SCP domain-containing protein

Overview
NameSCP domain-containing protein
Smed IDSMED30002634
Length (bp)835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCP domain-containing protein (SMED30002634) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCP domain-containing protein (SMED30002634) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002634

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30002634h1SMcG0014094 dd_210dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Smed sexual biotypeSMED30002634h1SMcG0014094 Contig25598uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002634h1SMcG0014094 Contig25598newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30002634h1SMcG0014094 dd_5744dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002634h1SMcG0014094 dd_Smed_v4_210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002634h1SMcG0014094 dd_Smed_v4_210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002634h1SMcG0014094 dd_Smed_v4_210_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002634h1SMcG0014094 Contig26329newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002634h1SMcG0014094 Contig26329uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002634h1SMcG0014094 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002634h1SMcG0014094 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_210_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002634h1SMcG0014094 dd_Smed_v4_210_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002634h1SMcG0014094 dd_Smed_v4_210_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_5744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002634h1SMcG0014094 dd_Smed_v4_5744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002634h1SMcG0014094 dd_Smed_v4_5744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002634h1SMcG0014094 dd_Smed_v6_5744_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002634h1SMcG0014094 dd_Smed_v4_210_1_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 134.806 bits (338), Expect = 7.136e-38
Identity = 74/198 (37.37%), Postives = 107/198 (54.04%), Query Frame = 3
Query:   51 CLLATLAVGTP----PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALD---KFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            CL+AT +   P    P + +  ++AHN+ R ++        P AA+M  M+WD  LA  ++ WA +C   H+   D++      F +VG+N++ G       +  +  WY+E + Y ++   CS VCGHYTQ+ WA S+ VGCA   C    G S A   +F+CNYGPAGNF +  PY  G +CS C K   C  NLC
Sbjct:   16 CLVATTSSKIPSITDPHFIDNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTA---IFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 135.191 bits (339), Expect = 7.223e-38
Identity = 74/198 (37.37%), Postives = 107/198 (54.04%), Query Frame = 3
Query:   51 CLLATLAVGTP----PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALD---KFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            CL+AT +   P    P + +  ++AHN+ R ++        P AA+M  M+WD  LA  ++ WA +C   H+   D++      F +VG+N++ G       +  +  WY+E + Y ++   CS VCGHYTQ+ WA S+ VGCA   C    G S A   +F+CNYGPAGNF +  PY  G +CS C K   C  NLC
Sbjct:   16 CLVATTSSKIPSITDPHFIDNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTA---IFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: GLIPR1 (GLI pathogenesis related 1 [Source:HGNC Symbol;Acc:HGNC:17001])

HSP 1 Score: 132.88 bits (333), Expect = 9.091e-37
Identity = 69/178 (38.76%), Postives = 98/178 (55.06%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY---DDRALDKFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTG-GSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 614
            ++ HN  R ++       +P A++M+ M WD ALA  ++ WA  C   H+T      +    F  +G+N++ GS    +    +  WYDE +DY ++ + C  VCGHYTQV WA SY VGCA   C + +G  + + G  FICNYGP GN+    PY+ GA CS CP    C +NLC 
Sbjct:   38 VRIHNKFRSEV-------KPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNY-PTWPYKRGATCSACPNNDKCLDNLCV 207          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 127.102 bits (318), Expect = 6.319e-33
Identity = 82/210 (39.05%), Postives = 105/210 (50.00%), Query Frame = 3
Query:   75 GTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDDPKGTLEFDE 650
              P E KE +L  HN LR Q+       QP A+NM  M WDD L   +  WA +CI  H           + +GQN+ A    Y+     VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  +GCA   C++ T  G  +     F+CNY P GN+  EAPY+ G  CS+CP   G SC+NNLC  +      E DE
Sbjct:   50 AIPREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHG-----PTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYRETYTPKPETDE 247          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 126.331 bits (316), Expect = 7.829e-33
Identity = 79/201 (39.30%), Postives = 103/201 (51.24%), Query Frame = 3
Query:   75 GTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
              P E KE +L  HN LR Q+       QP A+NM  M WDD L   +  WA +CI  H           + +GQN+ A    Y+     VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  +GCA   C++ T  G  +     F+CNY P GN+  EAPY+ G  CS+CP   G SC+NNLC  ++
Sbjct:   50 AIPREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHG-----PTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREE 238          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 97.8265 bits (242), Expect = 1.939e-24
Identity = 67/212 (31.60%), Postives = 99/212 (46.70%), Query Frame = 3
Query:   54 LLATLAVGTPPEY----KEFLLKAHNDLRRQIALG----KTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMF---AGSNYKEVVQ-------GWYDEYKDYTYEGKGCSAV-----CGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCK--NNLCA 614
            LL  L  G   ++    +  +L  HN LR +IA G    K   +PAA++M++M WD  +A  ++ +A KC  GH             +G+N++     +    + Q        W  E++DY +     S        GH TQ+AWAK+  +GC   NC + T G        +C Y P GN+ ++  Y  G  CSKCP GTSC+    LCA
Sbjct:    7 LLTALCAGAYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAG--------LGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKV--TVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 93.9745 bits (232), Expect = 5.884e-23
Identity = 64/212 (30.19%), Postives = 103/212 (48.58%), Query Frame = 3
Query:   45 ISCLLATLAVGTPPEYKE----FLLKAHNDLRRQIALGK----TPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQG------------WYDEYKDYTYEGKGCS-----AVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNN 605
            + CLL      T  E+ E    ++L  HN LR QIALGK       +P+A+NM++++WD  L   +++++  C  GH     RA      +G+NM+  ++   V Q             W  E++ + + G   +     +  GH TQ+AWA +  +GC    C      SF   ++ +C Y PAGN+     Y+ G  CS CP GT+C+++
Sbjct:    7 LICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSA--SRA-----NIGENMYWWTS-PVVTQTDAELLGNRSANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCSSD---SFGTQYVVVCLYSPAGNYIGMDIYKSGETCSNCPDGTNCESS 207          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 93.5893 bits (231), Expect = 6.426e-23
Identity = 62/205 (30.24%), Postives = 95/205 (46.34%), Query Frame = 3
Query:   54 LLATLAVGTPPEY----KEFLLKAHNDLRRQIALG----KTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMF---AGSNYKEVVQ-------GWYDEYKDYTYEGKGCSAV-----CGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCK 599
            LL  L  G   ++    +  +L  HN LR +IA G    +   + AA++M++M W  +LA  S+ +A +C  GH           + VG+N++          + Q        W  E++DY +     +        GH TQ+AWAK+  +GC   NC   T G        +C+Y P GN+ ++  Y  G  CSKCP GTSC+
Sbjct:    7 LLTVLCAGAYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHS--------NMIGVGENLYWYWTSGTITNIDQFGAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVA--VVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSCE 201          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-12 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N5N3])

HSP 1 Score: 92.4337 bits (228), Expect = 1.797e-22
Identity = 63/213 (29.58%), Postives = 92/213 (43.19%), Query Frame = 3
Query:   27 LLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGK----TPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD-------------TYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAV-----CGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCK 599
            L L  +  C  A  +       +  ++KAHNDLR  IALG        +P AANM ++ WD  +A  ++++A  C   H              +    +LDKF     N             W  E++DY +E     A       GH TQ+AWA++  +GC   NC + +  +  Y    +C Y  AGN  D   Y+ G  CS CP G+ C+
Sbjct:    5 LYLIAIFGCATAQFS----STAQTAIVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDHSGTEYGENLYWSWSSSAPTSLDKFGVAASN------------SWEKEFQDYGWESTYMDADLFDSGIGHATQMAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMMDSDIYQSGDTCSFCPSGSKCE 201          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-2 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20603])

