Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30002638
Length (bp)2349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30002638) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30002638) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30002638) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30002638) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002638

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 4 cellSMED30002638SMESG000074913.1 dd_Smed_v4_12976_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002638SMESG000074913.1 dd_Smed_v4_12976_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002638SMESG000074913.1 dd_Smed_v4_12976_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: LCK (LCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6524])

HSP 1 Score: 97.4413 bits (241), Expect = 1.746e-20
Identity = 69/211 (32.70%), Postives = 109/211 (51.66%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN---KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H R V LY V    +  Y+  E ME G+L  F+K     K T N +   ++Q+ EG+ ++ ++  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L +++  C K     R T + L +  EDF
Sbjct:  304 HQRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDF 504          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: FES (FES proto-oncogene, tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:3657])

HSP 1 Score: 98.2117 bits (243), Expect = 1.995e-20
Identity = 67/266 (25.19%), Postives = 124/266 (46.62%), Query Frame = 2
Query: 1451 IGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTT----QKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN--KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRA-PFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNE 2227
            +G+ +  G+  ++FS ++R  N  + +K    T     + KF     I+++         HP  V L GV    +  Y+ ME ++ G   +F++    +     + +       G++YL  +  IHRDL   + L+ E   LK+S+F +S+     E   V+      L+ +P+K+ APE L   R+++++DVWSFG +L +  +  A P+P     + +   E    G   C  L C + + R++  C   + G R +  ++  E
Sbjct:  435 LGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQY-------SHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSR----EEADGVYAAS-GGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKG--GRLPCPEL-CPDAVFRLMEQCWAYEPGQRPSFSTIYQE 685          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: LCK (LCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6524])

HSP 1 Score: 97.0561 bits (240), Expect = 2.058e-20
Identity = 69/211 (32.70%), Postives = 109/211 (51.66%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN---KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H R V LY V    +  Y+  E ME G+L  F+K     K T N +   ++Q+ EG+ ++ ++  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L +++  C K     R T + L +  EDF
Sbjct:  297 HQRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDF 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: LCK (LCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:6524])

HSP 1 Score: 97.0561 bits (240), Expect = 2.058e-20
Identity = 69/211 (32.70%), Postives = 109/211 (51.66%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN---KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H R V LY V    +  Y+  E ME G+L  F+K     K T N +   ++Q+ EG+ ++ ++  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L +++  C K     R T + L +  EDF
Sbjct:  297 HQRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDF 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: FES (FES proto-oncogene, tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:3657])

HSP 1 Score: 97.8265 bits (242), Expect = 2.520e-20
Identity = 67/266 (25.19%), Postives = 124/266 (46.62%), Query Frame = 2
Query: 1451 IGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTT----QKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN--KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRA-PFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNE 2227
            +G+ +  G+  ++FS ++R  N  + +K    T     + KF     I+++         HP  V L GV    +  Y+ ME ++ G   +F++    +     + +       G++YL  +  IHRDL   + L+ E   LK+S+F +S+     E   V+      L+ +P+K+ APE L   R+++++DVWSFG +L +  +  A P+P     + +   E    G   C  L C + + R++  C   + G R +  ++  E
Sbjct:  493 LGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQY-------SHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSR----EEADGVYAAS-GGLRQVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKG--GRLPCPEL-CPDAVFRLMEQCWAYEPGQRPSFSTIYQE 743          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: F26E4.5 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:O01325])

HSP 1 Score: 102.834 bits (255), Expect = 8.451e-23
Identity = 63/213 (29.58%), Postives = 112/213 (52.58%), Query Frame = 2
Query: 1439 DAIEIGDCVNDGDHSDLFSAKMRV---TNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDI--KKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF 2062
            + I +G  + +G+  ++F   + V   TN   +  K    ++    + I  +RE     L  +H   V LYGV    +   + ME    G LKS I+K     +D+  +K+  Q+ +G++YL  +QVIHRDL   ++LL +S + K+S+F LS +  L++         + L  +PI++ APE L    +++K+DVWSFG ++ ++ +   P+
Sbjct:  193 EQINLGKKLGNGEFGEVFQGVLSVGIFTNDVEVAVKTMKGSKVTADERITFLREA-NLMLKLNHKYVVRLYGVATQQEPIMIVMELCSGGCLKSRIEKKDEQLSDVLKRKYCKQIAKGMRYLEKKQVIHRDLAARNVLLDKSDNCKISDFGLSLFGKLHKE--------QKLMKVPIRWLAPETLLKGIYSSKSDVWSFGVVMFEVFSGEYPY 396          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 94.3597 bits (233), Expect = 7.946e-20
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 2
Query: 1445 IEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIY-IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK---KNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKP 2074
            I++GD +  G+  D+     +  N+K+ +K       K+  + +   + +   F +   HP  V L GV  D    Y+  E M  G L   ++   ++      +  ++  + +G+ YL  +Q++HRDL   ++LL +    K+S+F L+K        S   K        PIK+ APE LR+ +FTTK+DVWSFG +L +I +  R P+P  P
Sbjct:  283 IDVGDTIGHGEFGDVRLGTYK--NRKVALK-----VSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGK-------FPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIP 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 94.3597 bits (233), Expect = 7.946e-20
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 2
Query: 1445 IEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIY-IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK---KNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKP 2074
            I++GD +  G+  D+     +  N+K+ +K       K+  + +   + +   F +   HP  V L GV  D    Y+  E M  G L   ++   ++      +  ++  + +G+ YL  +Q++HRDL   ++LL +    K+S+F L+K        S   K        PIK+ APE LR+ +FTTK+DVWSFG +L +I +  R P+P  P
Sbjct:  283 IDVGDTIGHGEFGDVRLGTYK--NRKVALK-----VSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGK-------FPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIP 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: kin-29 (Serine/threonine-protein kinase kin-29 [Source:UniProtKB/Swiss-Prot;Acc:Q21017])

HSP 1 Score: 94.7449 bits (234), Expect = 1.153e-19
Identity = 64/278 (23.02%), Postives = 134/278 (48.20%), Query Frame = 2
Query: 1409 PVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTL-KSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERF-TTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFI 2236
            P +   + K+   ++G  +  G+ + +  A+ ++   K+ IK     +     + I + RE+   ++  DHP  V  Y +       Y+  E    G L ++ I+K +  EN  +KW S+    + YLH Q ++HRDL   +ILL ++ ++K+ +F  S ++T ++  + +             Y APE+L    +   KAD+WS G +L  ++    PFP     ++K    +  +      +++C + +R++++    ++ G R T++++L   ++
Sbjct:    4 PRRRMGLEKIGLYDVGRAIGKGNFATVRIARHKIAKTKVAIKS-IDVSALDRENLIKLEREVKIVKVI-DHPHIVKSYEIMRVDNMLYIVSEYCSSGELYETLIEKGRVAENVARKWFSETASAVAYLHSQGIVHRDLKAENILLGKNSNIKIIDFGFSNFQTGDQLLNTWCGSP--------PYAAPELLLGNSYDGMKADIWSMGVLLYILVAGGFPFPSDSVNKLKRSVLSGLVKIPYWVSVECADFIRKMLV----LNPGKRYTIQNVLQHRWM 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 93.5893 bits (231), Expect = 1.911e-19
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 2
Query: 1445 IEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIY-IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK---KNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKP 2074
            I++GD +  G+  D+     +  N+K+ +K       K+  + +   + +   F +   HP  V L GV  D    Y+  E M  G L   ++   ++      +  ++  + +G+ YL  +Q++HRDL   ++LL +    K+S+F L+K        S   K        PIK+ APE LR+ +FTTK+DVWSFG +L +I +  R P+P  P
Sbjct:  368 IDVGDTIGHGEFGDVRLGTYK--NRKVALK-----VSKRHGNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSASGK-------FPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIP 568          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Takl1 (gene:FBgn0046689 transcript:FBtr0083996)

HSP 1 Score: 88.9669 bits (219), Expect = 1.636e-18
Identity = 60/229 (26.20%), Postives = 119/229 (51.97%), Query Frame = 2
Query: 1616 DHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIK---KWSSQMLEGLKYLH--DQQVIHRDLNPSSILL-KESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPG----KPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTV-----------ESLLNEDFIK 2239
            DH   + + G  ++ K  Y+ ME +E G+L +++  +   E  ++   +W+ Q  + L YLH  D+ ++HRD+ P ++LL  + +DLK+ +F L+   + N+          D++   ++Y APE +++ ++T K DV+SFG +L +++T++ P+        +  I     + E    +     C EG+++++  C+ I+   R ++           ES  +EDFIK
Sbjct:   62 DHENVIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSLDRPIVHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKT---------DMQGT-LRYMAPEAIKHLKYTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMECCMDINPEKRPSMKEIEKFLGEQYESGTDEDFIK 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Src42A (gene:FBgn0264959 transcript:FBtr0335275)

HSP 1 Score: 88.5817 bits (218), Expect = 4.986e-18
Identity = 58/206 (28.16%), Postives = 98/206 (47.57%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIK-----KWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            H + + LY V    +  Y+  E M+ G+L  +++        +K       ++Q+  G+ YL  Q  IHRDL   ++L+ +   +K+++F L++    +E       +       PIK+ APE     +F+ K+DVWSFG +L +++T  R P+PG    E+ T  E+   G        C   L  I++ C   D   R T E+L
Sbjct:  300 HTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDE------YEARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEH---GYRMPQPPNCEPRLYEIMLECWHKDPMRRPTFETL 496          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083550)

HSP 1 Score: 88.9669 bits (219), Expect = 8.074e-18
Identity = 54/184 (29.35%), Postives = 96/184 (52.17%), Query Frame = 2
Query: 1580 IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---------------------TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFP 2065
            ++RE+   ++   H   +NL G  +     YV +E    G LK F+ KN+P                     TE D+ K++ Q+  G+ YL  ++ IHRDL   ++L+ +   LK+++F L++     + +  + K+      LPIK+ APE L+ + + +K+DVWS+G +L +I+T  + P+P
Sbjct:  457 LVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDI---QSTDYYRKNTNG--RLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYP 635          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083549)

