + P    GF ++  + +P +VTP   +  + +++   +  +  +  GY++ +E  T +E+VPVV  + + T+++T++     V+ G  S ++ M   ++ P++                                  +K+ ++ E    P+  +   + + +E  L     +KQ Q  +   T L  + S T  + +  +    +N++P+V   +  T HF+
Sbjct: 2107 EVERPISMDVVPVVPEYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMV--PEYESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTTE--YKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV--------------------------------PEFKTELSTEVHARPQLTAGHETRLDYERQLQWETELKQYQ--SAVSTRLPSRPSLTSVYSATLEHETSMNVVPVVPYDERFTSHFT 2394          

HSP 3 Score: 85.5001 bits (210), Expect = 9.188e-14
Identity = 48/195 (24.62%), Postives = 107/195 (54.87%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESR 585
            +E +  + +TPMV + +  S++   +   P +  G+ +E E +  + + P+VR++++ ++  TE+   P     F S   +P  + VTP+    ++ T+ME  + ++PI+ +G+ +++E     +V P +    + +++T +++    V  G+ + ++   ++E+VPVV E  F T++STE+     +  G E+R
Sbjct: 2145 REYIRSMSVTPMVPEYE--SKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTT--EYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVVPE--FKTELSTEVHARPQLTAGHETR 2333          
BLAST of SMED30002653 vs. TrEMBL
Match: A0A4S2M574 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003893 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.497e-19
Identity = 70/317 (22.08%), Postives = 148/317 (46.69%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQF-LSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIV 948
            +E  +P+   P V+   + ++M   +   P +R G+ +E+E ++   +TP+V + +  + QT+  +   P +   F +  E P  + V P+V   ++ TQ+  D+   P V  GF +++E ++   VTP + +  + S++  ++ +   +  GY +  E    + +VP+V+ +++ T+++TE+      R G  S   + +P ++TPM                                 + YK+R+ +    +P   + ++SE +++  + ++P V    + T   TDLT K    PGF S       + ++P+V
Sbjct: 2034 EEHEHPITAVPYVRH--YKTRMERSLVAKPRLRPGYRSEMEHKQTFSVTPMVPEYRTTIEQTLPSV---PRLKPGFATEVERPISMDVVPVVP--EYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMVPE--YESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPM--------------------------------TTEYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV 2309          

HSP 2 Score: 93.9745 bits (232), Expect = 1.866e-16
Identity = 64/326 (19.63%), Postives = 151/326 (46.32%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK-GKNLTRHFS 978
            EV  P+ +  +    ++ +Q+ TD+   P V+ GF +E E  + + +TP+V   ++ S+   ++   P + + + S  E  + ++V P+V+  ++ T++  ++ + P    GF ++  + +P +VTP   +  + +++   +  +  +  GY++ +E  T +E+VPVV  + + T+++T++     V+ G  S ++ M   ++ P++                                  +K+ ++ E    P+  +   + + +E  L     +KQ Q  +   T L  + S T  + +  +    +N++P+V   +  T HF+
Sbjct: 2107 EVERPISMDVVPVVPEYKTQLSTDVPARPQVQRGFSSEREYIRSMSVTPMV--PEYESKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTTE--YKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVV--------------------------------PEFKTELSTEVHARPQLTAGHETRLDYERQLQWETELKQYQ--SAVSTRLPSRPSLTSVYSATLEHETSMNVVPVVPYDERFTSHFT 2394          

HSP 3 Score: 85.5001 bits (210), Expect = 9.114e-14
Identity = 48/195 (24.62%), Postives = 107/195 (54.87%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESR 585
            +E +  + +TPMV + +  S++   +   P +  G+ +E E +  + + P+VR++++ ++  TE+   P     F S   +P  + VTP+    ++ T+ME  + ++PI+ +G+ +++E     +V P +    + +++T +++    V  G+ + ++   ++E+VPVV E  F T++STE+     +  G E+R
Sbjct: 2145 REYIRSMSVTPMVPEYE--SKLEHKVVERPVLEAGYASEGEHEHPMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTT--EYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVVQPGFVSEQQHMLTMEVVPVVPE--FKTELSTEVHARPQLTAGHETR 2333          
BLAST of SMED30002653 vs. TrEMBL
Match: G7Y4Z3 (Titin OS=Clonorchis sinensis OX=79923 GN=CLF_101087 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.856e-19
Identity = 69/317 (21.77%), Postives = 151/317 (47.63%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQF-LSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIV 948
            +E  +P+   P V+   + ++M   +   P +R G+ +E+E ++ L +TP+V + +  + QT+  +   P +   F +  E P  + V P+V   ++ TQ+  ++   P V  GF +++E ++   VTP + +  + +++  ++ +   +  GY + +E   ++ +VP+V+ +++ T+++TE+      R G  S   + +P ++TPM                                 + YK+R+ +    +P   + ++SE +++  + ++P V    + T   TDLT K    PGF S       + ++P+V
Sbjct: 2018 EEHEHPITAVPYVRH--YKTRMERSLAAKPRLRPGYRSEMEHKQTLSVTPMVPEYRTTIEQTLPSV---PRLKPGFATEVERPISMDVVPVVP--EYKTQLSTEVPARPQVQRGFSSEREYIRSMSVTPMVPE--YETKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASEATVPRPIEVTPM--------------------------------TTEYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVV 2293          