HSP 1 Score: 91.2781 bits (225), Expect = 4.809e-22
Identity = 61/199 (30.65%), Postives = 95/199 (47.74%), Query Frame = 3
Query:   54 LLATLAVGTPPEY----KEFLLKAHNDLRRQIALG----KTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMF---VGQNMFAGSNYKEVVQG-WYDEYKDYTYEGKGCS-----AVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCK 599
            L+  LAVG   ++    +  ++ AHN LR +IA G    K   +    N+++M WD A+A  ++ +A  C  GH    D  L + ++      ++   + Y       W  E++DY ++    +        GH TQ+AWAKS  +GC   +C   + G        +C Y P GNF ++  Y  GA CS CP GTSC+
Sbjct:    6 LVVALAVGCSADFGSSGQNGIINAHNTLRSKIAKGTYVAKGTQKSPGTNLLKMKWDSAVAASAQNYANGCPTGHS--GDAGLGENLYWYWTSGSLGDLNQYGSAASASWEKEFQDYGWKSNLMTIDLFNTGIGHATQMAWAKSNLIGCGVKDCGRDSNGLNKV--TVVCQYKPQGNFINQYIYVSGATCSGCPSGTSCE 200          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 123.25 bits (308), Expect = 2.206e-32
Identity = 74/214 (34.58%), Postives = 112/214 (52.34%), Query Frame = 3
Query:   27 LLLCGVISCLLA------TLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFA----------GSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVG-AACSKC-PKGTSCKNNLCA 614
            L    +ISC +A       +A G   E +  +L+ HN LR+ +A G+ P QP A NM E+VWDD LA ++++WA  C   HD +  R +++F  +GQN+              ++   +Q W++E + Y++ G   S   GHY+Q+ W ++  VGC     K+ +     Y  L++CNYGP GN     PYEVG  +CS    K +S    LCA
Sbjct:    9 LTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPH--RTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTS----KYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPSSRYQGLCA 214          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 69.707 bits (169), Expect = 1.178e-13
Identity = 56/187 (29.95%), Postives = 83/187 (44.39%), Query Frame = 3
Query:   99 FLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQN---MFAGSN-----YKEVVQGWYDEYKDYT------YEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKG-TSCKNNLCA 614
             +L+ HN+ R  IA G     P+A  M  M WD  LA  +   A +C   HD  + R  + + + GQN   +F  S       ++ +  W+DE +D T      Y+ +G  A+ GH+T +   ++  VGCA       T  +     L  CNY      N+   Y  G A S+C  G  S   NLC+
Sbjct:   63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHD--ECRNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAI-GHFTTMVNERNNRVGCAI---ARFTDANNVQATLLACNYAVTNVVNNPV-YRAGTAASECTTGRNSNYPNLCS 242          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 69.707 bits (169), Expect = 2.002e-13
Identity = 59/204 (28.92%), Postives = 85/204 (41.67%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNM---FAGSNY-------KEVVQGWYDEYKDYT------YEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKN--NLCALDDPKGTLEFDE 650
            ++ LL  HN  R +IA G      +AA+M  + WD  L   +   A +C   HD    R   +F F GQN+   + G  +       K  V  W+ E++D        Y         GH+T +   +   VGCA V   E     F +  +  CNY     FN E  Y+ G A SKCP+    +   +LC   D    L+ +E
Sbjct:   96 RQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC--RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQF--MLTCNYDYNNIFN-EPIYQSGPAGSKCPQHRISEKFPSLCDWRDANNDLDSEE 294          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG17974 (gene:FBgn0034624 transcript:FBtr0071611)

HSP 1 Score: 65.0846 bits (157), Expect = 4.183e-12
Identity = 58/187 (31.02%), Postives = 82/187 (43.85%), Query Frame = 3
Query:   87 EYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFA-----------GSNYKEVVQGWYDEYKDY------TYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAP-YEVGAACSKCPKGTS 593
             +K   L AHN  R  +ALGK P    AA M  MVWDD L   S      C   HD  D     ++   GQN+ A            S  +E +  W++E+         +++        GH+ +++  K++AVGC+ +        S  Y + FICNY  A  +   AP YE G A S+C  G S
Sbjct:   61 RHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHD--DCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFAVGCSIMRFTRPDYPS-VYIYNFICNY--ASLYALGAPVYETGRAASRCTTGKS 242          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG42780 (gene:FBgn0261848 transcript:FBtr0339817)

HSP 1 Score: 58.5362 bits (140), Expect = 7.333e-10
Identity = 57/189 (30.16%), Postives = 76/189 (40.21%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFA-----------------GSNYKEVVQGWYDEYKDYTYEGKGCSA-----VCGHYTQVAWAKSYAVGCAAV--NCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKG 587
            K  L+KAHN +R++ A GK   +  A  M +M W+  L   +   A  C+ GHD   +   +KF   GQN+FA                    ++  VQ W  E KD T E    +      V GH T +   KS AVGC  V  N  E    + A      CNY       +    E   A  +C KG
Sbjct:   62 KNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNT--EKFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRYNLA------CNYAYTNVIGERVYEECAKAGIECAKG 242          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 127.872 bits (320), Expect = 3.730e-35
Identity = 74/182 (40.66%), Postives = 95/182 (52.20%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY---DDRALDKFMFVGQNMFAGSNY-----KEVVQGWYDEYKDYTYEGKGCS--AVCGHYTQVAWAKSYAVGCAAVNCKE---KTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            ++ HN  R  ++       P AANM  M WD ALA  +  WA  C+  H+ +     R    F  VG+N++AG+ Y     K  V  W +E KDY Y    C+   VCGHYTQV WA SY VGCA   C     +T  S   G +F+CNY  AGNF   +PY+ GA+CS C     C+ NLC
Sbjct:   36 VREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLC 210          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: glipr1a (GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-GENE-110309-2])