HSP 1 Score: 88.9669 bits (219), Expect = 8.074e-18
Identity = 54/184 (29.35%), Postives = 96/184 (52.17%), Query Frame = 2
Query: 1580 IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---------------------TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFP 2065
            ++RE+   ++   H   +NL G  +     YV +E    G LK F+ KN+P                     TE D+ K++ Q+  G+ YL  ++ IHRDL   ++L+ +   LK+++F L++     + +  + K+      LPIK+ APE L+ + + +K+DVWS+G +L +I+T  + P+P
Sbjct:  457 LVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDI---QSTDYYRKNTNG--RLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYP 635          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083548)

HSP 1 Score: 88.9669 bits (219), Expect = 8.074e-18
Identity = 54/184 (29.35%), Postives = 96/184 (52.17%), Query Frame = 2
Query: 1580 IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---------------------TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFP 2065
            ++RE+   ++   H   +NL G  +     YV +E    G LK F+ KN+P                     TE D+ K++ Q+  G+ YL  ++ IHRDL   ++L+ +   LK+++F L++     + +  + K+      LPIK+ APE L+ + + +K+DVWS+G +L +I+T  + P+P
Sbjct:  457 LVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDI---QSTDYYRKNTNG--RLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYP 635          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-340m8.2 (si:ch73-340m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-209])

HSP 1 Score: 101.679 bits (252), Expect = 3.815e-22
Identity = 64/205 (31.22%), Postives = 113/205 (55.12%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTEND----IKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQR-APFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            H R + LY V    +   +  E M+ G+LK+F+ ++K  ++     +  ++ Q+ EG+ Y+ + +++HRDL   +ILL E +  K+++F L++   +N P +  +    D++ LP+K+ APEI  N  +T+K+DVWSFG +L +I+T    P+PG+ K+    G +    G+       C E L  I++ C K +   R T   L
Sbjct:  270 HERLLKLYAVCTTSQPMCIVTELMKNGSLKTFLLRHKEKQDLEFSLMLDFAIQITEGMIYI-ENKIVHRDLRAENILLTEMQSCKIADFGLAQ---VNRPGNQRISS--DVR-LPVKWMAPEIFDNGEYTSKSDVWSFGILLTEIVTYGDDPYPGQDKMSCVRGIQR---GERMPRPAGCPESLYGIMLLCWKANPKERPTFTEL 464          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk17a (serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-GENE-030131-5556])

HSP 1 Score: 98.5969 bits (244), Expect = 1.303e-21
Identity = 73/256 (28.52%), Postives = 119/256 (46.48%), Query Frame = 2
Query: 1511 TNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESK---DLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLE-------IKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIK 2239
            ++ K    KY    +K       II EI   +L    PR VNL+ VY  P    + +E    G + +    ++    TE ++K+   Q+LEG+ +LH+  V+H DL P +ILL       D+K+ +F LS+  + +        +V ++   P +Y APE+L  E  +T  D+WS G ++  ++T  +PF G  K E       I   +   E+   D SA+       R I S L  +   R+T E  L   +++
Sbjct:   66 SSGKEFAAKYMRKRRKGQDCRTEIIHEIAVLELAAACPRVVNLHEVYEMPSEMVLVLEYAAGGEIFNQCVADRDEAFTEQEVKRLMKQILEGVSFLHNNNVVHLDLKPQNILLTSESPLGDIKIVDFGLSRLLSNSH-------EVREIMGTP-EYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEQLDGSAI-------RFIKSLLIKEPENRATAEDCLKHQWLQ 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 99.3673 bits (246), Expect = 2.072e-21
Identity = 70/212 (33.02%), Postives = 107/212 (50.47%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSAL-QCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H + V L  V    +  Y+  E ME G+L  FIK ++     + K   +S+Q+ EG+ Y+  +  IHRDL  ++IL+ +S   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +II+  R P+PG    E+    E      Y    L  C + L  I++ C K     R T E L +  EDF
Sbjct:  276 HDKLVRLNAVVTKEEPIYIITEFMEKGSLLDFIKSDEGNRVQLPKLIDFSAQIAEGMAYIEQRNYIHRDLRAANILVNKSLVCKIADFGLARIIEDNEYTA------REGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRALERG----YRMQRLDSCPQELYDIMLECWKNKPEDRPTFEYLQSVLEDF 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 99.3673 bits (246), Expect = 2.361e-21
Identity = 70/212 (33.02%), Postives = 107/212 (50.47%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSAL-QCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H + V L  V    +  Y+  E ME G+L  FIK ++     + K   +S+Q+ EG+ Y+  +  IHRDL  ++IL+ +S   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +II+  R P+PG    E+    E      Y    L  C + L  I++ C K     R T E L +  EDF
Sbjct:  286 HDKLVRLNAVVTKEEPIYIITEFMEKGSLLDFIKSDEGNRVQLPKLIDFSAQIAEGMAYIEQRNYIHRDLRAANILVNKSLVCKIADFGLARIIEDNEYTA------REGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRALERG----YRMQRLDSCPQELYDIMLECWKNKPEDRPTFEYLQSVLEDF 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040617-1])

HSP 1 Score: 97.4413 bits (241), Expect = 1.011e-20
Identity = 67/211 (31.75%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTE---NDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            HPR V L+ V    +  Y+  E ME G+L  F+K  + ++   N +   ++Q+ EG+ Y+  +  IHRDL  ++IL+      K+++F L++    NE ++       +    PIK+ APE +    F+ K+DVWSFG +L +I+T  R P+PG    E+     N E G        C E L  ++  C   +   R T E L +  EDF
Sbjct:  290 HPRLVRLFAVVTQ-EPIYIITEYMENGSLVDFLKTPEGSDIPINTLIDMAAQVAEGMAYVEQKNYIHRDLRAANILVSHELTCKIADFGLARLIENNEYTA------REGAKFPIKWTAPEAINYGTFSIKSDVWSFGVLLTEIVTYGRIPYPGMTNPEV---IANLERGYRMPCPDNCPEALYNVMKHCWTENPDNRPTFEFLRSVLEDF 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: BLK (LCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:100497656])

HSP 1 Score: 100.908 bits (250), Expect = 1.090e-21
Identity = 73/211 (34.60%), Postives = 109/211 (51.66%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL--LNEDF 2233
            HPR V L  V    +  Y+  E ME G L  ++K ++  +  I K    S+Q+ EG+ +L  +  IHRDL  ++IL+ ES   K+++F L++    NE ++      ++    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    EN E G        C   L  +++ C K +   R T E L  L EDF
Sbjct:  291 HPRLVRLNAVVTQ-EPIYIVTEYMEKGCLVDYLKTSEGLKLTIYKLIDMSAQVAEGMAFLEHKNYIHRDLRAANILVSESLCCKIADFGLARVIVDNEYTA------KEGAKFPIKWTAPEAINYGTFTIKSDVWSFGVLLTEIVTYGRIPYPGMTNPEV---IENLERGYRMPQPDNCPMELYELMLRCWKEEPEERPTFEFLRSLLEDF 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045672.1 (protein kinase C delta type-like [Source:NCBI gene;Acc:101734050])

HSP 1 Score: 97.4413 bits (241), Expect = 1.092e-21
Identity = 48/162 (29.63%), Postives = 87/162 (53.70%), Query Frame = 2
Query: 1580 IIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFI-KKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF 2062
            I+RE    ++   HP   +++  +      ++AME    G+LK  + KK+      +  +S++M+ GL+YLH + +IH DL P +IL+     +K+++F L+         ++F  D   +    +KY APE+L ++++    D W+FG IL ++ T R PF
Sbjct:   49 ILREARVLRVAAGHPYLCHMHAAFQTQNYAFIAMEFASRGSLKDLLTKKHHLKTRQVIFYSAEMVCGLQYLHSRGIIHSDLKPDNILVSSEGHIKIADFGLAA-------ENIFGNDTICVHRGTMKYMAPEVLEDQQYNAAVDWWAFGIILCQMATGRYPF 203          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: cdk5rap1 (CDK5 regulatory subunit associated protein 1 [Source:Xenbase;Acc:XB-GENE-5727595])

HSP 1 Score: 99.3673 bits (246), Expect = 3.832e-21
Identity = 65/208 (31.25%), Postives = 106/208 (50.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVF-VKDVEDLKN---LPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + L  V    +  Y+  E M  G+L S+++ +  T   I      ++Q+  G+ YL  Q  IHRDL   ++L+ E+   K+++F L++         VF  +DV + KN   LP+K+ APE +R  RFT K+DVW+FG ++ +I+T  + P+PG   L  +   +  E G        C   L +I++ C       R T E+L
Sbjct:  299 HPKLIQLQAVCTLEEPVYIITELMRHGSLLSYLQNDNGTSIHIPNQVDMAAQVASGMAYLETQSFIHRDLAARNVLVGENGVYKVADFGLAR---------VFKGEDVYEAKNDTKLPLKWTAPEAIRYNRFTIKSDVWAFGILIFEIVTYGKMPYPG---LTGRQALDKLENGYRIPKPFNCPHDLYKIMLECWNAKPEERPTFETL 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: gpn2 (GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751862])