HSP 2 Score: 92.0485 bits (227), Expect = 6.954e-16
Identity = 64/330 (19.39%), Postives = 152/330 (46.06%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSH----HPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK-GKNLTRHFS 978
            EV  P+ +  +    ++ +Q+ T++   P V+ GF +E E  + + +TP+V + +      T+L H     P + + + S +E  + ++V P+V+  ++ T++  ++ + P    GF ++  + +P +VTP   +  + +++   +  +  +  GY++ +E  T +E+VPVV  + + T+++T++      + G  S ++ M   ++ P++                                  +K+ ++ E    P+  +   + + +E  L     +KQ Q  +  +T L  + S T  + +  +    +N++P+V   +  T HF+
Sbjct: 2091 EVERPISMDVVPVVPEYKTQLSTEVPARPQVQRGFSSEREYIRSMSVTPMVPEYE------TKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASEATVPRPIEVTPMTTE--YKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVV--------------------------------PEFKTELSTEVHARPQLTTGHETRLDYERQLQWETELKQYQ--SAVETRLPSRPSLTSVYSATLEHETSMNVVPVVPYDERFTSHFT 2378          

HSP 3 Score: 83.1889 bits (204), Expect = 5.271e-13
Identity = 46/195 (23.59%), Postives = 106/195 (54.36%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESR 585
            +E +  + +TPMV + +  +++   +   P +  G+ +E E +  + + P+VR++++ ++  TE+   P     F S   +P  + VTP+    ++ T+ME  + ++PI+ +G+ +++E     +V P +    + +++T +++       G+ + ++   ++E+VPVV E  F T++STE+     +  G E+R
Sbjct: 2129 REYIRSMSVTPMVPEYE--TKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASEATVPRPIEVTPMTT--EYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVVPE--FKTELSTEVHARPQLTTGHETR 2317          
BLAST of SMED30002653 vs. TrEMBL
Match: A0A419PWM3 (Muscle M-line assembly protein unc-89 (Fragment) OS=Clonorchis sinensis OX=79923 GN=unc-89 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.574e-19
Identity = 69/317 (21.77%), Postives = 151/317 (47.63%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQF-LSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIV 948
            +E  +P+   P V+   + ++M   +   P +R G+ +E+E ++ L +TP+V + +  + QT+  +   P +   F +  E P  + V P+V   ++ TQ+  ++   P V  GF +++E ++   VTP + +  + +++  ++ +   +  GY + +E   ++ +VP+V+ +++ T+++TE+      R G  S   + +P ++TPM                                 + YK+R+ +    +P   + ++SE +++  + ++P V    + T   TDLT K    PGF S       + ++P+V
Sbjct: 2034 EEHEHPITAVPYVRH--YKTRMERSLAAKPRLRPGYRSEMEHKQTLSVTPMVPEYRTTIEQTLPSV---PRLKPGFATEVERPISMDVVPVVP--EYKTQLSTEVPARPQVQRGFSSEREYIRSMSVTPMVPE--YETKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPM--------------------------------TTEYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVV 2309          

HSP 2 Score: 91.6633 bits (226), Expect = 9.133e-16
Identity = 64/330 (19.39%), Postives = 152/330 (46.06%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSH----HPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK-GKNLTRHFS 978
            EV  P+ +  +    ++ +Q+ T++   P V+ GF +E E  + + +TP+V + +      T+L H     P + + + S +E  + ++V P+V+  ++ T++  ++ + P    GF ++  + +P +VTP   +  + +++   +  +  +  GY++ +E  T +E+VPVV  + + T+++T++      + G  S ++ M   ++ P++                                  +K+ ++ E    P+  +   + + +E  L     +KQ Q  +  +T L  + S T  + +  +    +N++P+V   +  T HF+
Sbjct: 2107 EVERPISMDVVPVVPEYKTQLSTEVPARPQVQRGFSSEREYIRSMSVTPMVPEYE------TKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTTE--YKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVV--------------------------------PEFKTELSTEVHARPQLTTGHETRLDYERQLQWETELKQYQ--SAVETRLPSRPSLTSVYSATLEHETSMNVVPVVPYDERFTSHFT 2394          