HSP 1 Score: 127.487 bits (319), Expect = 9.597e-35
Identity = 75/186 (40.32%), Postives = 96/186 (51.61%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY---DDRALDKFMFVGQNMFAGSNY-----KEVVQGWYDEYKDYTYEGKGCS--AVCGHYTQVAWAKSYAVGCAAVNCKE---KTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDD 623
            ++ HN  R  ++       P AANM  M WD ALA  +  WA  C+  H+ +     R    F  VG+N++AG+ Y     K  V  W +E KDY Y    C+   VCGHYTQV WA SY VGCA   C     +T  S   G +F+CNY  AGNF   +PY+ GA+CS C     C+ NLC   D
Sbjct:   44 VREHNQNRSSVS-------PTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTFTTVGENIWAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGHYTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATAGNFAGRSPYKQGASCSGCGGSDKCERNLCRNTD 222          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 116.701 bits (291), Expect = 5.176e-31
Identity = 68/178 (38.20%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  102 LLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNM-FAGSNYKEV---VQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKE--KTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            LL  HN +R Q+        P AANM  MVWD+ LA  +E WA +CI  H  +          +GQN+      YK +   V+ WYDE   ++Y  +   +VC HYTQ+ WA S  +GCA   C +    G  +    L +CNY   GN+  EAPY++G  CS CP   G SC  N C
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHF-----LQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 116.701 bits (291), Expect = 5.176e-31
Identity = 68/178 (38.20%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  102 LLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNM-FAGSNYKEV---VQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKE--KTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            LL  HN +R Q+        P AANM  MVWD+ LA  +E WA +CI  H  +          +GQN+      YK +   V+ WYDE   ++Y  +   +VC HYTQ+ WA S  +GCA   C +    G  +    L +CNY   GN+  EAPY++G  CS CP   G SC  N C
Sbjct:   69 LLDYHNRVRSQVF-------PPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHF-----LQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSYPSRCSGSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQC 234          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 116.701 bits (291), Expect = 7.052e-31
Identity = 72/188 (38.30%), Postives = 98/188 (52.13%), Query Frame = 3
Query:  102 LLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS-NYKEVVQ---GWYDEYKDYTYE-GKGCSA---------VCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            +L  HN +R ++        P A+NM  MVWDD LA  +E+WA  CI  H     R L +F+  GQN+   +  Y+ ++Q    W+DE KDY++   + C+          +C HYTQ+ WA S  VGCA   C      G  +      +CNY P GN+  EAPY+VG  CS CP   G SC NN+C
Sbjct:   72 ILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHG---PRNLLRFL--GQNLSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 119.783 bits (299), Expect = 2.893e-30
Identity = 78/195 (40.00%), Postives = 101/195 (51.79%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCSA-VCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
            KE +++ HN LR Q+        P+A+NM  M WDD L   +E WA +CI  H      AL   M +GQN+      Y++    VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  VGCA   CK     G  +      +CNY P GN+  EAPY+ G  CS+CP   G +C+NNLC   D
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG---PTAL--LMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYKGD 239          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 119.398 bits (298), Expect = 4.162e-30
Identity = 78/195 (40.00%), Postives = 101/195 (51.79%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
            KE +++ HN LR Q+        P+A+NM  M WDD L   +E WA +CI  H      AL   M +GQN+      Y++    VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  VGCA   CK     G  +      +CNY P GN+  EAPY+ G  CS+CP   G +C+NNLC   D
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG---PTAL--LMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLCYKGD 239          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 118.627 bits (296), Expect = 5.875e-30
Identity = 77/191 (40.31%), Postives = 100/191 (52.36%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCSA-VCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            KE +++ HN LR Q+        P+A+NM  M WDD L   +E WA +CI  H      AL   M +GQN+      Y++    VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  VGCA   CK     G  +      +CNY P GN+  EAPY+ G  CS+CP   G +C+NNLC
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG---PTAL--LMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 110.923 bits (276), Expect = 1.604e-28
Identity = 69/194 (35.57%), Postives = 94/194 (48.45%), Query Frame = 3
Query:   84 PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS-NYKEVV---QGWYDEYKDYTYE----------GKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            P     LL  HN +R ++        P AANM  MVWD+ LA  +E WA +C      +D        ++GQN+   S  Y+ +V   +GWYDE + Y++            K   AVC HYTQ+ WA S  +GCA   C      G ++      +CNY   GN+  EAPY++G  CS CP   G  C NN+C
Sbjct:   60 PRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQC-----KWDHGPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 110.538 bits (275), Expect = 1.826e-28
Identity = 69/194 (35.57%), Postives = 94/194 (48.45%), Query Frame = 3
Query:   84 PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS-NYKEVV---QGWYDEYKDYTYE----------GKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            P     LL  HN +R ++        P AANM  MVWD+ LA  +E WA +C      +D        ++GQN+   S  Y+ +V   +GWYDE + Y++            K   AVC HYTQ+ WA S  +GCA   C      G ++      +CNY   GN+  EAPY++G  CS CP   G  C NN+C
Sbjct:   55 PRDMSALLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQC-----KWDHGPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 135.191 bits (339), Expect = 3.768e-38
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query:   57 LATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDR---ALDKFMFVGQNMFAG---SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            L  +   T P++ +  L  HN+LRR++       QP AA+M ++ WD  LA  ++ W  +C   H+    +    L+ + F+G+N++ G   +  ++VV  WY+E K + ++   CS +CGHYTQV WAK+  +GCA  NC    G  F+ G LF+CNY PAGNF    PY  G +CS C + T C+N+LC
Sbjct:   30 LPRVPTITDPKFIDAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKG--FSAG-LFVCNYSPAGNFIGFRPYTRGDSCSMCGQKT-CENSLC 209          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1l3 (GLI pathogenesis-related 1 like 3 [Source:MGI Symbol;Acc:MGI:3620621])

HSP 1 Score: 133.265 bits (334), Expect = 1.990e-37
Identity = 69/182 (37.91%), Postives = 103/182 (56.59%), Query Frame = 3
Query:   84 PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRA---LDKFMFVGQNMFAG---SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            P++ +  L  HN+LRR++       QP AA+M +++WD  LA  ++ W  +C  GH+    +    L  + F+G+N++ G   +  ++VV  WY+E  DY +    CS +C +YTQV WAK++ +GCA  NC   T  S     LF+CNY P GNF D  PY  G  CS C +   C+N+LC
Sbjct:   39 PKFIDAFLNIHNELRRKV-------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFIGENIYLGEIETQPEDVVNNWYNENTDYNFVDNTCSKICRNYTQVFWAKTFKIGCAVSNCPNLTRYS---AGLFVCNYSPTGNFLDFRPYRKGDPCSMCGQ-RKCENSLC 209          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 124.79 bits (312), Expect = 4.180e-34
Identity = 65/185 (35.14%), Postives = 102/185 (55.14%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFA----GSNYKEVVQGWYDEYKDYTYEGKGC--SAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPK 629
            K+ ++  HN  R Q++       P A++M++M WDD LA  ++ +A KC+ GH+    R        G+N+FA    G +    V  W++E++ Y +    C  + +CGHYTQV W+K+  +GC +  C+   G   A   L +CNY P GN     PY+ G  CS+CP G SC+N+LC  ++P+
Sbjct:   35 KQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRR-------GENLFAITDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCGAENPE 205          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 122.865 bits (307), Expect = 2.903e-33
Identity = 66/174 (37.93%), Postives = 89/174 (51.15%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD-TYDDRALDKFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            ++ HN LR +++       P A NM+ M WD  LA  ++ W   C   H+     R    F  +G+N++ GS    +    +  WY+E K Y +  + C  VCGHYTQV WA SY +GCA   C             FIC+YGPAGN+    PY+ GA CS CPK   C N+LC
Sbjct:   38 VQVHNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGAN--------FICDYGPAGNY-PTWPYKQGATCSDCPKDDKCLNSLC 195          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 122.865 bits (307), Expect = 2.903e-33
Identity = 66/174 (37.93%), Postives = 89/174 (51.15%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD-TYDDRALDKFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            ++ HN LR +++       P A NM+ M WD  LA  ++ W   C   H+     R    F  +G+N++ GS    +    +  WY+E K Y +  + C  VCGHYTQV WA SY +GCA   C             FIC+YGPAGN+    PY+ GA CS CPK   C N+LC
Sbjct:   38 VQVHNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGAN--------FICDYGPAGNY-PTWPYKQGATCSDCPKDDKCLNSLC 195          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9DAG6|GPRL1_MOUSE (GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=Glipr1l1 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.636e-37
Identity = 73/191 (38.22%), Postives = 110/191 (57.59%), Query Frame = 3
Query:   57 LATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDR---ALDKFMFVGQNMFAG---SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            L  +   T P++ +  L  HN+LRR++       QP AA+M ++ WD  LA  ++ W  +C   H+    +    L+ + F+G+N++ G   +  ++VV  WY+E K + ++   CS +CGHYTQV WAK+  +GCA  NC    G  F+ G LF+CNY PAGNF    PY  G +CS C + T C+N+LC
Sbjct:   30 LPRVPTITDPKFIDAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFDFNTCSEMCGHYTQVVWAKTVKIGCAVSNCPNLKG--FSAG-LFVCNYSPAGNFIGFRPYTRGDSCSMCGQKT-CENSLC 209          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6UWM5|GPRL1_HUMAN (GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1L1 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 3.469e-37
Identity = 74/198 (37.37%), Postives = 107/198 (54.04%), Query Frame = 3
Query:   51 CLLATLAVGTP----PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALD---KFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
            CL+AT +   P    P + +  ++AHN+ R ++        P AA+M  M+WD  LA  ++ WA +C   H+   D++      F +VG+N++ G       +  +  WY+E + Y ++   CS VCGHYTQ+ WA S+ VGCA   C    G S A   +F+CNYGPAGNF +  PY  G +CS C K   C  NLC
Sbjct:   16 CLVATTSSKIPSITDPHFIDNCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTA---IFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q32LB5|GPRL1_BOVIN (GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLIPR1L1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.127e-36
Identity = 79/214 (36.92%), Postives = 112/214 (52.34%), Query Frame = 3
Query:   15 FIMKLLLCGVISCLLATLAVGTPPE--------YKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALD---KFMFVGQNMFAG----SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC 611
             I++  L  + +  L  +A  +PP+        + E  L+ HN+ R  ++       P AA+M  M WD+ALA  +E WA KC   H++   ++      F + G+N++ G    S  K  +  WYDE K Y +  + CS VCGHYTQV WA SY VGCA   C        A   L +CNY PAGN+ + +PY  G  CS C +G +C+NNLC
Sbjct:    1 MILRKKLSYLWTLGLCLVASKSPPKAPSITNDRFIEECLRLHNEARTNVS-------PPAADMKYMSWDEALAKTAEAWAKKCKFIHNSCSSKSFKCHPTFQYAGENLWLGPLTISAAKFAINMWYDERKFYDFNTRSCSQVCGHYTQVVWAYSYKVGCAVAVCPNLGSPDSA---LLVCNYAPAGNYPNMSPYTNGTPCSMC-QGDTCENNLC 203          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P48060|GLIP1_HUMAN (Glioma pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR1 PE=1 SV=3)