HSP 1 Score: 97.0561 bits (240), Expect = 9.925e-21
Identity = 67/212 (31.60%), Postives = 113/212 (53.30%), Query Frame = 2
Query: 1598 TFQLTK-DHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK---KNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            T  +TK  H   VNL GV        V ME M  G L ++++   ++      +  +S  +++G++YL  ++++HRDL   +IL+ E  + K+S+F LSK +             +DL  LPIK+ APE L+N +F++++DVWSFG +L ++ +  RAP+   PK+ ++   E  + G    +   C   +  I+ SC + D G R T + L
Sbjct:  209 TATMTKLQHKNLVNLLGVILKNGLLLV-MELMSKGNLVNYLRSRGRSMVPPYQLLIFSMDIVQGMEYLELKRLVHRDLAARNILVSEKGEAKISDFGLSKPQL----------QQDDLSRLPIKWTAPEALQNYKFSSRSDVWSFGVLLWEVYSYGRAPY---PKMSVREVIEAVKKGYRMEAPENCPPMIYSIMKSCWEADPGKRPTFKKL 406          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: gpn2 (GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751862])

HSP 1 Score: 97.0561 bits (240), Expect = 1.247e-20
Identity = 67/212 (31.60%), Postives = 113/212 (53.30%), Query Frame = 2
Query: 1598 TFQLTK-DHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK---KNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            T  +TK  H   VNL GV        V ME M  G L ++++   ++      +  +S  +++G++YL  ++++HRDL   +IL+ E  + K+S+F LSK +             +DL  LPIK+ APE L+N +F++++DVWSFG +L ++ +  RAP+   PK+ ++   E  + G    +   C   +  I+ SC + D G R T + L
Sbjct:  229 TATMTKLQHKNLVNLLGVILKNGLLLV-MELMSKGNLVNYLRSRGRSMVPPYQLLIFSMDIVQGMEYLELKRLVHRDLAARNILVSEKGEAKISDFGLSKPQL----------QQDDLSRLPIKWTAPEALQNYKFSSRSDVWSFGVLLWEVYSYGRAPY---PKMSVREVIEAVKKGYRMEAPENCPPMIYSIMKSCWEADPGKRPTFKKL 426          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Lck (lymphocyte protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:96756])

HSP 1 Score: 103.605 bits (257), Expect = 1.412e-22
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HPR V LY V    +  Y+  E ME G+L  F+K     + ++ K    ++Q+ EG+ ++ +Q  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L  ++M C K     R T + L
Sbjct:  308 HPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYL 501          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Lck (lymphocyte protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:96756])

HSP 1 Score: 103.219 bits (256), Expect = 1.529e-22
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HPR V LY V    +  Y+  E ME G+L  F+K     + ++ K    ++Q+ EG+ ++ +Q  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L  ++M C K     R T + L
Sbjct:  297 HPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYL 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Lck (lymphocyte protein tyrosine kinase [Source:MGI Symbol;Acc:MGI:96756])

HSP 1 Score: 103.219 bits (256), Expect = 1.529e-22
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HPR V LY V    +  Y+  E ME G+L  F+K     + ++ K    ++Q+ EG+ ++ +Q  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L  ++M C K     R T + L
Sbjct:  297 HPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYL 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Frk (fyn-related kinase [Source:MGI Symbol;Acc:MGI:103265])

HSP 1 Score: 94.3597 bits (233), Expect = 1.119e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKN------LPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDC-SALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V       Y+  E M  G+L+ +++ +  ++  + +    ++Q+  G+ YL  Q  IHRDL   ++L+ E    K+++F L++         VF  D ED+        LP+K+ APE +R  +F+ K+DVWSFG +L +IIT  + P+ G    ++      N    Y       C +    I++ C  ++   R T E+L
Sbjct:  293 HPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDGGSKIHLIQQVDMAAQVASGMAYLESQNYIHRDLAARNVLVGEHNIYKVADFGLAR---------VFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLSQN----YRLPQPSNCPQQFYSIMLECWNVEPKQRPTFETL 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Frk (fyn-related kinase [Source:MGI Symbol;Acc:MGI:103265])

HSP 1 Score: 94.3597 bits (233), Expect = 1.119e-19
Identity = 60/211 (28.44%), Postives = 104/211 (49.29%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKN------LPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDC-SALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V       Y+  E M  G+L+ +++ +  ++  + +    ++Q+  G+ YL  Q  IHRDL   ++L+ E    K+++F L++         VF  D ED+        LP+K+ APE +R  +F+ K+DVWSFG +L +IIT  + P+ G    ++      N    Y       C +    I++ C  ++   R T E+L
Sbjct:  293 HPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDGGSKIHLIQQVDMAAQVASGMAYLESQNYIHRDLAARNVLVGEHNIYKVADFGLAR---------VFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLSQN----YRLPQPSNCPQQFYSIMLECWNVEPKQRPTFETL 490          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P42690|SRK4_SPOLA (Tyrosine-protein kinase isoform SRK4 OS=Spongilla lacustris OX=6055 GN=SRK1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.082e-22
Identity = 65/203 (32.02%), Postives = 105/203 (51.72%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTEN--DIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V    +  Y+  E M+ G+L  +++ +  +    D+    SQ+  G+ YL  Q  IHRDL   +IL+ E K  K+++F L++   ++E     + + +     PIK+ APE     RFT K+DVWSFG +L ++IT  R P+PG    ++    E  +        + C E L  I+M C + D  +R T E+L
Sbjct:  292 HPKLIQLYAVCTKEEPIYIVTELMKHGSLLEYLRGDGRSLKLPDLVDMCSQVASGMSYLEQQNYIHRDLAARNILVGEHKICKVADFGLAR--VIDEE----IYEAKLGAKFPIKWTAPEAAMYSRFTIKSDVWSFGIVLYEVITYGRFPYPGMTNAQV---LEQIQQSYRMPRPMGCPEKLYAIMMDCWREDPASRPTFETL 485          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P42689|SRK3_SPOLA (Tyrosine-protein kinase SRK3 (Fragment) OS=Spongilla lacustris OX=6055 GN=SRK3 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.832e-22
Identity = 67/214 (31.31%), Postives = 108/214 (50.47%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKN---LPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            HP  + LY V    +  Y+  E M+ G++  ++K  +    T + +   S+Q+  G+ YL     IHRDL   +IL+ E    K+++F L++         V  +D+ + +     PIK+ APE     RFT K+DVWSFG ++ +I+T  R P+PG    ++    E  + G        C + L +I++SC K +   R T ESL N  ED+
Sbjct:  118 HPNLLQLYAVCTIGEPIYIVTELMKYGSMLEYLKHGEGKNITLHQMVDMSAQIASGMTYLEAHSYIHRDLAARNILVGEGNVCKVADFGLAR---------VIKEDIYNPREGTKFPIKWTAPEAALYNRFTIKSDVWSFGVLISEIVTHGRMPYPGMTNRQV---LEAVDRGYRMPCPEGCPDPLYKIMLSCWKHEPDDRPTFESLKNLLEDY 319          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01621|LCK_RAT (Proto-oncogene tyrosine-protein kinase LCK OS=Rattus norvegicus OX=10116 GN=Lck PE=1 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 1.050e-21
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HPR V LY V    +  Y+  E ME G+L  F+K     + ++ K    ++Q+ EG+ ++ +Q  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L  ++M C K     R T + L
Sbjct:  297 HPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLEKGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYL 490          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P06240|LCK_MOUSE (Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4)