HSP 3 Score: 82.8037 bits (203), Expect = 5.957e-13
Identity = 46/195 (23.59%), Postives = 106/195 (54.36%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESR 585
            +E +  + +TPMV + +  +++   +   P +  G+ +E E +  + + P+VR++++ ++  TE+   P     F S   +P  + VTP+    ++ T+ME  + ++PI+ +G+ +++E     +V P +    + +++T +++       G+ + ++   ++E+VPVV E  F T++STE+     +  G E+R
Sbjct: 2145 REYIRSMSVTPMVPEYE--TKLEHKVVERPVLEAGYASEEEHEHAMNVVPLVRRTEYKTELATEVPSRPTARPGFASETTVPRPIEVTPMTT--EYKTRMERRMPSYPILEAGYSSEEEYQTRMEVVPVVPHTSYRTEMTTDLTAKPVTQPGFVSEQQHMLTMEVVPVVPE--FKTELSTEVHARPQLTTGHETR 2333          
BLAST of SMED30002653 vs. Planmine SMEST
Match: SMESG000005752.1 (SMESG000005752.1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 364/379 (96.04%), Postives = 370/379 (97.63%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVKGKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNKCQSISIRKISVFDLLETST 1137
            KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVKGKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNK    S+  +S++ L +T +
Sbjct: 3153 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVKGKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNKSDEGSL-SMSIYSLTKTES 3530          

HSP 2 Score: 282.337 bits (721), Expect = 4.805e-84
Identity = 145/335 (43.28%), Postives = 219/335 (65.37%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVKGKNLTRHFS 978
            KEVMNPLQITPMVKQSQF SQ+ TD+YHHPDV TGF++E  +Q +LEITP+VR+SQFLSQ  T+L HHPD++S ++S+KE+ N L +TP+VK  QFL+Q   D+ +HP V+SG+D+ KE++ P  +TP +K++ FLSQ + ++  H DV+ G+++ K+I  +LEI P+V+ESQFL+Q+ST++  +  V  G +S +E+M P  ITPM+          TD+  +P     +++ K ++N +  +   K S + S+++ +    P+  S ++S+ +  N L I P VKQ QF++   TDL      T GF+S  +   +L I P+VK        S
Sbjct: 2451 KEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVRESQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKESQFLSQASTDLYHHPDVTTGFDSEKDIQKNLEITPMVRESQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQLS 2785          

HSP 3 Score: 275.789 bits (704), Expect = 9.630e-82
Identity = 142/326 (43.56%), Postives = 214/326 (65.64%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KEVMNPLQITPMVKQSQF SQM TD+YHHPDV TGF++E  +Q +LEITP+V+QSQFLSQ  T+L HHPD++S ++S+KE+ N L +TP+VK  QFL+Q+  D+ +HP V +GFD++K +    ++TP +K + FLSQ++ ++  H DV  GY+++KE+   L+I P+VK+SQFL+Q+ST++C +  V  G +S +E+M P  ITPM+          TD+  +P     Y++ + I+  +  +   + S + S+++ +    P   S ++S+ +  N L I   VKQ QF++   TDL      T GF+S  +   +L I P+VK
Sbjct: 2646 KEVMNPLQITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQLSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLCHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVTTGYDSVRDIQKNLEVTPMVRESQFLSQVSTDLYHHPNVVSGYDSDKEVMNPLQITAMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVK 2971          

HSP 4 Score: 274.248 bits (700), Expect = 2.898e-81
Identity = 154/380 (40.53%), Postives = 233/380 (61.32%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI-------LTDIDGYPLPNV--PYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK--------GKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNKCQS 1089
            KEVMNPLQITPMVKQSQF SQM TD+YHHPDV TGF++E  +Q +LEITP+V+QSQFLSQ  T+L HHPD++S ++S+KE+ N L +TP+VK  QFL+Q   D+ +HP V+SG+D+ KE++ P  +TP +K + FLSQI+ ++  H DV+ G+++ K +  +LEI P+V+ESQFL+Q ST++  +  V  G +S +E+M P  ITPM+           D Y  P+V   Y+++K + N +  +   K S + S+ + +    P+  + F+SE   + +L I P V++ QF++   TDL        G++S  +    L I P+VK          +L  H  +T  T FD   S  N    + + P+  +S  L++  +
Sbjct: 2334 KEVMNPLQITPMVKQSQFLSQMITDLYHHPDVTTGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVRESQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKESQFLSQASTDLYHHPDVTTGFDSEKDIQKNLEITPMVRESQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDVT--TGFD---SEKNLQNNLEITPMVKQSQFLSQVST 2708          

HSP 5 Score: 265.388 bits (677), Expect = 4.452e-78
Identity = 141/326 (43.25%), Postives = 211/326 (64.72%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPM---------ILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KEVMNPL ITPMVKQSQF SQM TD+YHHPDV TGF++E  +Q +LEITP+V++SQFLSQ  T+L HHPD++S ++S+KE+ N L +TP+VK  QFL+QM  D+ +HP V +GFD++K +    ++TP +K + FLSQ + ++  H DV  GY+++KE+   L+I P+VK+SQFL+Q ST++  +  V  G +S +E+M P  ITPM         I TD+  +P     +++ K ++N +  +   + S + S+ + +    P+  S ++S+ +  N L I P VKQ QF++ A TDL        G++S  +    L I P+VK
Sbjct: 2256 KEVMNPLLITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKILQNNLEITPMVKRSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMITDLYHHPDVTTGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVRESQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVK 2581          

HSP 6 Score: 259.61 bits (662), Expect = 3.501e-76
Identity = 140/328 (42.68%), Postives = 211/328 (64.33%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI-------LTDIDGYPLPNV--PYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVKGK 957
            KEVMNPLQIT MVKQSQF SQM TD+YHHPDV TGF++E  +Q +LEITP+V+QSQFLSQ  T+L HHPD++S ++S+KE+ N L +TP+VK  QFL+QM  D+ +HP +  GFD++K +    ++TP +K + FLSQ + ++  H +V  GY+++KEI   L+I P+VK+SQFL+Q ST++  +  V  G +S +E+M P  ITPM+             Y  P+V   Y+++K + N +  +   K S + S++  +    P+  + F +E++ + DL I P V+Q QF++   T+L+        FES  +    L++ PIVK +
Sbjct: 2919 KEVMNPLQITAMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDITVGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLRITPMVKQSQFLSQASTGLYHHPDVLSGYDSDKEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHR 3246          

HSP 7 Score: 259.225 bits (661), Expect = 4.989e-76
Identity = 139/326 (42.64%), Postives = 209/326 (64.11%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI-------LTDIDGYPLPNV--PYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KEVMNPLQITPMVKQSQF SQ  TD+YHHPDV TG+++  +IQK+LE+TP+VR+SQFLSQ  T+L HHP+++S ++S+KE+ N L +T +VK  QFL+QM  D+ +HP V +GFD++K +    ++TP +K + FLSQ + ++  H DV  GY+++KE+   L+I P+VK+SQFL+Q+ST++  +  + +G +S + L    +ITPM+           D Y  PNV   Y+++K I N +  +   K S + S+ + +    P   S ++S+ +  N L I P VKQ QF++ A T L        G++S  +    L I P+VK
Sbjct: 2841 KEVMNPLQITPMVKQSQFLSQASTDLYHHPDVTTGYDSVRDIQKNLEVTPMVRESQFLSQVSTDLYHHPNVVSGYDSDKEVMNPLQITAMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDITVGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLRITPMVKQSQFLSQASTGLYHHPDVLSGYDSDKEVMNPLQITPMVK 3166          

HSP 8 Score: 256.914 bits (655), Expect = 3.193e-75
Identity = 133/326 (40.80%), Postives = 211/326 (64.72%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KEVMNPLQITPMVKQSQF SQM TD+ HHP+V +G++++ E+   L+ITP+V+QSQFLSQ  T+L HHPD+ + ++S +++   L VTP+V+  QFL+Q+  D+ +HP V+SG+D+ KE++ P  +T  +K + FLSQ++ ++  H DV+ G+++ K +  +LEI P+VK+SQFL+Q ST++  +  V  G +S +E+M P  ITPM+          TD+  +P   V +++ K+++N +  +   K S + S+ + +    P   S ++S+ +  N L I P VKQ QF++ A TDL    +   G++S  +    L I P+VK
Sbjct: 2802 KEVMNPLQITPMVKQSQFLSQMSTDLCHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVTTGYDSVRDIQKNLEVTPMVRESQFLSQVSTDLYHHPNVVSGYDSDKEVMNPLQITAMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDITVGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLRITPMVK 3127          

HSP 9 Score: 256.914 bits (655), Expect = 3.651e-75
Identity = 138/326 (42.33%), Postives = 208/326 (63.80%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI-------LTDIDGYPLPNV--PYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KE++ PLQITPMVKQSQF SQM T++YHHPDV TGF++E  +Q +LEITP+V+QSQFLSQ  T L HHPD++S ++S+KE+ N L +TP+VK  QFL+QM  D+ +HP V +GFD++K +    ++TP +K + FLSQ + ++  H DV  GY+++KE+   L+I P+VK+SQFL+Q+ T++  +  V  G +S + L    +ITPM+           D Y  P+V   Y+++K + N +  +   K S + S+ + +    P   S ++S+ +  N L I P VKQ QF++   TDL      T GF+S  +   +L I P+V+
Sbjct: 2178 KEILKPLQITPMVKQSQFLSQMSTELYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTNLCHHPDVVSGYDSDKEVMNPLLITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKILQNNLEITPMVKRSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMITDLYHHPDVTTGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVR 2503          

HSP 10 Score: 253.832 bits (647), Expect = 3.558e-74
Identity = 128/326 (39.26%), Postives = 209/326 (64.11%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI---------LTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KEVMNPLQITPMVKQSQF SQM TD+YHHPD+  GF++E  +Q +LEITP+V+QSQFLSQ  T+L HHP+++S ++S+KE+ N L +TP+VK  QFL+Q   D+ +HP V+SG+D+ KEI+ P  +TP +K + FLSQ +  +  H DV  GY+++KE+   L+I P+VK+SQF +Q+ T+I  +  VR G E+  E+ K  +ITP++         +T++  +P     +E+NK + N +  +   K+  + +++  +    P   S F+++ +      + P++K + F++    ++++    + G+ +  +    L I+P+VK
Sbjct: 2997 KEVMNPLQITPMVKQSQFLSQMSTDLYHHPDITVGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEIMNPLRITPMVKQSQFLSQASTGLYHHPDVLSGYDSDKEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVK 3322          

HSP 11 Score: 250.751 bits (639), Expect = 4.318e-73
Identity = 135/326 (41.41%), Postives = 203/326 (62.27%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            KE+   L+ITPMVKQS+F SQM T++YHHP+V TGF++ IEI+K LEITP+ +Q QFLSQ  T L HHPD+   F+S K++   L +TP+VK  QFL+Q   D+ +HP V+S +D +KE+ KP  +TP +K + FLSQ +  +  H DV+ G+++ K I  SLEI P+VK+SQFL+Q ST++C +  +  G +S +E++KP  ITPM+          T++  +P     +++ K ++N +  +   K S + S+ +      P+  S ++S+ +  N L I P VKQ QF++   TDL      T GF+S      +L I P+VK
Sbjct: 1983 KEINKSLEITPMVKQSKFLSQMNTELYHHPEVMTGFDSNIEIKKGLEITPMFKQCQFLSQASTNLYHHPDVTRGFDSEKDINKSLEITPMVKQSQFLSQASTDLCHHPDVVSVYDCEKEVTKPLQITPMVKQSQFLSQTSTNLYHHPDVTTGFDSEKNINRSLEITPMVKQSQFLSQASTDLCLHPNIVSGYDSDKEILKPLQITPMVKQSQFLSQMSTELYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTNLCHHPDVVSGYDSDKEVMNPLLITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKILQNNLEITPMVK 2308          

HSP 12 Score: 248.054 bits (632), Expect = 3.373e-72
Identity = 126/317 (39.75%), Postives = 198/317 (62.46%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            K++   L+ITPMV++SQF SQ+ TD+YHHPDV +G++++ E+   L+ITP+V+QSQFLSQ  T+L HHPD+ + F+S K + N L +TP+VK  QFL+Q+  D+ +HP V+SG+D+ KE++ P  +TP +K + FLSQI+ ++  H DV+ G+++ K +  +LEI P+VK+SQFL+Q+ST++  +  V  G +S +E+M P  ITPM+                              K S + S+++ +    P   S ++S+ +  N L I P VKQ QF++ A TDL      T G++SV D   +L + P+V+
Sbjct: 2607 KDIQKNLEITPMVRESQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQVSTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQLSTDLYHHPDVVSGYDSDKEVMNPLQITPMV------------------------------KQSQFLSQMSTDLCHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPDVTTGYDSVRDIQKNLEVTPMVR 2893          

HSP 13 Score: 245.358 bits (625), Expect = 3.011e-71
Identity = 140/380 (36.84%), Postives = 226/380 (59.47%), Query Frame = 1
Query:    1 KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI---------LTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK--------GKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNKCQS 1089
            K +   L+ITPMVKQSQF SQ  TD+  HP++ +G++++ EI K L+ITP+V+QSQFLSQ  TEL HHPD+ + F+S K + N L +TP+VK  QFL+Q   ++ +HP V+SG+D+ KE++ P  +TP +K + FLSQ++ ++  H DV+ G+++ K +  +LEI P+VK SQFL+Q ST++  +  V  G +S +E+M P  ITPM+         +TD+  +P     +++ K+++N +  +   K S + S+ + +    P+  S ++S+ +  N L I P VKQ QF++ A TDL    +   G++S  +    L I P+VK          +L  H  +T  T FD   S  N    + + P+  +S  L++  +
Sbjct: 2139 KNINRSLEITPMVKQSQFLSQASTDLCLHPNIVSGYDSDKEILKPLQITPMVKQSQFLSQMSTELYHHPDVTTGFDSEKNLQNNLEITPMVKQSQFLSQASTNLCHHPDVVSGYDSDKEVMNPLLITPMVKQSQFLSQMSTDLYHHPDVTTGFDSEKILQNNLEITPMVKRSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQMITDLYHHPDVTTGFDSEKILQNNLEITPMVKQSQFLSQASTDLYHHPDVVSGYDSDKEVMNPLQITPMVKQSQFLSQASTDLYHHPNVVSGYDSDKEVMNPLQITPMVKQSQFLSQISTDLYHHPDVT--TGFD---SEKNLQNNLEITPMVRESQFLSQAST 2513          

HSP 14 Score: 225.713 bits (574), Expect = 1.990e-64
Identity = 131/325 (40.31%), Postives = 194/325 (59.69%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMI-------LTDIDGYPLPNV--PYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            E+   ++ TPMVKQS F SQ  T++ +HP V  GFE+E EI K LEITP+VR+SQFLSQ  T L HHPD+ S F+S KE+   L +TP+VK  +FL+QM  ++ +HP V++GFD+  EI K  ++TP  K   FLSQ +  +  H DV+ G+++ K+I  SLEI P+VK+SQFL+Q ST++C +  V    +  +E+ KP  ITPM+        T  + Y  P+V   +++ K I   +  +   K S + S+ + +    P   S ++S+ +    L I P VKQ QF++   T+L      T GF+S  +   +L I P+VK
Sbjct: 1906 EIEKSMEFTPMVKQSNFLSQRSTELNNHPSVTVGFESEKEIAKQLEITPLVRESQFLSQMSTNLYHHPDVTSGFDSEKEINKSLEITPMVKQSKFLSQMNTELYHHPEVMTGFDSNIEIKKGLEITPMFKQCQFLSQASTNLYHHPDVTRGFDSEKDINKSLEITPMVKQSQFLSQASTDLCHHPDVVSVYDCEKEVTKPLQITPMVKQSQFLSQTSTNLYHHPDVTTGFDSEKNINRSLEITPMVKQSQFLSQASTDLCLHPNIVSGYDSDKEILKPLQITPMVKQSQFLSQMSTELYHHPDVTTGFDSEKNLQNNLEITPMVK 2230          

HSP 15 Score: 193.356 bits (490), Expect = 2.383e-53
Identity = 127/379 (33.51%), Postives = 202/379 (53.30%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK--------GKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLPLKYKSNKLNKCQS 1089
            ++   + I  + K S+F S +  D+    DV +G ++  EI+K +E TP+V+QS FLSQ  TEL++HP +   FES KE+   L +TP+V+  QFL+QM  ++ +HP V SGFD++KEI K  ++TP +K + FLSQ+  E+  H +V  G+++N EI   LEI P+ K+ QFL+Q ST +  +  V  G +S +++ K  +ITPM+          TD+  +P     Y+  K +   +  +   K S + S+ +      P+  + F+SE      L I P VKQ QF++ A TDL    +   G++S  +    L I P+VK           L  H  +T  T FD   S  N    + + P+  +S  L++  +
Sbjct: 1867 DIFKTMDILLVGKTSRFLSHINADLSKQLDVISGCQSITEIEKSMEFTPMVKQSNFLSQRSTELNNHPSVTVGFESEKEIAKQLEITPLVRESQFLSQMSTNLYHHPDVTSGFDSEKEINKSLEITPMVKQSKFLSQMNTELYHHPEVMTGFDSNIEIKKGLEITPMFKQCQFLSQASTNLYHHPDVTRGFDSEKDINKSLEITPMVKQSQFLSQASTDLCHHPDVVSVYDCEKEVTKPLQITPMVKQSQFLSQTSTNLYHHPDVTTGFDSEKNINRSLEITPMVKQSQFLSQASTDLCLHPNIVSGYDSDKEILKPLQITPMVKQSQFLSQMSTELYHHPDVT--TGFD---SEKNLQNNLEITPMVKQSQFLSQAST 2240          

HSP 16 Score: 166.007 bits (419), Expect = 4.815e-44
Identity = 105/320 (32.81%), Postives = 180/320 (56.25%), Query Frame = 1
Query:   19 LQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMKPKDITPMIL---------TDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKEKKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGFESVFDKSFDLNIIPIVK 951
            ++I P  K S+F + +  D+   P+V  G E+ ++I K ++I  V + S+FLS    +LS   D++S  +S  E+   +  TP+VK   FL+Q   +++NHP V  GF+++KEI K  ++TP ++++ FLSQ++  +  H DV+ G+++ KEI  SLEI P+VK+S+FL+Q++TE+  +  V  G +S  E+ K  +ITPM           T++  +P     +++ K I   +  +   K S + S+ + +    P+  S ++ E +    L I P VKQ QF++   T+L      T GF+S  + +  L I P+VK
Sbjct: 1835 MEIVPFTKTSKFKALLEYDL--KPEVICGTESNVDIFKTMDILLVGKTSRFLSHINADLSKQLDVISGCQSITEIEKSMEFTPMVKQSNFLSQRSTELNNHPSVTVGFESEKEIAKQLEITPLVRESQFLSQMSTNLYHHPDVTSGFDSEKEINKSLEITPMVKQSKFLSQMNTELYHHPEVMTGFDSNIEIKKGLEITPMFKQCQFLSQASTNLYHHPDVTRGFDSEKDINKSLEITPMVKQSQFLSQASTDLCHHPDVVSVYDCEKEVTKPLQITPMVKQSQFLSQTSTNLYHHPDVTTGFDSEKNINRSLEITPMVK 2152          

HSP 17 Score: 88.9669 bits (219), Expect = 1.858e-18
Identity = 53/174 (30.46%), Postives = 99/174 (56.90%), Query Frame = 1
Query:   43 QSQFFSQMCTDIYHHPDVRTGFETEIE--IQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAK--KEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFLTQISTEICE 552
            QS F +    +I H P + TG+E+  E     +LEITP+V++   L+  +  ++     +  + S+ E+ + L +TP+VK   FL++++  +S  P V  GF+ +  KEI  P ++TP +K++ F++++TAEI +       Y T  E   +L++ P+VK++ F T + T + +
Sbjct: 3727 QSYFTTTTQQNIVHRPLLSTGYESGSENIFINNLEITPIVKEKNILTTVVRPITQRTKAIPSYHSDFELNSELQITPMVKQSTFLSKVDNYVSIKPEVQKGFETQVTKEI--PMEITPIVKESTFVNKVTAEIPRRHSTQKAYETVIEKQRTLDVTPMVKQTSFKTTVQTNVVD 3898          

HSP 18 Score: 73.559 bits (179), Expect = 1.784e-13
Identity = 55/209 (26.32%), Postives = 99/209 (47.37%), Query Frame = 1
Query:    4 EVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITPVVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQMEADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVSCGYNTNKEIFTSLEIVPVVKESQFL--TQISTEICENFGVRLGLESREELMKPKDITPMI 624
            E+ + LQITPMVKQS F S++   +   P+V+ GFET++  +  +EITP+V++S F+++   E+         +E+  E    L VTP+VK   F T ++ ++ +     S +          D+    KD              SD+ C + T  E+  S +    + + Q+   T +  ++      + G +S  E  +P D+ P++
Sbjct: 3794 ELNSELQITPMVKQSTFLSKVDNYVSIKPEVQKGFETQVTKEIPMEITPIVKESTFVNKVTAEIPRRHSTQKAYETVIEKQRTLDVTPMVKQTSFKTTVQTNVVDKCFTSSAY---------LDIVSLRKD-----------KSPSDLPC-FETTIELPKSKKSSLTIPKRQYYHSTHLLAKVPRTIKAQSGFDSTLEFNRPLDVVPVV 3981          
The following BLAST results are available for this feature:
BLAST of SMED30002653 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LZM51.235e-1922.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M5631.354e-1922.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M5741.497e-1922.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y4Z31.856e-1921.77Titin OS=Clonorchis sinensis OX=79923 GN=CLF_10108... [more]
A0A419PWM32.574e-1921.77Muscle M-line assembly protein unc-89 (Fragment) O... [more]
back to top
BLAST of SMED30002653 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002653 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005752.14.805e-8496.04SMESG000005752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002653 ID=SMED30002653|Name=SMED30002653|organism=Schmidtea mediterranea sexual|type=transcript|length=1330bp
AAAGAGGTTATGAATCCATTACAAATAACTCCGATGGTAAAACAGAGCCA
ATTTTTTTCACAGATGTGTACTGATATCTATCATCATCCTGATGTCAGAA
CTGGTTTCGAAACCGAAATTGAAATACAAAAAGATTTAGAGATAACTCCA
GTAGTTAGACAAAGTCAGTTTCTATCTCAAACGATTACAGAATTAAGCCA
TCATCCTGATATTCTATCATGTTTCGAAAGCAATAAAGAAATGCCCAATA
TTTTGCATGTAACACCAATTGTCAAACATAGACAATTTCTGACCCAAATG
GAGGCTGATATATCTAATCATCCAATTGTTATCAGCGGATTCGATGCTAA
AAAAGAAATATTGAAACCATTTGACGTTACTCCAACAATCAAAGATAATT
TGTTTCTTTCTCAAATAACCGCCGAGATTTCACAGCATTCTGACGTAAGT
TGCGGATACAACACTAACAAAGAAATATTTACTTCCCTTGAGATTGTTCC
AGTCGTTAAAGAAAGTCAGTTTTTAACTCAAATTTCAACGGAAATTTGTG
AAAATTTCGGAGTAAGGCTAGGATTAGAAAGTAGAGAGGAATTGATGAAA
CCAAAGGATATCACTCCGATGATTTTGACGGATATTGACGGATACCCCTT
ACCCAATGTTCCATATGAGAACAACAAAGTTATTGAAAATTTTATGGGAA
CTTCTTCAACTGATAAAAATAGTCACTACAAGTCAAGGATTAATAAAGAA
AAGAAAAGGTTTCCCGAAACGTTCTCGCGTTTCAACAGCGAAATGAAATT
CGAAAATGATTTGCATATAATCCCATCGGTGAAACAAGACCAATTCATAA
CCATTGCTGATACAGACCTCACGGAAAAGGTTTCTTTTACTCCAGGCTTT
GAATCTGTTTTTGATAAAAGCTTTGATCTTAACATTATTCCAATAGTTAA
GGGGAAAAATTTGACTAGACATTTTTCCATAACAGACGACACAAAATTTG
ATGCTTATTTATCCAATAATAACTTTGCGTTCCAAATGAATGTCTTACCA
TTGAAATATAAATCAAATAAATTAAATAAATGTCAAAGTATCTCAATTCG
CAAAATATCCGTATTTGATCTTCTCGAAACCTCCACGGTTTTCATTAATT
GTATTATGTCAAAAATTAGAGTTGTTTTATGGCATACCGATTATCGGTTA
TAGAAATCCTGATTTAAACCGATTATCGTTCCTTAATGATCTTCATAGAA
ACATATTATAATATTTTGCAATTGTTATGTATTGTAACATATGTAATCTA
AAAGTATTGTGTAGTGCCAGATCGGAAGAG
back to top

protein sequence of SMED30002653-orf-1

>SMED30002653-orf-1 ID=SMED30002653-orf-1|Name=SMED30002653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
KEVMNPLQITPMVKQSQFFSQMCTDIYHHPDVRTGFETEIEIQKDLEITP
VVRQSQFLSQTITELSHHPDILSCFESNKEMPNILHVTPIVKHRQFLTQM
EADISNHPIVISGFDAKKEILKPFDVTPTIKDNLFLSQITAEISQHSDVS
CGYNTNKEIFTSLEIVPVVKESQFLTQISTEICENFGVRLGLESREELMK
PKDITPMILTDIDGYPLPNVPYENNKVIENFMGTSSTDKNSHYKSRINKE
KKRFPETFSRFNSEMKFENDLHIIPSVKQDQFITIADTDLTEKVSFTPGF
ESVFDKSFDLNIIPIVKGKNLTRHFSITDDTKFDAYLSNNNFAFQMNVLP
LKYKSNKLNKCQSISIRKISVFDLLETSTVFINCIMSKIRVVLWHTDYRL
*
back to top