HSP 1 Score: 132.88 bits (333), Expect = 4.366e-36
Identity = 69/178 (38.76%), Postives = 98/178 (55.06%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY---DDRALDKFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTG-GSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 614
            ++ HN  R ++       +P A++M+ M WD ALA  ++ WA  C   H+T      +    F  +G+N++ GS    +    +  WYDE +DY ++ + C  VCGHYTQV WA SY VGCA   C + +G  + + G  FICNYGP GN+    PY+ GA CS CP    C +NLC 
Sbjct:   38 VRIHNKFRSEV-------KPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNY-PTWPYKRGATCSACPNNDKCLDNLCV 207          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2XXQ0|CRVP_ERYPO (Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus OX=338838 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.049e-34
Identity = 69/185 (37.30%), Postives = 101/185 (54.59%), Query Frame = 3
Query:   84 PEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYK---EVVQGWYDEYKDYTYEGKGC---SAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDE--APYEVGAACSKCPKGTSCKNNLCA 614
            PE +  ++  HN  RR ++       P A NM++M W    A  +E WA +C+  H    +R LD     G+N++  S ++   EV+Q WYDEY+++ + G G    +A+ GHYTQ+ W KSY VGCA  NC      S+ Y + ++C Y PAGNF  +   PY  G  C+ CP  ++C N LC 
Sbjct:   30 PEIQNLIVDTHNSYRRSVS-------PTATNMLKMEWYPEAAANAERWAYQCVYDHSQKYERVLDGIQ-CGENIYMYSEFRPWTEVMQSWYDEYRNFIF-GVGAHPANALIGHYTQIVWYKSYRVGCAIANCP-----SYPYNYFYVCQYCPAGNFGGQTATPYNSGTTCADCP--SACDNGLCT 198          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1C9ZZV5 (SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 6.748e-142
Identity = 191/212 (90.09%), Postives = 200/212 (94.34%), Query Frame = 3
Query:   18 IMKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 653
            +M+ LLCG+IS +   L   TPPEYK+FLLKAHNDLRR IALGKTPNQPAAANMIEMVWDDALAGK+EEWAGKCIAGHDTYDDR LDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAW+KSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCAL+DP  +LEFDEE
Sbjct:    6 VMQFLLCGIISFISIALIFCTPPEYKDFLLKAHNDLRRDIALGKTPNQPAAANMIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWSKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALNDPNASLEFDEE 217          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A172RVP6 (TPX-1 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TPX-1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.147e-48
Identity = 78/146 (53.42%), Postives = 103/146 (70.55%), Query Frame = 3
Query:  177 MIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 614
            M+EMVW D LA  +E  A +C+  HD  +DRA   F   GQN++AG   KE ++ W+DE KDY+Y   GC+ VCGHYTQVAWAKSYAVGCA+V+C+ + G  F Y +  +CNYGPAGN+  E PY+ G+ACS CP G++C + LC+
Sbjct:    1 MMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNG--FQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 144          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A183B220 (SCP domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13254 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.400e-42
Identity = 78/190 (41.05%), Postives = 101/190 (53.16%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAA--CSKCPK 584
            MK     ++S  LA LAV    + K  LL+ HN  R +I     P QP A +M  + W D L+ K+++W+ +CI GHD  DDR L +F +VGQN     + +     W+DEYK Y +    CS VCGHYTQ+ WA +  VGC    C   T  SF YG+  +CNYG  GN N   PY  G    C K  K
Sbjct:    1 MKSFYLTILSLALAGLAVSITVDEKNLLLRLHNAARTRILNCSVPGQPPARSMQMLKWHDGLSKKAQQWSDRCITGHDKNDDRKLPEFWWVGQNFAGFPSVEPGFNAWFDEYKQYNFMANTCSGVCGHYTQLVWADTEYVGCGVTKC---TKPSFPYGYSIVCNYGLGGNMNGARPYTAGTLGDCRKTSK 187          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1I8HU24 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002706g1 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.324e-41
Identity = 81/188 (43.09%), Postives = 100/188 (53.19%), Query Frame = 3
Query:   15 FIMKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG--SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACS 572
            F + LL+    +C  A L   +  +   FL K HN LR Q A G T  QP+A+NM E+VWDD L   +  W  KC  GHD   DR L  F +VGQN   G   ++   V+ W++EYK Y Y  K CS VCGHYTQV WAK+  VGC    C         Y +  +CNY   GNFN+E PY  G   S
Sbjct:    4 FALVLLVAMATACCEARLLRLSQSQKMAFL-KEHNRLRAQTAKGHTRGQPSASNMAELVWDDRLMRSANRWVRKCRVGHDRARDRRLPGFSWVGQNWAGGHSRDFTRYVRMWFNEYKYYNYYRKSCSKVCGHYTQVVWAKTTRVGCGVARCGR-------YPYHVVCNYATGGNFNNEFPYARGRPAS 183          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1I8HQH6 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027161g1 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.908e-41
Identity = 82/191 (42.93%), Postives = 107/191 (56.02%), Query Frame = 3
Query:   15 FIMKLLLCGVISCLLATLAVGT-PPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG--SNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKC 578
            F+  L+   V +  +A+  + T   E K+ +L AHN LR + A+G   NQP AANM  + WDD L   +  W  +C+AGHD+  DRAL  + +VGQN   G   N+   V  W+ EYKDYT+  K CSAVCGHYTQV WAK+  VGC    C         Y +  +CNY   GN+N E PY  G   S+C
Sbjct:    3 FVFALIWALVATSTMASGELVTLTAEQKQAILDAHNVLRARTAMGLVGNQPKAANMPALEWDDRLMDSANNWVKQCVAGHDSGSDRALTGYSWVGQNWAGGYSGNFSYYVDLWFREYKDYTFATKSCSAVCGHYTQVVWAKTTLVGCGVSRCSN-------YPYTIVCNYATGGNYNGEYPYVSGDDASQC 186          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042591.1 (GLI pathogenesis related 1 [Source:NCBI gene;Acc:111193446])