HSP 1 Score: 103.219 bits (256), Expect = 1.069e-21
Identity = 67/204 (32.84%), Postives = 106/204 (51.96%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HPR V LY V    +  Y+  E ME G+L  F+K     + ++ K    ++Q+ EG+ ++ +Q  IHRDL  ++IL+ ++   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C E L  ++M C K     R T + L
Sbjct:  297 HPRLVRLYAVVTQ-EPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEV---IQNLERGYRMVRPDNCPEELYHLMMLCWKERPEDRPTFDYL 490          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P42683|LCK_CHICK (Proto-oncogene tyrosine-protein kinase LCK OS=Gallus gallus OX=9031 GN=LCK PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 1.987e-21
Identity = 70/211 (33.18%), Postives = 110/211 (52.13%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            HPR V LY V    +  Y+  E ME G+L  F+K ++  +  I K    ++Q+ EG+ ++  +  IHRDL  ++IL+ E+   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C + L  ++M C K     R T E + +  EDF
Sbjct:  296 HPRLVRLYAVVTK-EPIYIITEYMEKGSLVDFLKTSEGIKLSINKLLDMAAQIAEGMAFIEAKNYIHRDLRAANILVSEALCCKIADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTYGRIPYPGMTNPEV---IQNLERGYRMPQPDNCPQELYELMMQCWKEQPEERPTFEYMKSVLEDF 496          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A2EAS8 (CAMK family protein kinase OS=Trichomonas vaginalis OX=5722 GN=TVAG_047030 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.142e-24
Identity = 84/283 (29.68%), Postives = 140/283 (49.47%), Query Frame = 2
Query: 1424 RISKLDAIEIGDCVNDGDHSDLFSAK---------MRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKN-KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIG--DYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFI 2236
            R   +D  ++GD + +G    +F A+         +++  KKLL K   H  +K+      +I EI     + +HP  + LYG + D +   + +E    GTL   +KK+ K  E    K+  Q+L  ++++H ++V+HRDL PS+I++     L L +F  +     N P+   V  ++        Y +PEIL N+ +   ADVW+ G+IL +++T + PF      E     +N E    DY  S L      R++I S L+ID  +R T + LLN+ +I
Sbjct:    6 RYWSIDDFDVGDVIGEGRFGKVFVAREKKSRFVCVLKIIRKKLLTK---HNLEKQ------LISEI-GLHSSFNHPNILRLYGYFFDDERIMMILEYAAHGTLSDLLKKHTKFDEPTAAKYFKQILSAVEHIHSKEVLHRDLKPSNIMISLDNTLLLGDFGFAIKG--NAPAGEIVGTLD--------YISPEILNNKEYGRSADVWALGSILFELLTGKCPFESDDPKETVRKIQNAEFSFPDY-ISPLA-----RKLISSILQIDPTSRPTAKDLLNDPWI 262          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2C9VI01 (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_07G028900 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 6.073e-24
Identity = 67/216 (31.02%), Postives = 117/216 (54.17%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNL--PIKYFAPEILRNER-FTTKADVWSFGAILIKIITQRAP------FPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIK 2239
            HP  V  YG   D    Y+ +E +  G+L+   K  +   + + +++ Q+LEGLKYLHD++V+HRD+  ++IL+ E   +K+++F L+K   L          V  LK+    I + APE+++ ++ +  +AD+WS G  +++++T++ P      F    ++E++ G   N + +Y  S     E  R  IM CL++D   R T   LLN  F+K
Sbjct:  689 HPNIVKYYGTEEDQSKIYIFLELVSTGSLRQVYKSFQLKNSQVSRYTKQILEGLKYLHDRKVVHRDIKCANILVDEKGCVKITDFGLAKVTEL----------VHLLKSCHGTIDWIAPEVMKKDKEYGVEADIWSLGCTVLEMLTRKYPYSHVSDFNANLEMEVQNGTLRNHLPNYSLS-----EKARSFIMDCLQVDPKKRPTASQLLNHSFVK 889          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: S8C0R3 (Protein kinase domain-containing protein (Fragment) OS=Genlisea aurea OX=192259 GN=M569_14433 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.032e-22
Identity = 64/223 (28.70%), Postives = 113/223 (50.67%), Query Frame = 2
Query: 1574 IYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIKQ 2242
            I+I+ + I+     +H   V  YG   +    Y+ +E +  G+L S  +K    ++ +  ++ Q+L GLKYLHD+ V+HRD+  ++IL+  +  +KL++F L+K   LN        DV+  K     + APE++R++ +   AD+WS G  +++++T R P+     LE          G+            R  I+ CL++D   R +   LLN  F+K+
Sbjct:    1 IFILVQEISLLSQFEHENIVQYYGTKKNESHLYIFIELVTKGSLLSLYQKYTLRDSQVCAYTRQILYGLKYLHDRNVVHRDIKCANILVHANGSVKLADFGLAKATKLN--------DVKSCKGTAY-WMAPEVVRSQGYGLAADIWSLGCTVLEMLTGRFPY---GNLECMAALFKIGRGERPAVPDSLSADSRDFILRCLEVDPKLRPSAAQLLNHPFLKR 211          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5N5FA81 (Serine/threonine-protein kinase ULK3-like OS=Pyrus ussuriensis x Pyrus communis OX=2448454 GN=D8674_001062 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.210e-22
Identity = 65/213 (30.52%), Postives = 112/213 (52.58%), Query Frame = 2
Query: 1463 VNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDI-KKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKD---LKLSNFNLSKYKTLNEPSSVFVKD-VEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEI 2086
            V  G  S ++ A  R + K + +K+   +   +   N       + F  + +HP  + L   + D  C ++ +E  + G L ++I+++   E  I K++  Q+   LK LH Q +IHRDL P +ILL  ++D   LK+++F LS+        S+   D  E +   P+ Y APE+L+ ER+  K D+WS G IL +++  R PFPG+  +++
Sbjct:   22 VGRGSFSTVWKAVHRQSGKVVALKQVHLSRLNRHLKNCLDCE--LNFLSSVNHPNIIRLLNAFQDESCIFMVLEFCDGGNLAAYIRQHGRVEEQIAKRFMQQLGAALKLLHSQHIIHRDLKPENILLSGTQDDVVLKVADFGLSR--------SLHPGDYAETVCGSPL-YMAPEVLQFERYDGKVDMWSIGVILFELLNGRPPFPGRTNVQV 223          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0B1TAK4 (Protein tyrosine kinase OS=Oesophagostomum dentatum OX=61180 GN=OESDEN_07701 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.290e-22
Identity = 56/158 (35.44%), Postives = 91/158 (57.59%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRA-PFPGKPKLEIK 2089
            HP  V LYGV  D + F + ME M  G LK+F++ N+ +      W++    G+ Y+H + +IHRD+   + LL  S  LK+++F L++           V  +   + LP+K+ APE+L N  FT K+DVWSFG ++ +I++  A P+ G P +++K
Sbjct:    6 HPNIVRLYGVALDKEPFLIVMELMANGDLKTFLRTNRSSPYQKLCWAAHAAYGIAYMHTKYLIHRDIAARNCLLSSSLTLKIADFGLTREGG--------VYQMIARRKLPVKWIAPEVLENNIFTLKSDVWSFGILVWEIMSDGAVPYEGLPNVKVK 155          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-340m8.2 (tyrosine-protein kinase SRK3-like [Source:NCBI gene;Acc:103039108])

HSP 1 Score: 102.064 bits (253), Expect = 2.063e-22
Identity = 99/387 (25.58%), Postives = 171/387 (44.19%), Query Frame = 2
Query: 1073 AENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEEAFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIK-KYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIK-----KWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKL----EIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTR 2200
            AEN   +  +KDG   + ++I E E+            L+F+  +    T+S + +  +       N D        LCT LN      V++ + +L   ++  E++    D     ++ KL +         G+ ++++     V NK + +  K F     +    I I++E         H R + LYGV    + F +  E M+ G+LK ++  ++    DI       ++ Q+ EG+ YL  + ++HRDL   +ILL + +  K+++F L+ +    +  S F   V      PIK+ APEI  N+ +T+K DVWSFG +L +I+T    P+P K KL     I+ G+   +          C   L  I+  C + D   R
Sbjct:  122 AENHFFYLSVKDGPYVRHYRIKEGEAGK----------LFFLVSQKTFPTVSDLVEHYSK------NQD-------GLCTQLNA---PCVMLDRPSLPTLSYDAEWEV---DRSSLAKVEKLGS---------GEFAEVWHG---VWNKNIDVAIKEFRVISPEIQTEIKIMKEY-------KHERLLKLYGVCTVSEPFCLITELMKNGSLKKYLISHR-ERKDIAFSLMIDFAVQVTEGMAYLESKNIVHRDLRADNILLTDMQFCKIADFGLADFTLPGDRESTFAVKV------PIKWMAPEIFDNQVYTSKCDVWSFGILLTEIVTYGNDPYPDKDKLACIQAIRRGYRMEQ-------PQACPSSLYEIMKLCWRTDPDER 446          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:103036768])

HSP 1 Score: 98.2117 bits (243), Expect = 4.797e-21
Identity = 70/212 (33.02%), Postives = 107/212 (50.47%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSAL-QCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            H + V L  V    +  Y+  E ME G+L  FIK ++     + K   +S+Q+ EG+ Y+  +  IHRDL  ++IL+ +S   K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +II+  R P+PG    E+    E      Y    L  C + L  I++ C K     R T E L +  EDF
Sbjct:  290 HDKLVRLNAVVTKEEPIYIITEFMEKGSLLDFIKTDEGNRVQLPKLIDFSAQIAEGMAYIEQRNYIHRDLRAANILVNKSLVCKIADFGLARIIEDNEYTA------REGAKFPIKWTAPEAINYGSFTIKSDVWSFGILLTEIISYGRTPYPGMTNPEVIRSLERG----YRMQRLDSCPQELYDIMLECWKNKPEDRPTFEYLQSVLEDF 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:103032401])

HSP 1 Score: 98.2117 bits (243), Expect = 4.857e-21
Identity = 67/214 (31.31%), Postives = 108/214 (50.47%), Query Frame = 2
Query: 1610 TKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTE---NDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            T  HPR V L+ V    +  Y+  E ME G+L  F+K  +      N +   +SQ+ +G+ Y+  +  IHRDL  ++IL+ ++   K+++F L++    +E ++       +    PIK+ APE +    F+ K+DVWSFG +L +I+T  R P+PG    E+    EN   G        C +GL  ++ +C   +   R T E L    EDF
Sbjct:  289 TLQHPRLVRLFAVVTQ-EPIYIITEYMENGSLVDFLKTPEGASLQTNTLIDMASQVADGMAYIEHKNYIHRDLRAANILVSDTLICKIADFGLARLIENDEYTA------REGAKFPIKWTAPEAINYGTFSIKSDVWSFGILLTEIVTYGRIPYPGMSNPEVIQNLEN---GYRMPCPDNCPDGLYNVMTACWTENPENRPTFEYLRGVLEDF 492          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: zgc:194282 (tyrosine-protein kinase Srms [Source:NCBI gene;Acc:103032452])

HSP 1 Score: 94.3597 bits (233), Expect = 8.893e-20
Identity = 63/261 (24.14%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1463 VNDGDHSDLFSAKMRVTNKKLLIK--KYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNE 2227
            + +G   +++ A     N+++ IK  K   T   +F   ++ ++ +        HP+ + L  +    +  ++  E M  G+LKS++   +    T   +   + Q+ EG+ YL D+ ++HRDL   +IL+    + K+++F L++        SV+         +P+++ APE   ++RF+ K+DVWSFG +L +++++ + P+ GK   E+    E    G    S  +C   + R++M C   D   R +  +L ++
Sbjct:  233 LGEGHFGEVWEALWTTKNQRVAIKMLKQEDTKLDEFVKEVHALKNL-------HHPKLIQLLALCTRGEPVFIITELMTKGSLKSYLATPEGQVLTSAHLIYMACQVAEGMAYLEDRHIVHRDLAARNILVGSELECKVADFGLARIIK----DSVYTASRNT--KIPVRWTAPEAALHQRFSVKSDVWSFGVLLYEMMSRGKMPYEGKNNKEV---LEILASGYRLPSPSRCPPNIYRMMMECWAADGSKRPSFHALHSQ 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: frk (tyrosine-protein kinase SRK2 [Source:NCBI gene;Acc:103029663])

HSP 1 Score: 93.9745 bits (232), Expect = 1.044e-19
Identity = 60/208 (28.85%), Postives = 109/208 (52.40%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFP----GKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V    +  Y+  E M  G+L  +++K++     + +    ++Q+  G+ YL  Q  IHRDL   ++L+ E+   K+++F L++    NE     V +  +    P+K+ APE +R+ +F  K+DVWSFG +L +I+T  + P+P     +  +++ TG+  +      C  L C + +  I++ C K     R T E+L
Sbjct:  256 HPKLIQLYAVCTLGEPIYIITELMSNGSLLEYLQKDRGARLRVTEQIEMAAQVAAGMAYLELQNYIHRDLAARNVLVGENNVCKVADFGLAR--VFNEN----VYEASEGTKFPVKWTAPEAIRDNKFNIKSDVWSFGILLYEIMTFGQMPYPTLTNAQVVVKLGTGYRMS------CPLL-CPKMIYDIMVECWKETPAERPTFETL 450          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 8.764e-23
Identity = 65/215 (30.23%), Postives = 105/215 (48.84%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK---WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKY-KTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDFIKQ 2242
            HP+ + LY V    +  Y+  E M  G+L ++++  +    D+ +    ++Q+  G+ YL  Q  IHRDL   +IL+ E    K+++F L++  K  NE       +       PIK+ APE     RF+ K+DVWSFG +L +IIT  + P+PG+   E+    +        C    C +    +++ C  +D   R T E+L    EDF  Q
Sbjct:  166 HPKLIQLYAVCTQEEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEY----EARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGY--RMPCPP-GCPQAFYDLMLECWNVDDQARPTFETLQWQLEDFFSQ 373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 96.2857 bits (238), Expect = 3.452e-21
Identity = 66/207 (31.88%), Postives = 103/207 (49.76%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNK------PTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            H + V LY V ++ +  Y+  E M  G+L  F+K+        P   D+   ++Q+  G+ Y+     IHRDL  ++IL+ ++   K+++F L++    NE ++            PIK+ APE     RFT K+DVWSFG +L +++T+ R P+PG    E+    E  E G        C E L  ++M C K D   R T E L
Sbjct:  259 HDKLVQLYAVVSE-EPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDM---AAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTA------RQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREV---LEQVERGYRMPCPPSCPESLHELMMQCWKKDPEERPTFEYL 452          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 94.7449 bits (234), Expect = 9.294e-21
Identity = 68/214 (31.78%), Postives = 106/214 (49.53%), Query Frame = 2
Query: 1610 TKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKW---SSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            T  HPR V LY V    +  Y+  E ME G+L  ++K  + +   + K    ++Q+ EG+ ++  +  IHRDL  ++IL+ E    K+++F L++    NE ++       +    PIK+ APE +    F+ K+DVWSFG +L +IIT  R P+PG    ++    E    G       Q  + L  ++M C K     R T E L    EDF
Sbjct:  231 TLQHPRLVRLYAVVTQ-EPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDNEYTA------REGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLER---GYRMPCPEQAPKQLYGVMMDCWKERPEERPTFEYLQGVLEDF 434          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: fer (fer (fps/fes related) tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-060526-234])

HSP 1 Score: 95.9005 bits (237), Expect = 1.255e-20
Identity = 64/266 (24.06%), Postives = 123/266 (46.24%), Query Frame = 2
Query: 1439 DAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKK--NKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNE 2227
            D I +G+ +  G+  ++++ +++ +   + +K       +   +   +   I+      +HP  V L GV       Y+ ME +  G   +F+++  ++ +   +  +S Q   G+ YL     IHRDL   + L+ E+  LK+S+F +S+     +   V++     ++ +PIK+ APE L    +TT +DVWS+G +L +I +   +P+PG      K   E    G        C +G+  +++ C +     R T   L  E
Sbjct:  556 DDIILGEKLGKGNFGEVYAGRLKASGVPVAVKACHENLSQDLKNRFLMEARILK---RYNHPNVVRLIGVCTRRTPVYIVMELVRGGDFLTFLRREGSRLSVPQLLNYSEQAAAGMAYLESHNCIHRDLAARNCLVGEASVLKISDFGMSR----QQADGVYLA-TGVMRQIPIKWTAPEALHYGTYTTMSDVWSYGILLWEIFSLGSSPYPGWSN---KMACEQVASGYRMPPPAVCPDGIYSLMLRCWEFHAEQRPTFTELHRE 810          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 90.8929 bits (224), Expect = 2.980e-20
Identity = 58/206 (28.16%), Postives = 107/206 (51.94%), Query Frame = 2
Query: 1463 VNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTEND---IKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRN-ERFTTKADVWSFGAILIKIITQRAPFPG 2068
            + +G +  ++ A+ ++T + + +KK    T+ +   +   IREI   +   +HP  V L  + +  K  Y+  E ++   LK F+    P+      +K +  Q+L+G+ + H  +++HRDL P ++L+     +KL++F L+  +    P   +  +V  L      Y APEIL   + ++T  DVWS G I  +++T+RA FPG
Sbjct:   10 IGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPST-AIREISLLR-ELNHPNIVRLLTIIHSEKKLYLVFELLD-QDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLA--RAFGVPQRTYTHEVVTL-----WYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPG 205          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 98.5969 bits (244), Expect = 1.121e-21
Identity = 75/280 (26.79%), Postives = 126/280 (45.00%), Query Frame = 2
Query: 1451 IGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNI-YIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDI-KKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDL--KLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRN-----------ER--FTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIK 2239
            I + V  G  + +  A  R T K   +K     +++K   N+  + RE+   Q   +HPR V L G Y D + +Y+ ME +  G L  F+  +     D  ++ S Q+L  +KY+H   + HRDL P +IL+++   +  K+++F L+K +        F           + Y APE++R            ER  +++  D+WS G ++  I+T   PF G  + ++          +      +  E  R  I S L++D   RST    LN  +IK
Sbjct:  200 IDEVVGQGAFATVKKAIERTTGKTFAVKI---ISKRKVIGNMDGVTRELEVLQKL-NHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCG--------TLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIK 467          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 91.6633 bits (226), Expect = 1.710e-19
Identity = 69/265 (26.04%), Postives = 127/265 (47.92%), Query Frame = 2
Query: 1448 EIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP--TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFI 2236
             +   +  G +  ++ A  + T++ + IK+  +   ++  D   I+ EI   +   +H   V  +G        Y+ +E    G+L+  I ++    +EN+ K + +Q L GLKYLH + VIHRD+  ++ILL     +KL++F +S   T+   S++ +          + + APEIL N   +T +D+WS GA +++++T+  P+       I    EN+    Y  S+    E L+  +  C   +   R T + LL   +I
Sbjct:   26 HLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELND---IMAEISLLK-NLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVS---TIVNSSALTLAGT-------LNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY--YPPSSF--SEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 83.1889 bits (204), Expect = 2.134e-17
Identity = 42/149 (28.19%), Postives = 82/149 (55.03%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK-WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF 2062
            HP  + ++G + D +  ++ M+ +E G L S ++K++   N + K +++++   L+YLH + +I+RDL P +ILL ++  +K+++F  +KY          V DV         Y APE++  + +    D WSFG ++ +++    PF
Sbjct:  145 HPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY----------VPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 83.5741 bits (205), Expect = 3.176e-17
Identity = 63/205 (30.73%), Postives = 101/205 (49.27%), Query Frame = 2
Query: 1472 GDHSDLFSAKMRVTN-KKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKC--FYVAMENMEL----GTLKSFIKKN-KPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF 2062
            G+ +    AK R+ N KK+   K  +T          I RE+  F  +      V  YG++ D +    Y+AME M       T K+ +K+  + +E  I K +  +L GL YLH+++VIHRD+ P +ILL E  ++KL +F +S  + +N  +  F             Y APE ++ + ++   DVWS G  L+++   R PF
Sbjct:  221 GEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFREL-QFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSG-EAVNSLAMTFTGTS--------FYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPF 415          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 82.0333 bits (201), Expect = 4.640e-17
Identity = 52/198 (26.26%), Postives = 105/198 (53.03%), Query Frame = 2
Query: 1478 HSDLFSAKMRVTNKKLLI--KKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKK-WSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF 2062
            H+  + A M+V  K++++  K+  HT  ++      ++  I+T      HP  + ++G + D +  ++ M+ +E G L S ++K++   N + K +++++   L+YLH + +I+RDL P +ILL ++  +K+++F  +KY          V DV         Y APE++  + +    D WSFG ++ +++    PF
Sbjct:  108 HNGRYYA-MKVLKKEIVVRLKQVEHTNDER------LMLSIVT------HPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY----------VPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPF 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 93.9745 bits (232), Expect = 1.414e-20
Identity = 61/205 (29.76%), Postives = 98/205 (47.80%), Query Frame = 2
Query: 1616 DHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP-TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSS--VFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLL 2221
            +HP  +   GV N    + V ME    G L   ++  +  T   +  W++Q+ +G+ YLH  ++IHRDL   +IL+  +  LK+S+F   K    NE S+   F   V         + APE++RNE  + K DVWSFG +L +++T   P+ G     I  G  +N +     S   C EG++ ++  C       R +   +L
Sbjct:   79 NHPNIIRFKGVCNQAPVYCVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDILKISDFGTCK--EFNEKSAKMTFAGTV--------AWMAPEVIRNEPCSEKVDVWSFGVLLWELLTGELPYKGVDSSAIIWGVGSNNLQLPVPST--CPEGIQLLMKLCWNSKPKNRPSFRQVL 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 93.2041 bits (230), Expect = 1.821e-20
Identity = 65/282 (23.05%), Postives = 137/282 (48.58%), Query Frame = 2
Query: 1415 KYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYII----REIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFI-KKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVF-VKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIKQ 2242
            ++ +  ++    +G  + +G  + +      +T +K+ +K      +K+  ++ Y+     RE    Q+ + HP  ++L  V      +Y+  E    G L  +I  + +  E +++K+  Q++  ++YLH   +IHRDL   ++LL E  ++++ +F LS   ++ +P  +  +KD    +     Y APEIL ++ + TK DVWS G  +  ++T + P+  +P   I T +     G+ +    +     R ++M  L  D   R +++  +N  ++K+
Sbjct:   15 RFLKCKRVGNYLLGKTIGEGSFAKVKQGFHVLTGEKVAVKI---IDKKQALEDRYVSKNMRREARILQMVR-HPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLLDEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPAYAAPEILGHQLYGTKVDVWSIGVNMYAMLTGKLPYTAEP-FNIVTLYNKMVRGEMNAVPDRLSPSCRDLLMRFLTFDPDERISLDEAINHVWLKK 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 90.5077 bits (223), Expect = 7.604e-20
Identity = 62/206 (30.10%), Postives = 107/206 (51.94%), Query Frame = 2
Query: 1463 VNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPT---ENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNER-FTTKADVWSFGAILIKIITQRAPFPG 2068
            + +G +  ++ A+ + T + + +KK    T+ +   +   IREI   +   +HP  V+L  V ++ K  Y+  E +    LK ++    P+    + IK +  Q+L G+ Y H  +V+HRDL P ++L+ ++  +KL++F L+  +    P   +  +V  L      Y APEIL   R + T  DVWS G I  ++ T+RA FPG
Sbjct:   10 IGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVPST-AIREISLLK-ELNHPNVVSLLDVVHNQKSLYLVFEFLS-QDLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLA--RAFGVPVRSYTHEVVTL-----WYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPG 205          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 90.1225 bits (222), Expect = 1.055e-19
Identity = 58/207 (28.02%), Postives = 98/207 (47.34%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIK 2239
            HP  V +YG +      +V ME +E GTL   +     +E  +      +L+ L +LH Q VIHRD+   SILL  +  +KLS+F      T + P        + L   P  + APE++  + + T+ D+WS G ++++++    P+  +P L+      + E      + +Q    L+  + + L  D   R+T   LLN  FI+
Sbjct:   83 HPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDMPRR------KSLVGTPY-WMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLE-PPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIR 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 88.9669 bits (219), Expect = 1.572e-19
Identity = 58/210 (27.62%), Postives = 105/210 (50.00%), Query Frame = 2
Query: 1625 RFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP-TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPF----PGKPKLEIKTGFENNEI-GDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFI 2236
            R V  YG+  D    Y+ ME +  G++   IK++    E+  +K+S Q+LEG+ YLH  +++HRD+  ++IL     ++KL++F  SK        + F      +   P  + APE++  E +  KADVWS G  +++++T + P+    P     +I T     E+  D    A++        + S L+++  +R + + LL   F+
Sbjct:   65 RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGF----RSVHGTPY-WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVE-------FVRSTLRMNSKSRPSADELLRFSFV 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038909.1 (tyrosine-protein kinase SRK3 [Source:NCBI gene;Acc:101169425])