HSP 1 Score: 132.88 bits (333), Expect = 4.801e-37
Identity = 72/181 (39.78%), Postives = 99/181 (54.70%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY---DDRALDKFMFVGQNMFAGSNY--KEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCK---EKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDD 623
            +  HN  R  +       QPAA+NM  M WD+ LA  +  WA KC+  H+T+   + R    F  VG+N++AG+++  +  ++ W DE KDY+Y    C  VCGHYTQV WA +Y VGCA   C    E+T       ++F+CNYG AGN  ++ PY  G  C  C  G  C+N LC   D
Sbjct:   35 VTEHNQHRANV-------QPAASNMRYMTWDEGLAVTARAWARKCLFIHNTHLKEEGRVHPVFSSVGENLWAGTHFSVQGAIKSWADEVKDYSYSTMTCKQVCGHYTQVVWANTYKVGCAVQYCPNGVEQTPFYPRQAFIFVCNYGTAGNVFNQKPYRTGPECRDC-TGELCENRLCRNTD 207          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054643.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 127.102 bits (318), Expect = 7.632e-35
Identity = 81/219 (36.99%), Postives = 111/219 (50.68%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD---TYDDRALDKFMFVGQNMFAGSNY-----KEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGG-----SFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLC---ALDDPK 629
            + +L  G    L   L   T P++    ++AHN  R + +       P AANM  M WDDALA  +  WA  C A H+    +  +A   F  VG+N++ GS Y     +  +Q W  E  DYT+  + C+ VCGHYTQ+ WA SY +GCA   C   +GG     +     +F+C+YG AGN     PY VG ACS C K   C++ LC     D+PK
Sbjct:   11 LTVLFSGPRGVLALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCARVCGHYTQLMWATSYKLGCAVHVC---SGGIDNFSTHPQSTIFVCDYGDAGNMFGFPPYIVGLACSSCGK-EKCQDKLCTDPTRDEPK 218          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053689.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 126.331 bits (316), Expect = 1.053e-34
Identity = 79/213 (37.09%), Postives = 108/213 (50.70%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD---TYDDRALDKFMFVGQNMFAGSNY-----KEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGG-----SFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALD 620
            + +L  G    L   L   T P++    ++AHN  R + +       P AANM  M WDDALA  +  WA  C A H+    +  +A   F  VG+N++ GS Y     +  +Q W  E  DYT+  + C+ VCGHYTQ+ WA SY +GCA   C   +GG     +     +F+C+YG AGN     PY VG ACS C K   C++ LC  D
Sbjct:   11 LTVLFSGPRGVLALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCARVCGHYTQLMWATSYKLGCAVHVC---SGGIDNFSTHPQSTIFVCDYGDAGNMFGFPPYIVGLACSSCGK-EKCQDKLCRYD 212          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030308.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 125.946 bits (315), Expect = 1.082e-34
Identity = 78/211 (36.97%), Postives = 108/211 (51.18%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHD---TYDDRALDKFMFVGQNMFAGSNY-----KEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGG-----SFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 614
            + +L  G    L   L   T P++    ++AHN  R + +       P AANM  M WDDALA  +  WA  C A H+    +  +A   F  VG+N++ GS Y     +  +Q W  E  DYT+  + C+ VCGHYTQ+ WA SY +GCA   C   +GG     +     +F+C+YG AGN     PY VG ACS C K   C++ LC+
Sbjct:   11 LTVLFSGPRGVLALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHRNRSCARVCGHYTQLMWATSYKLGCAVHVC---SGGIDNFSTHPQSTIFVCDYGDAGNMFGFPPYIVGLACSSCGK-EKCQDKLCS 210          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 119.783 bits (299), Expect = 6.235e-32
Identity = 69/205 (33.66%), Postives = 106/205 (51.71%), Query Frame = 3
Query:   30 LLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS---NYKEVVQGWYDEYKDYTYEGKGCSA--VCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGT-SCKNNLCALDDP 626
            L+C  +  LLA      P E ++ ++  HN  R  +       +P AA+MI M W   LA  ++E+A KCI  H+       D    +G+N+F  +   + ++ +  W+ E+K Y+Y+   C+   +CGHYTQ+ WAK+  VGC +  C+      F    L +CNY P GN+  + PY+VG  CSKCP    +C +  C   DP
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWEHNP------DSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQACDSTDP 200          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 8.566e-29
Identity = 76/204 (37.25%), Postives = 98/204 (48.04%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNM--FAGSNYKEV--VQGWYDEYKDYTY-EGKGCSA---------VCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDDPKGTLEFDE 650
            +  L + HN LR  +        P AA+M  M WD  LAG +E WA +C  GH   D   LD    +GQN+  + GS       VQ W+DE + Y Y E K CS          +C HYTQ+ WA+S  VGCA   C + +     + Y    +CNY P GN+  EAPY  G  CS+CP   G SC+  LC     +     DE
Sbjct:    6 RRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQ--LDA---IGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLCYQVTIRRPQRLDE 197          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 105.145 bits (261), Expect = 2.227e-27
Identity = 61/186 (32.80%), Postives = 94/186 (50.54%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS---NYKEVVQGWYDEYKDYTYE---GKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEA--PYEVGAACSKCPKGTSCKNNLCALDDP 626
            + F++  HNDLRR +        P+A NM++M+W       +  WA  C  GH   D R        G+N+F  S    +   ++ WY+E     ++   G   +   GHYTQ+ W  S+ +GCA   C +  G +    +L++C+Y P GN N     PY++G +C+ CPK  +C NNLC  D+P
Sbjct:   44 QTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSP-DARRKTTQWTCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVA---KYLYVCHYCPMGNLNTRINRPYDLGTSCASCPK--NCVNNLC--DNP 214          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 9.142e-24
Identity = 62/181 (34.25%), Postives = 86/181 (47.51%), Query Frame = 3
Query:  114 HNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEV-VQGWYDEYKDYTYE-GKGCS---------AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            HN LR ++        P ++NM  M W   L  ++  + G+C+        + +    F+GQ  +         VQ WYDE KDY Y   + C+         AVC HYTQ+ WA +  VGCA   C      G  +      +CNY P GN+   +PY+ G ACS+CP   G SC+NNLC
Sbjct:    3 HNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCLR-----LMQPMAMIHFLGQPHWLSHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 65.855 bits (159), Expect = 1.035e-13
Identity = 44/123 (35.77%), Postives = 66/123 (53.66%), Query Frame = 3
Query:  294 GQNMFAGS---NYKEVVQGWYDEYKDYTYE-GKGCSAV--CGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEA--PYEVGAACSKCPKGTSCKNNLCALDDPKGTL 638
            G+N+F  +   ++++ V  WY+E +   +  GKG +A    GHYTQV W  S+ +GCA   C E       Y ++++C+Y PAGN N     PY  G+ C  CP    C+N+LC+   P   L
Sbjct:    2 GENIFLATAPLSWQDAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAI-----YKYVYVCHYCPAGNLNTRLSRPYNEGSPCRSCPN--DCENDLCSESCPYRNL 117          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000359.1 (pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene:ENSPMAG00000000319.1 transcript:ENSPMAT00000000359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 7.076e-13
Identity = 41/114 (35.96%), Postives = 61/114 (53.51%), Query Frame = 3
Query:  294 GQNMFAGS---NYKEVVQGWYDEYK--DYTYEGKGCSAVCGHYTQ-VAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEA--PYEVGAACSKCPKGTSCKNNLC 611
            G+N++ G+    +K V+  WY+E     + Y+  G  A   HYTQ + W  S+ +GC+   C        A  + ++C+Y PAGN N     PY+ G+AC+ CPK  SC N LC
Sbjct:    4 GENLYIGNAPFTWKYVIGEWYNEVTAPGFVYDKAGQGAGVEHYTQQLVWYSSFQIGCSVNFCAT------AKKYFYVCHYCPAGNLNTRVFRPYDKGSACTSCPK--SCVNKLC 109          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 65.855 bits (159), Expect = 1.318e-12
Identity = 47/173 (27.17%), Postives = 71/173 (41.04%), Query Frame = 3
Query:   42 VISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKC-IAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEV 557
            ++ CL+A  A  T P ++  +L  HN  R  + +   P          + W D LA  ++ +A +   +G  T+ D         G+N+  G      V  WY E   Y Y   G S   GH+TQV W  +  +GC    C         +    +C+Y P GN+  E   EV
Sbjct:    9 LLGCLVAVKAQTTFPNFESDVLNEHNKFR-ALHVDTAP----------LTWSDTLATYAQNYADQYDCSGVLTHSDGPY------GENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGT------TWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 60.4622 bits (145), Expect = 3.378e-11
Identity = 49/149 (32.89%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  102 LLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYD--DRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDE 542
            +L  HN  R   AL K  + PA      + W D LA  ++++A       D YD            G+N+  G +    V  WY+E  +Y +   G S+  GH+TQV W  +  VGC    C    GG  A+G   IC+Y PAGN+  E
Sbjct:  166 VLAEHNKKR---ALHK--DTPA------LSWSDTLASYAQDYA-------DNYDCSGTLTHSGGPYGENLALGYDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTC----GG--AWGDYVICSYDPAGNYEGE 290          
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 52.7582 bits (125), Expect = 1.438e-8
Identity = 39/121 (32.23%), Postives = 53/121 (43.80%), Query Frame = 3
Query:  186 MVWDDALAGKSEEWAGKCIAGHDTYD--DRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDE 542
            + W D LA  ++ +A       D+YD     +      G+N+  G      V  WY+E   Y Y   G S   GH+TQV W  +  VGC   +C    GG   +G   IC+Y  AGN   E
Sbjct:  213 LTWSDTLATYAQNYA-------DSYDCSGNLVHSGGPYGENLALGYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSC----GGE--WGDYIICSYKAAGNVIGE 320          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 58.151 bits (139), Expect = 9.109e-10
Identity = 45/175 (25.71%), Postives = 78/175 (44.57%), Query Frame = 3
Query:   21 MKLLL-CGVISCLLATL-AVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEV---VQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGN 530
            MK ++  G +   + TL A+    + +  +L  HN+ R            A  N   + W  ALA  ++ WAGK +A     +  + +   + G+N+   S++ ++   +Q WY+E + Y Y+  G +   GH+TQ+ W  +  VG   V   +   G   Y    +  Y P GN
Sbjct:  188 MKAIVGMGPVRMDIKTLGALPVDEDTRSRILDIHNNYR------------AMHNAAPLRWSAALAKDAQAWAGK-LAREGRLEHASREDRYYKGENICRMSHHFDIGDALQIWYNESESYQYDNPGFALTTGHFTQIVWRGTREVG---VGFAKSPDGRLTYA---VARYNPPGN 343          

HSP 2 Score: 55.8398 bits (133), Expect = 4.195e-9
Identity = 40/148 (27.03%), Postives = 65/148 (43.92%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMF--AGSNYKEV----VQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGN 530
            L AHN  R            A  N+  + W +++A ++++WA K         D++       G+N+F  +G+N+ +      + WY E + Y ++  G  +  GH+TQV W  S  +G A    K K G  F      +  Y P GN
Sbjct:    9 LDAHNRYR------------AMHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSG---QGENVFMSSGANFDDAGEAACESWYQEVERYNFQRGGHQSGTGHFTQVVWKSSEELGVA--RAKSKKGAVF-----VVARYSPGGN 134          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO41919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S310])

HSP 1 Score: 53.9138 bits (128), Expect = 4.470e-9
Identity = 44/164 (26.83%), Postives = 69/164 (42.07%), Query Frame = 3
Query:  105 LKAHNDLRRQIAL-GKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTY----DDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCS------AVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGA 563
            LKAHN  R   AL G  P          + WD++LA  + +W+   +A  +T+    +    +   ++ +   +     E V+ WYDE  DY +     S      A  GH+TQ+ W  +  +G A    K        Y    +  Y P GN+N E   +VG+
Sbjct:    5 LKAHNTKR---ALHGARP----------LTWDNSLARDAGKWS-LLLANSNTFKHAPNSDEGENLYYISKVSASPVTCVEAVKAWYDEVVDYPFNNPPESVFQVSGAPIGHFTQIVWKDTRRLGVAIARIKR----GLWYSTYIVARYSPPGNYNGEFTQQVGS 150          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO35383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP0])

HSP 1 Score: 53.5286 bits (127), Expect = 5.393e-9
Identity = 43/147 (29.25%), Postives = 61/147 (41.50%), Query Frame = 3
Query:  105 LKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS----NYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNF 533
            ++ HN+LR Q    K            + W D LA  ++ WA   IA +   +  + D     G+N+F  S    N  +VV  WY E   Y +   G  +  GH+TQV W  +  V  A+    E   GS       +  Y PAGN 
Sbjct:    8 IEVHNELRAQHQAPK------------VTWSDQLAKDAQAWANH-IAKNGRLEHSSPDSRPDQGENLFMSSPGEINAGDVVDEWYSEVSKYKFGKPGWQSGTGHFTQVVWKGTKEVAMASA---EGPDGSV----YVVGRYKPAGNV 134          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 52.7582 bits (125), Expect = 8.835e-9
Identity = 47/163 (28.83%), Postives = 69/163 (42.33%), Query Frame = 3
Query:   81 PPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYK----EVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEV 557
            P +Y++  L +HN  R Q   G  P          + W   LA   ++WA K +A  +T      +     G+N+   S Y+       + WYDE + Y +   G S+  GH+TQV W  S  +G A      K G  +A     +  Y PAGN   + P  V
Sbjct:    2 PNKYQKECLDSHNAYRAQ--HGAPP----------LKWSAKLASDCDKWA-KDLARRNTMQHSKGE----YGENLAFASGYELSGGRTTEMWYDEIQKYRFNNPGFSSGTGHFTQVVWVGSQEMGVA--KAVSKNGAHYA-----VARYYPAGNVIGQFPENV 140          
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 51.6026 bits (122), Expect = 2.158e-8
Identity = 40/161 (24.84%), Postives = 64/161 (39.75%), Query Frame = 3
Query:   87 EYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKF----MFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEV 557
            E+K  +LK HND R Q                 + W+  LA +++ WA + +A  +     +  ++     ++   +  G   ++    WY E   Y +E  G S   GH+TQV WA S  +G         +G  F      +  Y P GN   + P  V
Sbjct:    1 EFKNDILKTHNDYRAQHGTKA------------LKWNARLASEAQSWA-ENLAQRNAIQHSSSREYGESIAYMSGAVLTG---RKATDMWYGEVDKYRFENPGFSTSSGHFTQVVWAGSTEMGAG--KATSSSGAHFV-----VARYTPPGNVMGQFPENV 138          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 122.094 bits (305), Expect = 4.362e-32
Identity = 67/182 (36.81%), Postives = 99/182 (54.40%), Query Frame = 3
Query:   87 EYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS---NYKEVVQGWYDEYKDYTYEGKGCS--AVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTS-CKNNLCA 614
            + +E L++ HN  R Q++       P+AA M+ + WD  L   +E +A KCI  H+T       +    G+N+FAG+   +  E V+ W+ E  DY+YE   C    +CGHYTQ+ WA ++ VGCA   C       +      +CNY PAGN++DE PY  G  CS+CP+    C+N+LC 
Sbjct:   60 QQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT-------ELEDTGENLFAGTGKLDLSEAVEKWFLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLCV 227          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 112.464 bits (280), Expect = 2.060e-29
Identity = 69/188 (36.70%), Postives = 95/188 (50.53%), Query Frame = 3
Query:  102 LLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGS-NYKEVVQ---GWYDEYKDYTYE-GKGCSA---------VCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLC 611
            +L  HN +R ++        P A+NM  MVWD+ LA  +E+WA  C+  H            F+GQN+   +  Y+ ++Q    WYDE KDY++   + C+          +C HYTQ+ WA S  VGCA   C      G  +      +CNY P GN+  EAPY+VG  CS CP   G SC NN+C
Sbjct:   69 ILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSH-----LLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRDCNPRCPLRCYGPMCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMC 244          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 116.701 bits (291), Expect = 2.659e-29
Identity = 75/195 (38.46%), Postives = 95/195 (48.72%), Query Frame = 3
Query:   93 KEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYE---------GKGCS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
            +E +L  HN LR  +        P+AANM  MVWDD L   + +WA +C   H   D       M +GQN+      Y+     VQ WYDE KDYTY           + CS  +C HYTQ+ WA +  VGCA   C +    G  +      +CNY P GN+  EAPY  G  CS+CP   G  C+NNLC  D 
Sbjct:   76 REEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQD-----LLMSIGQNLAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLCYKDS 258          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 107.071 bits (266), Expect = 6.853e-26
Identity = 72/194 (37.11%), Postives = 92/194 (47.42%), Query Frame = 3
Query:   96 EFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYEGKG---------CS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
            + +L  HN LR Q+        P A+NM  M+WD  L   +EEWA  C+  H             +GQN+ A    Y+     VQ WYDE KDY++             CS  VC HYTQ+ WA S  +GCA   C      G  +A     +CNY P GN+   APY+ G  CS CP   G  C++NLC  DD
Sbjct:   62 QLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHG-----PASLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYKDD 243          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 107.071 bits (266), Expect = 8.163e-26
Identity = 72/194 (37.11%), Postives = 92/194 (47.42%), Query Frame = 3
Query:   96 EFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAG-SNYKEV---VQGWYDEYKDYTYEGKG---------CS-AVCGHYTQVAWAKSYAVGCAAVNCKEKT--GGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPK--GTSCKNNLCALDD 623
            + +L  HN LR Q+        P A+NM  M+WD  L   +EEWA  C+  H             +GQN+ A    Y+     VQ WYDE KDY++             CS  VC HYTQ+ WA S  +GCA   C      G  +A     +CNY P GN+   APY+ G  CS CP   G  C++NLC  DD
Sbjct:   90 QLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHG-----PASLLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLCYKDD 271          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036363.1 (SMESG000036363.1)

HSP 1 Score: 440.269 bits (1131), Expect = 3.326e-158
Identity = 210/211 (99.53%), Postives = 210/211 (99.53%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 653
            MKLL CGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE
Sbjct:    1 MKLLFCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 211          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 361.688 bits (927), Expect = 2.761e-127
Identity = 168/211 (79.62%), Postives = 183/211 (86.73%), Query Frame = 3
Query:   21 MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 653
            MK L C  +  +  TL   TP EYKEFLLKAHNDLRR +ALG TPNQPAAANMIEMVWDD LA K+E WA  CIAGHDTY+DR LDKFMFVGQNMFAGS+YK+VVQGWYDE+KDYTYEGKGCSA+CGHYTQV WAKSYAVGCAAVNC+EKT G F YGWLFICNYGPAGNF +E PYEVG ACSKCPKGTSCKNNLCAL+DPKG+LEF+ +
Sbjct:    1 MKYLFCLFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEGKGCSAICGHYTQVVWAKSYAVGCAAVNCQEKTSGIFPYGWLFICNYGPAGNFGEEPPYEVGTACSKCPKGTSCKNNLCALNDPKGSLEFESD 211          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 288.886 bits (738), Expect = 2.641e-99
Identity = 133/159 (83.65%), Postives = 145/159 (91.19%), Query Frame = 3
Query:  177 MIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 653
            MIEMVWDD LA K+E WA  CIAGHDTY+DR LDKFMFVGQNMFAGS+YK+VVQGWYDE+KDYTYEGKGCSA+CGHYTQV WAKSYAVGCAAVNC+EKT G F YGWLFICNYGPAGNF +E PYEVG ACSKCPKGTSCKNNLCAL+DPKG+LEF+ +
Sbjct:    1 MIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEGKGCSAICGHYTQVVWAKSYAVGCAAVNCQEKTSGIFPYGWLFICNYGPAGNFGEEPPYEVGTACSKCPKGTSCKNNLCALNDPKGSLEFESD 159          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 282.337 bits (721), Expect = 8.741e-97
Identity = 130/156 (83.33%), Postives = 142/156 (91.03%), Query Frame = 3
Query:  186 MVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALDDPKGTLEFDEE 653
            MVWDD LA K+E WA  CIAGHDTY+DR LDKFMFVGQNMFAGS+YK+VVQGWYDE+KDYTYEGKGCSA+CGHYTQV WAKSYAVGCAAVNC+EKT G F YGWLFICNYGPAGNF +E PYEVG ACSKCPKGTSCKNNLCAL+DPKG+LEF+ +
Sbjct:    1 MVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEGKGCSAICGHYTQVVWAKSYAVGCAAVNCQEKTSGIFPYGWLFICNYGPAGNFGEEPPYEVGTACSKCPKGTSCKNNLCALNDPKGSLEFESD 156          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000004532.1 (SMESG000004532.1)

HSP 1 Score: 207.223 bits (526), Expect = 3.192e-66
Identity = 97/196 (49.49%), Postives = 129/196 (65.82%), Query Frame = 3
Query:   27 LLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEKTGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCA 614
            +LL   +   L + A     + +E  L AHN  RRQ+A GK   QPAA +M+EMVW D LA  +E  A +C+  HD  +DRA   F   GQN++AG   KE ++ W+DE KDY+Y   GC+ VCGHYTQVAWAKSYAVGCA+V+C+ + G  F Y +  +CNYGPAGN+  E PY+ G+ACS CP G++C + LC+
Sbjct:    2 ILLSIFLVISLISQAFSISSDLREDFLTAHNTFRRQVAQGKVQGQPAAGDMMEMVWSDELAATAENSANRCVFQHDNDEDRATKSFPDAGQNIYAGWEPKEAIKLWFDENKDYSYNSDGCNGVCGHYTQVAWAKSYAVGCASVHCEGRNG--FQYKYFVVCNYGPAGNYMGEKPYKPGSACSNCPTGSTCNDGLCS 195          
The following BLAST results are available for this feature:
BLAST of SCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR1L17.136e-3837.37GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L17.223e-3837.37GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR19.091e-3738.76GLI pathogenesis related 1 [Source:HGNC Symbol;Acc... [more]
CRISPLD26.319e-3339.05cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD27.829e-3339.30cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-51.939e-2431.60SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-105.884e-2330.19SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-146.426e-2330.24SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-121.797e-2229.58SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-24.809e-2230.65SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84832.206e-3234.58gene:FBgn0038126 transcript:FBtr0082782[more]
CG326791.178e-1329.95gene:FBgn0052679 transcript:FBtr0071469[more]
CG94002.002e-1328.92gene:FBgn0030562 transcript:FBtr0073920[more]
CG179744.183e-1231.02gene:FBgn0034624 transcript:FBtr0071611[more]
CG427807.333e-1030.16gene:FBgn0261848 transcript:FBtr0339817[more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glipr1a3.730e-3540.66GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
glipr1a9.597e-3540.32GLI pathogenesis-related 1a [Source:ZFIN;Acc:ZDB-G... [more]
r3hdml5.176e-3138.20R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml5.176e-3138.20R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
pi15a7.052e-3138.30peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld22.893e-3040.00cysteine-rich secretory protein LCCL domain contai... [more]
crispld24.162e-3040.00cysteine-rich secretory protein LCCL domain contai... [more]
crispld25.875e-3040.31cysteine-rich secretory protein LCCL domain contai... [more]
R3HDML1.604e-2835.57R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML1.826e-2835.57R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr1l13.768e-3838.22GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Glipr1l31.990e-3737.91GLI pathogenesis-related 1 like 3 [Source:MGI Symb... [more]
Pi164.180e-3435.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr12.903e-3337.93GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
Glipr12.903e-3337.93GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
back to top
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DAG6|GPRL1_MOUSE2.636e-3738.22GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q6UWM5|GPRL1_HUMAN3.469e-3737.37GLIPR1-like protein 1 OS=Homo sapiens OX=9606 GN=G... [more]
sp|Q32LB5|GPRL1_BOVIN1.127e-3636.92GLIPR1-like protein 1 OS=Bos taurus OX=9913 GN=GLI... [more]
sp|P48060|GLIP1_HUMAN4.366e-3638.76Glioma pathogenesis-related protein 1 OS=Homo sapi... [more]
sp|Q2XXQ0|CRVP_ERYPO2.049e-3437.30Cysteine-rich venom protein LIO1 (Fragment) OS=Ery... [more]
back to top
BLAST of SCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1C9ZZV56.748e-14290.09SCP domain-containing protein (Fragment) OS=Dugesi... [more]
A0A172RVP61.147e-4853.42TPX-1 protein (Fragment) OS=Schmidtea mediterranea... [more]
A0A183B2202.400e-4241.05SCP domain-containing protein OS=Echinostoma capro... [more]
A0A1I8HU241.324e-4143.09SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HQH61.908e-4142.93SCP domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042591.14.801e-3739.78GLI pathogenesis related 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000054643.17.632e-3536.99glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000053689.11.053e-3437.09glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000030308.11.082e-3436.97glioma pathogenesis-related protein 1-like [Source... [more]
ENSAMXT00000029824.16.235e-3233.66peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.18.566e-2937.25pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP32.227e-2732.80cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.19.142e-2434.25pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CRISP21.035e-1335.77cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
ENSPMAT00000000359.17.076e-1335.96pep scaffold:Pmarinus_7.0:GL487788:450:5784:1 gene... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY31.318e-1227.17Cell wall-associated protein involved in export of... [more]
PRY13.378e-1132.89Sterol binding protein involved in the export of a... [more]
PRY21.438e-832.23Sterol binding protein involved in the export of a... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493109.109e-1025.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419194.470e-926.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353835.393e-929.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488808.835e-928.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488812.158e-824.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.24.362e-3236.81peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
pi15a2.060e-2936.70peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld22.659e-2938.46cysteine rich secretory protein LCCL domain contai... [more]
crispld1a6.853e-2637.11cysteine rich secretory protein LCCL domain contai... [more]
crispld1a8.163e-2637.11cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036363.13.326e-15899.53SMESG000036363.1[more]
SMESG000036385.12.761e-12779.62SMESG000036385.1[more]
SMESG000036385.12.641e-9983.65SMESG000036385.1[more]
SMESG000036385.18.741e-9783.33SMESG000036385.1[more]
SMESG000004532.13.192e-6649.49SMESG000004532.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002634 ID=SMED30002634|Name=SCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=835bp
GTCTTCTCAAATAATTTATTATGAAGTTATTGCTTTGTGGGGTTATTTCT
TGTCTTTTAGCCACTCTAGCAGTTGGAACTCCTCCTGAATACAAAGAATT
TCTTCTGAAAGCCCACAATGATTTGAGAAGACAAATAGCTTTAGGTAAAA
CTCCAAATCAACCAGCTGCCGCCAACATGATTGAAATGGTTTGGGATGAT
GCACTTGCCGGAAAATCTGAAGAATGGGCTGGGAAATGTATTGCCGGACA
TGACACCTATGATGATAGAGCACTCGACAAATTTATGTTTGTTGGTCAGA
ATATGTTTGCTGGATCGAATTATAAAGAAGTGGTTCAAGGATGGTATGAT
GAATATAAAGATTACACATATGAAGGTAAAGGATGTTCAGCAGTTTGTGG
CCATTACACACAAGTTGCTTGGGCAAAAAGTTATGCAGTTGGTTGCGCTG
CTGTGAACTGCAAAGAAAAAACTGGTGGTTCATTTGCATACGGATGGTTA
TTTATTTGCAATTATGGACCAGCAGGAAATTTCAATGATGAAGCTCCGTA
TGAAGTAGGAGCCGCATGTTCAAAATGTCCCAAAGGAACATCGTGTAAAA
ACAATCTCTGTGCTTTGGACGACCCAAAAGGAACTTTGGAATTCGATGAA
GAGAAAAGAAGAAAAAGACATAAGGGTCACCATAAACGACATGCTGGCCA
TCATAAACGACACGCTGGTCACCATTAATTGAACGGAAGTCCGATTATTC
CGAGAACTTTAATTTATTTGAAAAAAATTCTGATAAAGCATTATTAAAAA
TATAATAAAGCATCCGTGTTTGATTTGCCTCTCAG
back to top

protein sequence of SMED30002634-orf-1

>SMED30002634-orf-1 ID=SMED30002634-orf-1|Name=SMED30002634-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MKLLLCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAA
ANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSN
YKEVVQGWYDEYKDYTYEGKGCSAVCGHYTQVAWAKSYAVGCAAVNCKEK
TGGSFAYGWLFICNYGPAGNFNDEAPYEVGAACSKCPKGTSCKNNLCALD
DPKGTLEFDEEKRRKRHKGHHKRHAGHHKRHAGHH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 104..117
score: 36.69
coord: 160..173
score: 44.96
coord: 126..142
score: 59.94
coord: 56..74
score: 31.36
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 14..200
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 102..117
score: 38.28
coord: 125..144
score: 48.75
coord: 19..35
score: 35.66
IPR014044CAP domainSMARTSM00198SCP_3coord: 23..173
e-value: 2.9E-50
score: 183.0
IPR014044CAP domainPFAMPF00188CAPcoord: 29..165
e-value: 4.6E-22
score: 79.2
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 15..205
e-value: 1.4E-60
score: 206.3
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 9..180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 211..242
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 215..242
NoneNo IPR availablePANTHERPTHR10334:SF220GLIPR1-LIKE PROTEIN 1coord: 14..200
NoneNo IPR availableCDDcd05385CAP_GLIPR1-likecoord: 29..169
e-value: 8.22661E-42
score: 137.923
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.85
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01010CRISP_2coord: 160..171
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 127..137