HSP 1 Score: 102.834 bits (255), Expect = 1.664e-22
Identity = 67/261 (25.67%), Postives = 132/261 (50.57%), Query Frame = 2
Query: 1463 VNDGDHSDLFSAKMRVTNKKLLIK--KYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKP---TENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQ-RAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNE 2227
            + +G+  +++ A     NKK+ IK  K   T Q +F   ++ ++ +        HPR + L  + +  +  Y+  E M  G+LKS++   +    +   +   S Q+ EG+ YL D+ ++HRDL   +IL+ +    K+++F L++        SV+         +P+++ APE   ++RF+ K+DVWSFG +L +++++ + P+ GK   E+ T   +   G       +C E + +I+M C   +   R +  +L ++
Sbjct:  245 LGEGNFGEVWEALWVKENKKVAIKTLKQEDTKQDEFVKEVHALKNL-------HHPRLIQLLAMCSRGEPVYIVTELMSKGSLKSYLASAEGHMLSSAHLIYMSGQISEGMAYLEDRNIVHRDLAARNILVGDDLVCKVADFGLARIIR----DSVYTASRNT--KIPVRWTAPEAALHQRFSVKSDVWSFGVLLYEMMSRGKMPYEGKSNKEVMTILTS---GYRLACPTRCPENIYKIMMDCWAAEPSKRPSFHALHSQ 489          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: frk (fyn related Src family tyrosine kinase [Source:NCBI gene;Acc:101162804])

HSP 1 Score: 100.908 bits (250), Expect = 6.969e-22
Identity = 66/214 (30.84%), Postives = 111/214 (51.87%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTE---NDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDL------KNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLE----IKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V    +  Y+  E M+ G+L  +++K+K      +D  + ++Q+  G+ YL  Q  IHRDL   ++L+ E+   K+++F L++         VF+K+ E++         P+K+ APE +   RFT K+DVWSFG +L +I+T  + P+PG   ++    I TG+         C    C + L  I++ C K     R T E+L
Sbjct:  306 HPKLIQLYAVCTLQEPIYIITELMKHGSLLDYLQKDKGVTLAISDQIEMAAQVASGMAYLELQNYIHRDLAARNVLVGENNICKVADFGLAR---------VFMKESENVYEAREGTKFPVKWTAPEAIHENRFTIKSDVWSFGILLYEIMTFGQVPYPGMSNIQVTQRITTGYR------MPCPP-NCPKLLYDIMLECWKESDQERPTFETL 503          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:100170631])

HSP 1 Score: 99.7525 bits (247), Expect = 1.511e-21
Identity = 71/212 (33.49%), Postives = 108/212 (50.94%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKK----NKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            HPR V L+ V  + +  Y+  E ME G+L  F+K     N P  N +   +SQ+ +G+ ++  +  IHRDL  ++IL+      K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C +GL  I+  C K     R T E L +  EDF
Sbjct:  289 HPRLVRLFAVVTE-EPIYIVTEYMENGSLVDFLKTQEGGNLPI-NTLIDMASQVADGMAFIEQRNYIHRDLRAANILVSHELICKVADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINFGTFTIKSDVWSFGILLTEIVTYGRIPYPGMSNPEV---IQNLERGYRMPKPEGCPDGLYAIMCHCWKETPDDRPTFEYLKDVLEDF 489          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: lck (LCK proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:100170631])

HSP 1 Score: 99.7525 bits (247), Expect = 1.511e-21
Identity = 71/212 (33.49%), Postives = 108/212 (50.94%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKK----NKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLN--EDF 2233
            HPR V L+ V  + +  Y+  E ME G+L  F+K     N P  N +   +SQ+ +G+ ++  +  IHRDL  ++IL+      K+++F L++    NE ++       +    PIK+ APE +    FT K+DVWSFG +L +I+T  R P+PG    E+    +N E G        C +GL  I+  C K     R T E L +  EDF
Sbjct:  289 HPRLVRLFAVVTE-EPIYIVTEYMENGSLVDFLKTQEGGNLPI-NTLIDMASQVADGMAFIEQRNYIHRDLRAANILVSHELICKVADFGLARLIEDNEYTA------REGAKFPIKWTAPEAINFGTFTIKSDVWSFGILLTEIVTYGRIPYPGMSNPEV---IQNLERGYRMPKPEGCPDGLYAIMCHCWKETPDDRPTFEYLKDVLEDF 489          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: frk (fyn related Src family tyrosine kinase [Source:NCBI gene;Acc:101162804])

HSP 1 Score: 99.3673 bits (246), Expect = 2.255e-21
Identity = 64/208 (30.77%), Postives = 108/208 (51.92%), Query Frame = 2
Query: 1619 HPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTE---NDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIIT-QRAPFPGKPKLE----IKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESL 2218
            HP+ + LY V    +  Y+  E M+ G+L  +++K+K      +D  + ++Q+  G+ YL  Q  IHRDL   ++L+ E+   K+++F L++   +    S  V +  +    P+K+ APE +   RFT K+DVWSFG +L +I+T  + P+PG   ++    I TG+         C    C + L  I++ C K     R T E+L
Sbjct:  288 HPKLIQLYAVCTLQEPIYIITELMKHGSLLDYLQKDKGVTLAISDQIEMAAQVASGMAYLELQNYIHRDLAARNVLVGENNICKVADFGLARVFMVE---SENVYEAREGTKFPVKWTAPEAIHENRFTIKSDVWSFGILLYEIMTFGQVPYPGMSNIQVTQRITTGYR------MPCPP-NCPKLLYDIMLECWKESDQERPTFETL 485          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074913.1 (SMESG000074913.1)

HSP 1 Score: 1368.99 bits (3542), Expect = 0.000e+0
Identity = 705/728 (96.84%), Postives = 713/728 (97.94%), Query Frame = 2
Query:   59 MNIIPILFSLLLLDFYSGETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNXXXXXXXXXXXXXXXXXXXXXXXXXXKIITKLIDHRKRKGSNQYKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIESKLIEILNILNTSTNLSKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEEAFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIKQ 2242
            MNIIPILFSLLLLDFYSGETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNIIYILLWIIIIIN LMFFLLLLEIRFKIITKLIDHRKRKGSNQYKILESRK+MFLK+YFMDTKEVN+KFELQ YKFE KIESKLIEILNILNTSTNLSKLKE SKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINS+NILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKL ISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSE+AFAFEYDFTGNDPVKYCRISKL AIEIGDCVNDG+HSDLF AKMRVTNKKLLIKKYFHTT+KKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK NKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILL ESKDLKLS+FNLSKYK LNEPSSVFVKDVEDL  LPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGF NNEIGDYDCSALQCGEGLR IIMSCLKIDQGTRSTVESLLNEDFI Q
Sbjct:    1 MNIIPILFSLLLLDFYSGETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNIIYILLWIIIIINILMFFLLLLEIRFKIITKLIDHRKRKGSNQYKILESRKSMFLKNYFMDTKEVNEKFELQHYKFEHKIESKLIEILNILNTSTNLSKLKEKSKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSNNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLAISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEKAFAFEYDFTGNDPVKYCRISKLVAIEIGDCVNDGNHSDLFRAKMRVTNKKLLIKKYFHTTEKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKVNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLNESKDLKLSSFNLSKYKILNEPSSVFVKDVEDLHKLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFANNEIGDYDCSALQCGEGLRTIIMSCLKIDQGTRSTVESLLNEDFINQ 728          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074913.1 (SMESG000074913.1)

HSP 1 Score: 1324.69 bits (3427), Expect = 0.000e+0
Identity = 683/706 (96.74%), Postives = 691/706 (97.88%), Query Frame = 2
Query:  125 MTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNXXXXXXXXXXXXXXXXXXXXXXXXXXKIITKLIDHRKRKGSNQYKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIESKLIEILNILNTSTNLSKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEEAFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIKQ 2242
            MTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNIIYILLWIIIIIN LMFFLLLLEIRFKIITKLIDHRKRKGSNQYKILESRK+MFLK+YFMDTKEVN+KFELQ YKFE KIESKLIEILNILNTSTNLSKLKE SKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINS+NILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKL ISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSE+AFAFEYDFTGNDPVKYCRISKL AIEIGDCVNDG+HSDLF AKMRVTNKKLLIKKYFHTT+KKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK NKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILL ESKDLKLS+FNLSKYK LNEPSSVFVKDVEDL  LPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGF NNEIGDYDCSALQCGEGLR IIMSCLKIDQGTRSTVESLLNEDFI Q
Sbjct:    1 MTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNIIYILLWIIIIINILMFFLLLLEIRFKIITKLIDHRKRKGSNQYKILESRKSMFLKNYFMDTKEVNEKFELQHYKFEHKIESKLIEILNILNTSTNLSKLKEKSKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSNNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLAISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEKAFAFEYDFTGNDPVKYCRISKLVAIEIGDCVNDGNHSDLFRAKMRVTNKKLLIKKYFHTTEKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKVNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLNESKDLKLSSFNLSKYKILNEPSSVFVKDVEDLHKLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFANNEIGDYDCSALQCGEGLRTIIMSCLKIDQGTRSTVESLLNEDFINQ 706          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074923.1 (SMESG000074923.1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 538/712 (75.56%), Postives = 581/712 (81.60%), Query Frame = 2
Query:  113 ETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNXXXXXXXXXXXXXXXXXXXXXXXXXXKIITKLIDHRKRKGSNQYKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIESKLIEILNILNTSTN--LSKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEEAFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLRRIIMSCLKIDQGTRSTVESLLNEDFIKQ 2242
            E P  +C + +PF+T   +C NF  VC+K  D  C+ F  ICAQCP +N+S L + +I  +K +L+N           +K T    I +   + F+                   LM  LL+LEIRF IITKL   RK     QY  L+ R   + K Y      V  + E +D   +  I   ++  ++IL T+ N  +  +KE +K  MNG  I++KI  +DNCV +KR+ICHKL L+KSED KILKLKY GKTLEDNQYFSTFNIPTDE+ILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKIL+EESTVAQCNIIDEEFLYFISREVKKL ISSIFDEGNSAVIDYDNTDTILAMK SLCTPLNCCLEDFVLIQKGTLSE+AFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDG+HSDLF AK RVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHD QVIHRDLNPSSILL ESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDL  LPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGF NNEIGDYDCSALQCGEGLRR+IMSCLKIDQGTRSTVESLLNEDFI Q
Sbjct:   20 ELPTTSCPSSRPFQTLGIRCANFQEVCVKTNDIKCKKFQNICAQCPPSNFSTLTYLNIENMKEQLKNN----------VKRTSSIFILLWIIIAFN------------------ILMAILLILEIRFGIITKLFHRRKLSDEKQYISLK-RAERYEKQY------VPIEREQRDDSNDSNI--IILNKIDILTTNVNKLIKSIKEKTKICMNGQIIEMKISPRDNCVAVKRKICHKLSLLKSEDCKILKLKYKGKTLEDNQYFSTFNIPTDEKILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILKEESTVAQCNIIDEEFLYFISREVKKLAISSIFDEGNSAVIDYDNTDTILAMKKSLCTPLNCCLEDFVLIQKGTLSEKAFAFEYDFTGNDPVKYCRISKLDAIEIGDCVNDGNHSDLFRAKERVTNKKLLIKKYFHTTQKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIKKNKPTENDIKKWSSQMLEGLKYLHDHQVIHRDLNPSSILLNESKDLKLSNFNLSKYKTLNEPSSVFVKDVEDLHKLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFANNEIGDYDCSALQCGEGLRRVIMSCLKIDQGTRSTVESLLNEDFINQ 694          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074915.1 (SMESG000074915.1)

HSP 1 Score: 417.542 bits (1072), Expect = 9.413e-140
Identity = 242/425 (56.94%), Postives = 281/425 (66.12%), Query Frame = 2
Query:   68 IPILFSLLLLDFYS-----GETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNXXXXXXXXXXXXXXXXXXXXXXXXXXKIITKLIDHRKRKGSNQ-YKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIESKLIEILNILNTSTNL--SKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPL 1318
            + IL  ++    YS      E P   C  +KPFKT +  C NF +VC+K GD++C++F  +C QCPA NYS+  + D+  I  +++ +   +  I +        +I       F                             IRFKI+TK+      +  N  Y+IL+SRK+  L                     E++I S +   LN L  + ++   K+KE +K  MNG  I+IKI  +DNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMK     P+
Sbjct:    1 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQRLCQQCPAYNYSIQTYLDVRTISDQIKRSYDRIERIHSNFYLIVGLIILFLFLSIFE----------------------------IRFKILTKVFSAICGQSINHMYRILQSRKSEEL------------------ILMEKRINSNITSNLNSLTANIDILIQKIKEKTKICMNGQIIEIKIWPRDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKNESMYPI 379          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074915.1 (SMESG000074915.1)

HSP 1 Score: 414.075 bits (1063), Expect = 1.110e-138
Identity = 236/399 (59.15%), Postives = 272/399 (68.17%), Query Frame = 2
Query:  131 CRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNXXXXXXXXXXXXXXXXXXXXXXXXXXKIITKLIDHRKRKGSNQ-YKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIESKLIEILNILNTSTNL--SKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKMSLCTPL 1318
            C  +KPFKT +  C NF +VC+K GD++C++F  +C QCPA NYS+  + D+  I  +++ +   +  I +        +I       F                             IRFKI+TK+      +  N  Y+IL+SRK+  L                     E++I S +   LN L  + ++   K+KE +K  MNG  I+IKI  +DNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMK     P+
Sbjct:    2 CGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQRLCQQCPAYNYSIQTYLDVRTISDQIKRSYDRIERIHSNFYLIVGLIILFLFLSIFE----------------------------IRFKILTKVFSAICGQSINHMYRILQSRKSEEL------------------ILMEKRINSNITSNLNSLTANIDILIQKIKEKTKICMNGQIIEIKIWPRDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINSSNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAVIDYDNTDTILAMKNESMYPI 354          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCK1.746e-2032.70LCK proto-oncogene, Src family tyrosine kinase [So... [more]
FES1.995e-2025.19FES proto-oncogene, tyrosine kinase [Source:HGNC S... [more]
LCK2.058e-2032.70LCK proto-oncogene, Src family tyrosine kinase [So... [more]
LCK2.058e-2032.70LCK proto-oncogene, Src family tyrosine kinase [So... [more]
FES2.520e-2025.19FES proto-oncogene, tyrosine kinase [Source:HGNC S... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F26E4.58.451e-2329.58Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
csk-17.946e-2029.30Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-17.946e-2029.30Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
kin-291.153e-1923.02Serine/threonine-protein kinase kin-29 [Source:Un... [more]
csk-11.911e-1929.30Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Takl11.636e-1826.20gene:FBgn0046689 transcript:FBtr0083996[more]
Src42A4.986e-1828.16gene:FBgn0264959 transcript:FBtr0335275[more]
htl8.074e-1829.35gene:FBgn0010389 transcript:FBtr0083550[more]
htl8.074e-1829.35gene:FBgn0010389 transcript:FBtr0083549[more]
htl8.074e-1829.35gene:FBgn0010389 transcript:FBtr0083548[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-340m8.23.815e-2231.22si:ch73-340m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-2... [more]
stk17a1.303e-2128.52serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-G... [more]
hck2.072e-2133.02HCK proto-oncogene, Src family tyrosine kinase [So... [more]
hck2.361e-2133.02HCK proto-oncogene, Src family tyrosine kinase [So... [more]
lck1.011e-2031.75LCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BLK1.090e-2134.60LCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSXETT00000045672.11.092e-2129.63protein kinase C delta type-like [Source:NCBI gene... [more]
cdk5rap13.832e-2131.25CDK5 regulatory subunit associated protein 1 [Sour... [more]
gpn29.925e-2131.60GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751... [more]
gpn21.247e-2031.60GPN-loop GTPase 2 [Source:Xenbase;Acc:XB-GENE-5751... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lck1.412e-2232.84lymphocyte protein tyrosine kinase [Source:MGI Sym... [more]
Lck1.529e-2232.84lymphocyte protein tyrosine kinase [Source:MGI Sym... [more]
Lck1.529e-2232.84lymphocyte protein tyrosine kinase [Source:MGI Sym... [more]
Frk1.119e-1928.44fyn-related kinase [Source:MGI Symbol;Acc:MGI:1032... [more]
Frk1.119e-1928.44fyn-related kinase [Source:MGI Symbol;Acc:MGI:1032... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42690|SRK4_SPOLA1.082e-2232.02Tyrosine-protein kinase isoform SRK4 OS=Spongilla ... [more]
sp|P42689|SRK3_SPOLA8.832e-2231.31Tyrosine-protein kinase SRK3 (Fragment) OS=Spongil... [more]
sp|Q01621|LCK_RAT1.050e-2132.84Proto-oncogene tyrosine-protein kinase LCK OS=Ratt... [more]
sp|P06240|LCK_MOUSE1.069e-2132.84Proto-oncogene tyrosine-protein kinase LCK OS=Mus ... [more]
sp|P42683|LCK_CHICK1.987e-2133.18Proto-oncogene tyrosine-protein kinase LCK OS=Gall... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A2EAS82.142e-2429.68CAMK family protein kinase OS=Trichomonas vaginali... [more]
A0A2C9VI016.073e-2431.02Uncharacterized protein OS=Manihot esculenta OX=39... [more]
S8C0R31.032e-2228.70Protein kinase domain-containing protein (Fragment... [more]
A0A5N5FA811.210e-2230.52Serine/threonine-protein kinase ULK3-like OS=Pyrus... [more]
A0A0B1TAK41.290e-2235.44Protein tyrosine kinase OS=Oesophagostomum dentatu... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-340m8.22.063e-2225.58tyrosine-protein kinase SRK3-like [Source:NCBI gen... [more]
hck4.797e-2133.02HCK proto-oncogene, Src family tyrosine kinase [So... [more]
lck4.857e-2131.31LCK proto-oncogene, Src family tyrosine kinase [So... [more]
zgc:1942828.893e-2024.14tyrosine-protein kinase Srms [Source:NCBI gene;Acc... [more]
frk1.044e-1928.85tyrosine-protein kinase SRK2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006670.18.764e-2330.23pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
clul13.452e-2131.88clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
hck9.294e-2131.78HCK proto-oncogene, Src family tyrosine kinase [So... [more]
fer1.255e-2024.06fer (fps/fes related) tyrosine kinase [Source:ZFIN... [more]
cdk22.980e-2028.16cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD531.121e-2126.79DNA damage response protein kinase; required for c... [more]
CDC151.710e-1926.04Protein kinase of the Mitotic Exit Network; locali... [more]
TPK32.134e-1728.19cAMP-dependent protein kinase catalytic subunit; p... [more]
MKK23.176e-1730.73MAPKK involved in the protein kinase C signaling p... [more]
TPK14.640e-1726.26cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375751.414e-2029.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.821e-2023.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414037.604e-2030.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.055e-1928.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414101.572e-1927.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038909.11.664e-2225.67tyrosine-protein kinase SRK3 [Source:NCBI gene;Acc... [more]
frk6.969e-2230.84fyn related Src family tyrosine kinase [Source:NCB... [more]
lck1.511e-2133.49LCK proto-oncogene, Src family tyrosine kinase [So... [more]
lck1.511e-2133.49LCK proto-oncogene, Src family tyrosine kinase [So... [more]
frk2.255e-2130.77fyn related Src family tyrosine kinase [Source:NCB... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074913.10.000e+096.84SMESG000074913.1[more]
SMESG000074913.10.000e+096.74SMESG000074913.1[more]
SMESG000074923.10.000e+075.56SMESG000074923.1[more]
SMESG000074915.19.413e-14056.94SMESG000074915.1[more]
SMESG000074915.11.110e-13859.15SMESG000074915.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002638 ID=SMED30002638|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2349bp
CATGCTTTATTAATAGAATTATTATTATTATAATTCTGAATGAATTAATG
ATTTTATTATGAATATTATTCCTATTTTGTTTTCTTTGCTTCTTTTGGAT
TTTTATTCGGGTGAAACTCCTCGGATGACATGTAGAAATTTGAAGCCTTT
TAAGACAGCAGATTATCAGTGCGACAACTTTTCAAATGTTTGCATTAAAA
AAGGTGATCAAGACTGTGAAAGTTTTATGGAAATTTGTGCACAATGCCCC
GCCACAAATTATAGCGTGCTTATGTTTTATGATATTACAAAAATTAAAGG
TGAATTAGAAAATACAAAATTGAATATGAATAATATTGCAACCGAAATGA
AAACCACAAAAGAAAAGTTAATAAAAATTACAAATCAATTAAAGTTCAGC
GAACAAGGAAAAAATATAATCTATATACTTTTGTGGATAATTATTATCAT
CAACTTTTTAATGTTTTTCTTGCTGCTGCTGGAAATCAGATTCAAGATCA
TCACGAAATTAATAGATCACAGAAAAAGAAAAGGCAGCAATCAATACAAA
ATTCTCGAAAGTCGAAAAACTATGTTTTTAAAAGATTATTTCATGGACAC
CAAAGAGGTTAATAAAAAATTTGAATTACAAGATTACAAATTTGAACGCA
AAATTGAGTCGAAGTTGATTGAAATTTTGAATATATTAAATACAAGCACA
AATTTGTCAAAATTAAAAGAGATATCTAAATTTCGCATGAATGGAAACAC
AATTAAAATAAAAATTGAAAAAAAAGATAATTGTGTGGTCATTAAACGAA
GGATTTGTCATAAACTTTACCTTGTTAAATCAGAAGATTACAAAATCCTA
AAACTCAAATACAACGGCAAAACATTGGAGGATAATCAGTACTTCTCAAC
CTTCAATATACCTACAGATGAGGAAATACTATGTGAAAAAGACCTGTCAA
TCAATTCTAGCAACATTCTGGTGGTCAAACCCGCAGGAAATATTCAGCTG
CCAGATTTAATTCAAATCCAAAAACATCAAACAATCTCTGATTTGAAAAA
ACTGACTCCCGGAATATCGGATGCCGAGAACCTCAGAATATTTGCAGAGA
TAAAGGATGGCAACGACAAAAAACAATTTAAAATTCTGGAAGAGGAATCA
ACTGTTGCGCAATGCAATATCATTGATGAAGAATTTCTGTATTTTATATC
AAGAGAAGTGAAAAAATTGACAATCTCGTCGATATTCGATGAAGGAAATT
CCGCTGTAATTGACTACGACAACACGGACACCATTTTAGCCATGAAAATG
AGTCTATGTACCCCATTAAATTGCTGCCTTGAAGATTTCGTGCTAATCCA
AAAGGGAACATTATCGGAGGAGGCGTTTGCATTCGAATACGATTTCACTG
GAAATGATCCAGTAAAATATTGCAGGATTTCGAAACTTGATGCCATTGAA
ATCGGGGATTGTGTAAATGATGGGGACCATTCAGACTTGTTTAGTGCAAA
AATGCGAGTAACAAACAAAAAGTTATTGATAAAGAAATATTTCCACACAA
CCCAAAAGAAATTTGCTGATAATATCTACATAATACGGGAAATAATAACT
TTTCAATTAACAAAAGATCATCCCAGATTTGTGAATTTATATGGAGTTTA
TAATGATCCAAAATGCTTTTATGTTGCCATGGAAAATATGGAACTTGGGA
CCTTGAAATCCTTCATCAAAAAAAATAAGCCCACCGAAAATGATATTAAG
AAATGGTCATCCCAAATGTTGGAGGGGCTGAAATATCTTCACGACCAACA
AGTAATTCACCGAGATTTAAACCCGTCAAGCATTCTATTGAAAGAATCAA
AGGACCTCAAGCTGTCAAACTTCAATTTATCGAAATATAAAACTCTCAAT
GAGCCAAGTTCAGTTTTTGTCAAAGATGTGGAGGATCTGAAAAATCTACC
AATCAAATATTTTGCCCCAGAAATTTTAAGAAATGAAAGATTCACCACCA
AGGCTGACGTGTGGTCATTTGGAGCGATTCTCATCAAGATTATTACCCAG
AGAGCCCCATTTCCTGGTAAACCCAAATTAGAAATTAAAACTGGATTCGA
AAACAATGAAATTGGTGATTACGATTGCTCAGCACTTCAATGTGGAGAAG
GATTAAGGAGAATCATCATGTCATGCTTGAAAATAGATCAAGGAACTCGT
TCAACTGTGGAGAGCTTATTAAATGAAGATTTTATCAAACAATAATCTTA
AATTTTGATTTACTATCAAACATTTTATAGTTTTATAGAATAATTATATT
AAATAAATAATTACATCAAACTTCTAAAATGTATTGTTGAACACTGATT
back to top

protein sequence of SMED30002638-orf-1

>SMED30002638-orf-1 ID=SMED30002638-orf-1|Name=SMED30002638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=729bp
MNIIPILFSLLLLDFYSGETPRMTCRNLKPFKTADYQCDNFSNVCIKKGD
QDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTT
KEKLIKITNQLKFSEQGKNIIYILLWIIIIINFLMFFLLLLEIRFKIITK
LIDHRKRKGSNQYKILESRKTMFLKDYFMDTKEVNKKFELQDYKFERKIE
SKLIEILNILNTSTNLSKLKEISKFRMNGNTIKIKIEKKDNCVVIKRRIC
HKLYLVKSEDYKILKLKYNGKTLEDNQYFSTFNIPTDEEILCEKDLSINS
SNILVVKPAGNIQLPDLIQIQKHQTISDLKKLTPGISDAENLRIFAEIKD
GNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLTISSIFDEGNSAV
IDYDNTDTILAMKMSLCTPLNCCLEDFVLIQKGTLSEEAFAFEYDFTGND
PVKYCRISKLDAIEIGDCVNDGDHSDLFSAKMRVTNKKLLIKKYFHTTQK
KFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLK
SFIKKNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLKESKDL
KLSNFNLSKYKTLNEPSSVFVKDVEDLKNLPIKYFAPEILRNERFTTKAD
VWSFGAILIKIITQRAPFPGKPKLEIKTGFENNEIGDYDCSALQCGEGLR
RIIMSCLKIDQGTRSTVESLLNEDFIKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation