Epithelial splicing regulatory protein 1/2

Overview
NameEpithelial splicing regulatory protein 1/2
Smed IDSMED30002619
Length (bp)2884
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epithelial splicing regulatory protein 1/2 (SMED30002619) t-SNE clustered cells

Violin plots show distribution of expression levels for Epithelial splicing regulatory protein 1/2 (SMED30002619) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epithelial splicing regulatory protein 1/2 (SMED30002619) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epithelial splicing regulatory protein 1/2 (SMED30002619) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002619

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30002619SMESG000044612.1 dd_Smed_v4_7995_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30002619SMESG000044612.1 dd_Smed_v4_7995_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002619SMESG000044612.1 dd_Smed_v4_7995_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002619SMESG000044612.1 dd_Smed_v4_7995_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Match: ESRP2 (epithelial splicing regulatory protein 2 [Source:HGNC Symbol;Acc:HGNC:26152])

HSP 1 Score: 152.14 bits (383), Expect = 2.605e-37
Identity = 126/438 (28.77%), Postives = 210/438 (47.95%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQ--AIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNV---------LVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLD----EISNFLQIEKPGGT---TMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKA-KNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            L+     T G  G DLG DET ++ + +Q+++  + Q   +   L+  +A++L            S   RE + L S+ S      L   L +    +N +V         L +D Q +           LR VLH E   +N+ L + ++ +Y+L  E  +   S C   D     ++  L +E         +  +  M   IL L +     LF    VIK  Y+       D ++ + V+  + + +++    +  FF+GLN+A GG+A+ + ++GRR+ + LI+F D  QRD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   +DQ+++R++GLP++    ++L F    +  V     G+  V+   G   GDAF +F  E +AQ A +  KGM +G RY+E+F ST  E+ QV+
Sbjct:   30 LVVLFGATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAAL------------STQCREASGL-SADSLARAEPLDKVLQQFSQLVNGDVALLGGGPYMLCTDGQQL-----------LRQVLHPEASRKNLVLPDMFFSFYDLRREFHMQHPSTCPARDLTVATMAQGLGLETDATEDDFGVWEVKTMVAVILHLLKEPSSQLFSKPEVIKQKYETGPCSKADVVDSETVVRARGLPWQSSDQDVARFFKGLNVARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHM---GVRYIEVYKATGEEFVKIAGGTSLEVARFLSR---EDQVILRLRGLPFSAGPTDVLGFL-GPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGM-LGKRYIELFRSTAAEVQQVL 435          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Match: ESRP1 (epithelial splicing regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:25966])

HSP 1 Score: 147.517 bits (371), Expect = 3.136e-36
Identity = 119/434 (27.42%), Postives = 210/434 (48.39%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDL-LSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD--EISNFLQIEKPGGTT---MSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T + + S SS S  +L  AL + +  ++  + +    +  +     G L +R +LH E   +N+ L   +Y +++L  E       S     LD   ++ +L  EK    +    S +  M N IL +      H F     +   ++       + I+ + V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDVESLSSAS--QLDQALRQFNQSVSNELNIGVGTSFCL--CTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Match: ESRP1 (epithelial splicing regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:25966])

HSP 1 Score: 147.132 bits (370), Expect = 4.136e-36
Identity = 119/434 (27.42%), Postives = 210/434 (48.39%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDL-LSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD--EISNFLQIEKPGGTT---MSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T + + S SS S  +L  AL + +  ++  + +    +  +     G L +R +LH E   +N+ L   +Y +++L  E       S     LD   ++ +L  EK    +    S +  M N IL +      H F     +   ++       + I+ + V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDVESLSSAS--QLDQALRQFNQSVSNELNIGVGTSFCL--CTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Match: ESRP1 (epithelial splicing regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:25966])

HSP 1 Score: 147.517 bits (371), Expect = 5.224e-36
Identity = 119/434 (27.42%), Postives = 210/434 (48.39%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDL-LSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD--EISNFLQIEKPGGTT---MSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T + + S SS S  +L  AL + +  ++  + +    +  +     G L +R +LH E   +N+ L   +Y +++L  E       S     LD   ++ +L  EK    +    S +  M N IL +      H F     +   ++       + I+ + V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDVESLSSAS--QLDQALRQFNQSVSNELNIGVGTSFCL--CTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Match: ESRP1 (epithelial splicing regulatory protein 1 [Source:HGNC Symbol;Acc:HGNC:25966])

HSP 1 Score: 147.517 bits (371), Expect = 5.369e-36
Identity = 119/434 (27.42%), Postives = 210/434 (48.39%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDL-LSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD--EISNFLQIEKPGGTT---MSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T + + S SS S  +L  AL + +  ++  + +    +  +     G L +R +LH E   +N+ L   +Y +++L  E       S     LD   ++ +L  EK    +    S +  M N IL +      H F     +   ++       + I+ + V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDVESLSSAS--QLDQALRQFNQSVSNELNIGVGTSFCL--CTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Match: sym-2 (RNA-binding protein sym-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22708])

HSP 1 Score: 117.472 bits (293), Expect = 6.528e-27
Identity = 88/317 (27.76%), Postives = 148/317 (46.69%), Query Frame = 3
Query: 1224 YKPIVFHVNDEIEPD---IVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMS-EGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIA-GYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFK--NSSDASATIKALRD 2153
            Y+P     + E+  D   +V   + + ++   + +  FF GL+I  GGIA+ +S EGRR+ ++L++F  +  RD+AL R ++ +    SR+I +      EFM +A G   E+++       + + I++R++GLPY  T  +I  FF+   +      + I  + ++ G   GDAFV FE E  AQ+        IG RY+E+F ST  E+ QV+     I   P     +  P +       K      + G     +P EA+    V +L D   +        +Y+  G+ S  AF +  N   ASA    + +
Sbjct:  163 YQPAPILEDQEVGADGDNVVCRARGLPWQASDHHVAQFFAGLDIVPGGIALCLSSEGRRNGEVLVQFSSQESRDLALKRHRNFLL---SRYIEVYKAGLDEFMHVATGSSTEAMEFV-----SANAIIVRMRGLPYDCTDAQIRTFFEPLKLT-----DKILFITRTDGRPTGDAFVQFETEEDAQQGLLKHRQVIGQRYIELFKSTAAEVQQVVKRCNLINSSPAVANAVEAPEE-------KKKDCVRLRG-----LPYEATVQHIVTFLGDFATMVKFQGVHMVYNNQGHPSGEAFIQMINEQAASACAAGVHN 454          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Match: sym-2 (RNA-binding protein sym-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22708])

HSP 1 Score: 71.2478 bits (173), Expect = 7.143e-13
Identity = 53/193 (27.46%), Postives = 83/193 (43.01%), Query Frame = 3
Query: 1581 DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFK--NSSDASATIKALRD 2153
            + I++R++GLPY  T  +I  FF+   +      + I  + ++ G   GDAFV FE E  AQ+        IG RY+E+F ST  E+ QV+     I   P     +  P +       K      + G     +P EA+    V +L D   +        +Y+  G+ S  AF +  N   ASA    + +
Sbjct:    7 NAIIVRMRGLPYDCTDAQIRTFFEPLKLT-----DKILFITRTDGRPTGDAFVQFETEEDAQQGLLKHRQVIGQRYIELFKSTAAEVQQVVKRCNLINSSPAVANAVEAPEE-------KKKDCVRLRG-----LPYEATVQHIVTFLGDFATMVKFQGVHMVYNNQGHPSGEAFIQMINEQAASACAAGVHN 182          

HSP 2 Score: 65.4698 bits (158), Expect = 5.891e-11
Identity = 48/202 (23.76%), Postives = 90/202 (44.55%), Query Frame = 3
Query: 1269 IVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYEN-----ESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAK-----NLKGMTIGNRYMEIFYSTPPEMN 1844
            I++ ++ + Y     QI  FF  L + D  + +  ++GR +    ++FE +      LL+   H +    R+I +    + E  ++    N      +V   +E  E + +  +R++GLPY  T   I+ F       V+F   G+ +V  + G  +G+AF+   NE  A         N   +    RY+E+F ++  E+N
Sbjct:    9 IIVRMRGLPYDCTDAQIRTFFEPLKLTDKILFITRTDGRPTGDAFVQFETEEDAQQGLLK---HRQVIGQRYIELFKSTAAEVQQVVKRCNLINSSPAVANAVEAPEEKKKDCVRLRGLPYEATVQHIVTFLGDFATMVKF--QGVHMVYNNQGHPSGEAFIQMINEQAASACAAGVHNNFMSVGKKKRYIEVFQASAEELN 205          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Match: sym-2 (RNA-binding protein sym-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22708])

HSP 1 Score: 71.2478 bits (173), Expect = 7.143e-13
Identity = 53/193 (27.46%), Postives = 83/193 (43.01%), Query Frame = 3
Query: 1581 DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFK--NSSDASATIKALRD 2153
            + I++R++GLPY  T  +I  FF+   +      + I  + ++ G   GDAFV FE E  AQ+        IG RY+E+F ST  E+ QV+     I   P     +  P +       K      + G     +P EA+    V +L D   +        +Y+  G+ S  AF +  N   ASA    + +
Sbjct:    7 NAIIVRMRGLPYDCTDAQIRTFFEPLKLT-----DKILFITRTDGRPTGDAFVQFETEEDAQQGLLKHRQVIGQRYIELFKSTAAEVQQVVKRCNLINSSPAVANAVEAPEE-------KKKDCVRLRG-----LPYEATVQHIVTFLGDFATMVKFQGVHMVYNNQGHPSGEAFIQMINEQAASACAAGVHN 182          

HSP 2 Score: 65.4698 bits (158), Expect = 5.891e-11
Identity = 48/202 (23.76%), Postives = 90/202 (44.55%), Query Frame = 3
Query: 1269 IVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYEN-----ESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAK-----NLKGMTIGNRYMEIFYSTPPEMN 1844
            I++ ++ + Y     QI  FF  L + D  + +  ++GR +    ++FE +      LL+   H +    R+I +    + E  ++    N      +V   +E  E + +  +R++GLPY  T   I+ F       V+F   G+ +V  + G  +G+AF+   NE  A         N   +    RY+E+F ++  E+N
Sbjct:    9 IIVRMRGLPYDCTDAQIRTFFEPLKLTDKILFITRTDGRPTGDAFVQFETEEDAQQGLLK---HRQVIGQRYIELFKSTAAEVQQVVKRCNLINSSPAVANAVEAPEEKKKDCVRLRGLPYEATVQHIVTFLGDFATMVKF--QGVHMVYNNQGHPSGEAFIQMINEQAASACAAGVHNNFMSVGKKKRYIEVFQASAEELN 205          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Match: hrpf-1 (HnRNP F homolog [Source:UniProtKB/TrEMBL;Acc:H2KZN0])

HSP 1 Score: 51.2174 bits (121), Expect = 2.343e-6
Identity = 26/80 (32.50%), Postives = 43/80 (53.75%), Query Frame = 3
Query: 1590 LIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYST 1829
            ++R++GLP++VT  +I +F       +    +GI L  +      G+A+V FE     Q AK      IG+RY+E+F +T
Sbjct:  124 IVRLRGLPFSVTSRDISDFL----APLPIVRDGILLPDQQRARPGGEAYVCFETMESVQIAKQRHMKNIGHRYIEVFEAT 199          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Match: hrpf-1 (HnRNP F homolog [Source:UniProtKB/TrEMBL;Acc:H2KZN0])

HSP 1 Score: 50.447 bits (119), Expect = 6.334e-6
Identity = 26/80 (32.50%), Postives = 43/80 (53.75%), Query Frame = 3
Query: 1590 LIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYST 1829
            ++R++GLP++VT  +I +F       +    +GI L  +      G+A+V FE     Q AK      IG+RY+E+F +T
Sbjct:  124 IVRLRGLPFSVTSRDISDFL----APLPIVRDGILLPDQQRARPGGEAYVCFETMESVQIAKQRHMKNIGHRYIEVFEAT 199          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Match: fus (gene:FBgn0023441 transcript:FBtr0302330)

HSP 1 Score: 171.014 bits (432), Expect = 2.284e-43
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Match: fus (gene:FBgn0023441 transcript:FBtr0087345)

HSP 1 Score: 171.014 bits (432), Expect = 2.557e-43
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Match: fus (gene:FBgn0023441 transcript:FBtr0087343)

HSP 1 Score: 171.4 bits (433), Expect = 2.648e-43
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Match: fus (gene:FBgn0023441 transcript:FBtr0087344)

HSP 1 Score: 171.4 bits (433), Expect = 2.648e-43
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Match: fus (gene:FBgn0023441 transcript:FBtr0087346)

HSP 1 Score: 171.4 bits (433), Expect = 2.648e-43
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:NCBI gene;Acc:560190])

HSP 1 Score: 150.984 bits (380), Expect = 3.144e-37
Identity = 130/478 (27.20%), Postives = 229/478 (47.91%), Query Frame = 3
Query:  651 LGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQ----NLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQL---------GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI---SAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADH 2033
            LG DE  I+Q+ +Q++DL+  +A        Q + LL     PD I +S   +E++ L +  +      L+ A+++++  +   V      T  +     G L +R VLH E   +NI L + ++ +++L  E      S+ +    NL  +++ L +        S+  + +  + Q+  +          H F     +   ++       + ++ + V+  + + +++    I  FFRGLNIA GG A+ + ++GRR+ + L++FE +  RD+AL R KHHM     R+I +      +F+KIAG  +  V  +L +   ++QI++R++GLP+  T  ++L FF S    V     GI  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+   S+A  IP  P     +  P   V Q    ++   V      + +P +AS  D + +L ++
Sbjct:   23 LGSDEKEIVQLVWQVVDLATKKAG-------QVNELL---VKPDHIELSEECQELSGL-TDEALTPVDPLEVAIDQLNQRLCAEVDTGAGNTFYL--CTDGQLHVRQVLHPEASSKNILLPDCFFSFFDLRKEFKKEFPSEVKLKDLNLQVMADHLNV----AVDSSLHAFTAYKVQQMVDIVLALISEPTCHEFTFPEKVNEKFETGTCSKMERVDDNTVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCLNAQGRRNGEALVRFESEEHRDLALQRHKHHM---GGRYIEVYKATGEDFLKIAGGTSNEVASFLSR---ENQIIVRMRGLPFNATAEQVLQFF-SPACPVTDGSEGILFVRFPDGRPTGDAFVLFSCEEHAQNALKKHKDMLGKRYIELFKSTAAEVQQVLNKYSSAPLIPVAPSPILSVVAPPTFVPQ---TAAVPGVRDCVRLRGLPYDASIQDILVFLGEY 473          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:572992])

HSP 1 Score: 145.206 bits (365), Expect = 2.298e-35
Identity = 123/443 (27.77%), Postives = 208/443 (46.95%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKL--ILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNV--LVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN------------LDEISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            L+ F   T G  G  LG DE  ++ + +Q++DL  N+   GKL   L+Q          PD + +S   +E T L +     +   L+  L +    ++  +  L     T+     + G L +R VLH E   +N+ L   +Y + +L  E        C N            LD +     +E+  G  +  +  M   IL +      H F +   +   ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  ++L F    +  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:    8 LVVFFGATAGANGGKLGSDERELILLVWQIVDLHENKV--GKLHRTLVQ----------PDSVDLSEQCKEETGLTAEELCKAE-PLESVLQQFHQSVSAELKSLGRSSYTL----CVDGPLLIRQVLHPEASKKNLVLPECFYTFVDLKKEFH----KCCPNAGPVKDLTLPSMLDYVCIQATVEQEAG--LREVKDMVLLILHVLAEPYNHKFSAFETVNYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALDRHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQMIIRMRGLPFTATPQDVLGFL-GPECPVTDGTEGLLFVKYPDGRPTGDAFVLFACEEYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:572992])

HSP 1 Score: 145.206 bits (365), Expect = 2.298e-35
Identity = 123/443 (27.77%), Postives = 208/443 (46.95%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKL--ILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNV--LVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN------------LDEISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            L+ F   T G  G  LG DE  ++ + +Q++DL  N+   GKL   L+Q          PD + +S   +E T L +     +   L+  L +    ++  +  L     T+     + G L +R VLH E   +N+ L   +Y + +L  E        C N            LD +     +E+  G  +  +  M   IL +      H F +   +   ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  ++L F    +  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:    8 LVVFFGATAGANGGKLGSDERELILLVWQIVDLHENKV--GKLHRTLVQ----------PDSVDLSEQCKEETGLTAEELCKAE-PLESVLQQFHQSVSAELKSLGRSSYTL----CVDGPLLIRQVLHPEASKKNLVLPECFYTFVDLKKEFH----KCCPNAGPVKDLTLPSMLDYVCIQATVEQEAG--LREVKDMVLLILHVLAEPYNHKFSAFETVNYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALDRHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQMIIRMRGLPFTATPQDVLGFL-GPECPVTDGTEGLLFVKYPDGRPTGDAFVLFACEEYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:572992])

HSP 1 Score: 145.591 bits (366), Expect = 2.325e-35
Identity = 123/443 (27.77%), Postives = 208/443 (46.95%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKL--ILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNV--LVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN------------LDEISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            L+ F   T G  G  LG DE  ++ + +Q++DL  N+   GKL   L+Q          PD + +S   +E T L +     +   L+  L +    ++  +  L     T+     + G L +R VLH E   +N+ L   +Y + +L  E        C N            LD +     +E+  G  +  +  M   IL +      H F +   +   ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  ++L F    +  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:    8 LVVFFGATAGANGGKLGSDERELILLVWQIVDLHENKV--GKLHRTLVQ----------PDSVDLSEQCKEETGLTAEELCKAE-PLESVLQQFHQSVSAELKSLGRSSYTL----CVDGPLLIRQVLHPEASKKNLVLPECFYTFVDLKKEFH----KCCPNAGPVKDLTLPSMLDYVCIQATVEQEAG--LREVKDMVLLILHVLAEPYNHKFSAFETVNYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALDRHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQMIIRMRGLPFTATPQDVLGFL-GPECPVTDGTEGLLFVKYPDGRPTGDAFVLFACEEYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:572992])

HSP 1 Score: 145.591 bits (366), Expect = 2.325e-35
Identity = 123/443 (27.77%), Postives = 208/443 (46.95%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKL--ILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNV--LVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN------------LDEISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            L+ F   T G  G  LG DE  ++ + +Q++DL  N+   GKL   L+Q          PD + +S   +E T L +     +   L+  L +    ++  +  L     T+     + G L +R VLH E   +N+ L   +Y + +L  E        C N            LD +     +E+  G  +  +  M   IL +      H F +   +   ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  ++L F    +  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:    8 LVVFFGATAGANGGKLGSDERELILLVWQIVDLHENKV--GKLHRTLVQ----------PDSVDLSEQCKEETGLTAEELCKAE-PLESVLQQFHQSVSAELKSLGRSSYTL----CVDGPLLIRQVLHPEASKKNLVLPECFYTFVDLKKEFH----KCCPNAGPVKDLTLPSMLDYVCIQATVEQEAG--LREVKDMVLLILHVLAEPYNHKFSAFETVNYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALDRHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQMIIRMRGLPFTATPQDVLGFL-GPECPVTDGTEGLLFVKYPDGRPTGDAFVLFACEEYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Match: atf1 (activating transcription factor 1 [Source:Xenbase;Acc:XB-GENE-971677])

HSP 1 Score: 142.51 bits (358), Expect = 2.153e-34
Identity = 112/436 (25.69%), Postives = 199/436 (45.64%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETR-------------FRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFL------QIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            L+     T G  G+ LG DE  ++Q+ +++I+L+N +             L + +  PD + ++   +E+T +  + S +   +L+ AL + +  +   + +    +  +     G L +R VLH E               F             +  +E+ +   + C  L    +        +++  G   +++I    N    L     LFHS  +             + I+ + ++  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E+L FF      V     GI  V        GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    9 LVVLFTTTAGANGSKLGSDEKEVIQLLWKVINLANKKV----------GELHEVTVRPDHLELTEECKEITRI-EADSLYVAPQLEQALQQFNQSVGNELNIGVGTSFCI--CTDGQLHIRQVLHPEASKKNILLPECFYSFFDLRKEFLKCCPGSSDTNELDVHAMASCILLSGAKSTRYRYGASEVDDMGDIIVTLISEPYNIFSLLISDVFLFHSSKL-------------EIIDDNTIIRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVLAFF-GQQCPVTGGKEGILFVTYPDNRPTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQVL 411          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Match: atf1 (activating transcription factor 1 [Source:Xenbase;Acc:XB-GENE-971677])

HSP 1 Score: 136.346 bits (342), Expect = 1.127e-32
Identity = 108/399 (27.07%), Postives = 190/399 (47.62%), Query Frame = 3
Query:  660 DETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            DE  ++Q+ +++I+L+N +             L + +  PD + ++   +E+T +  + S +   +L+ AL + +  +   + +    +  +     G L +R VLH E    +         +Y+ FD    F   KC      +N L +       M+    +S A     ++ + F S    K           + I+ + ++  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E+L FF      V     GI  V        GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:   27 DEKEVIQLLWKVINLANKKV----------GELHEVTVRPDHLELTEECKEITRI-EADSLYVAPQLEQALQQFNQSVGNELNIGVGTSFCI--CTDGQLHIRQVLHPEA---SKKNILLPECFYSFFDLRKEFL--KCCPGSSDTNELDVH-----AMASCILLSGAFSDPERVNYKFESGTCSKL----------EIIDDNTIIRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVLAFF-GQQCPVTGGKEGILFVTYPDNRPTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQVL 385          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Match: atf1 (activating transcription factor 1 [Source:Xenbase;Acc:XB-GENE-971677])

HSP 1 Score: 136.732 bits (343), Expect = 1.173e-32
Identity = 109/399 (27.32%), Postives = 189/399 (47.37%), Query Frame = 3
Query:  660 DETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            DE  ++Q+ +++I+L+N +             L + +  PD + ++   +E+T +  + S +   +L+ AL + +  +   + +    +  +     G L +R VLH E    +         +Y+ FD    F   KC      +N L +       M+    +S A         LFHS  +             + I+ + ++  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E+L FF      V     GI  V        GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:   27 DEKEVIQLLWKVINLANKKV----------GELHEVTVRPDHLELTEECKEITRI-EADSLYVAPQLEQALQQFNQSVGNELNIGVGTSFCI--CTDGQLHIRQVLHPEA---SKKNILLPECFYSFFDLRKEFL--KCCPGSSDTNELDVH-----AMASCILLSGAAFTDV---FLFHSSKL-------------EIIDDNTIIRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVLAFF-GQQCPVTGGKEGILFVTYPDNRPTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQVL 379          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Match: atf1 (activating transcription factor 1 [Source:Xenbase;Acc:XB-GENE-971677])

HSP 1 Score: 135.191 bits (339), Expect = 4.456e-32
Identity = 112/408 (27.45%), Postives = 200/408 (49.02%), Query Frame = 3
Query:  660 DETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEV--SIFTSSKCQNLD--EISNFLQIEKPGGT---TMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            DE  ++Q+ +++I+L+N +             L + +  PD + ++   +E+T +  + S +   +L+ AL + +  +   + +    +  +     G L +R VLH E   +NI L   +Y +++L  E       SS    LD   ++++L  EK         S +  M + I+ L      + F     +   ++       + I+ + ++  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E+L FF      V     GI  V        GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:   27 DEKEVIQLLWKVINLANKKV----------GELHEVTVRPDHLELTEECKEITRI-EADSLYVAPQLEQALQQFNQSVGNELNIGVGTSFCI--CTDGQLHIRQVLHPEASKKNILLPECFYSFFDLRKEFLKCCPGSSDTNELDVHAMASYLGFEKKSTRYRYGASEVDDMGDIIVTLISEPYNYKFSDPERVNYKFESGTCSKLEIIDDNTIIRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVLAFF-GQQCPVTGGKEGILFVTYPDNRPTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQVL 414          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Match: atf1 (activating transcription factor 1 [Source:Xenbase;Acc:XB-GENE-971677])

HSP 1 Score: 133.265 bits (334), Expect = 1.546e-31
Identity = 106/373 (28.42%), Postives = 178/373 (47.72%), Query Frame = 3
Query:  738 LLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +LQ   L + +  PD + ++   +E+T +  + S +   +L+ AL + +  +   + +    +  +     G L +R VLH E   +NI L   +Y     FD    F   KC      +N L +       +      ++    L     LFHS  +             + I+ + ++  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E+L FF      V     GI  V        GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:   43 VLQVGELHEVTVRPDHLELTEECKEITRI-EADSLYVAPQLEQALQQFNQSVGNELNIGVGTSFCI--CTDGQLHIRQVLHPEASKKNILLPECFYS---FFDLRKEFL--KCCPGSSDTNELDVHAMASCILLSGAAFTDIFSLLISDVFLFHSSKL-------------EIIDDNTIIRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVLAFF-GQQCPVTGGKEGILFVTYPDNRPTGDAFVLFACEEYAQNALKKHKELLGKRYIELFRSTAAEVQQVL 387          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Match: Esrp2 (epithelial splicing regulatory protein 2 [Source:MGI Symbol;Acc:MGI:1924661])

HSP 1 Score: 152.91 bits (385), Expect = 1.056e-37
Identity = 127/437 (29.06%), Postives = 214/437 (48.97%), Query Frame = 3
Query:  591 PSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQ--AIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVIL---GHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLD----EISNFLQIEKPGGT---TMSIICYMSNAILQLTQL--GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKA-KNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            P    L+     T G  G DLG DET ++ + +Q+++  + Q   +   L+  +A++L            S   RE + L S+ S      L   L +    ++ +V +     +   P +L   G   LR VLH E   +N+ L + ++ +Y+L  E  +   S C   D     ++  L +E         +  +  M   IL L +   G LF    V+K  Y+       D ++ + V+  + + +++    +  FF+GLNIA GG+A+ + ++GRR+ + LI+F D  QRD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   +DQ+++R++GLP++    ++L F    +  V    +G+  V+   G   GDAF +F  E +AQ A +  KGM +G RY+E+F ST  E+ QV+
Sbjct:   25 PEPQSLVVLFGATAGALGPDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAAL------------SPQCREASGL-SADSLARAESLDKVLQQFSQLVSGDVAL-----LGGGPYVLCTDGQQLLRQVLHPEASRKNLVLPDTFFSFYDLRREFHMQHPSTCSARDLTVGTMAQDLGLETDATEDDFGVWEVKTMVAVILHLLEGSNGQLFSKPEVVKQKYETGPCSKADVVDNETVVRARGLPWQSSDQDVARFFKGLNIARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHM---GVRYIEVYKATGEEFVKIAGGTSLEVARFLSR---EDQVILRLRGLPFSAGPTDVLGFL-GPECPVTGGADGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGM-LGKRYIELFRSTAAEVQQVL 435          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Match: Esrp2 (epithelial splicing regulatory protein 2 [Source:MGI Symbol;Acc:MGI:1924661])

HSP 1 Score: 147.517 bits (371), Expect = 1.724e-36
Identity = 127/437 (29.06%), Postives = 214/437 (48.97%), Query Frame = 3
Query:  591 PSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQ--AIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVIL---GHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLD----EISNFLQIEKPGGT---TMSIICYMSNAILQLTQL--GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKA-KNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            P    L+     T G  G DLG DET ++ + +Q+++  + Q   +   L+  +A++L            S   RE + L S+ S      L   L +    ++ +V +     +   P +L   G   LR VLH E   +N+ L + ++ +Y+L  E  +   S C   D     ++  L +E         +  +  M   IL L +   G LF    V+K  Y+       D ++ + V+  + + +++    +  FF+GLNIA GG+A+ + ++GRR+ + LI+F D  QRD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   +DQ+++R++GLP++    ++L F    +  V    +G+  V+   G   GDAF +F  E +AQ A +  KGM +G RY+E+F ST  E+ QV+
Sbjct:   25 PEPQSLVVLFGATAGALGPDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAAL------------SPQCREASGL-SADSLARAESLDKVLQQFSQLVSGDVAL-----LGGGPYVLCTDGQQLLRQVLHPEASRKNLVLPDTFFSFYDLRREFHMQHPSTCSARDLTVGTMAQDLGLETDATEDDFGVWEVKTMVAVILHLLEGSNGQLFSKPEVVKQKYETGPCKA-DVVDNETVVRARGLPWQSSDQDVARFFKGLNIARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHM---GVRYIEVYKATGEEFVKIAGGTSLEVARFLSR---EDQVILRLRGLPFSAGPTDVLGFL-GPECPVTGGADGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGM-LGKRYIELFRSTAAEVQQVL 434          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Match: Esrp1 (epithelial splicing regulatory protein 1 [Source:MGI Symbol;Acc:MGI:1917326])

HSP 1 Score: 144.821 bits (364), Expect = 1.726e-35
Identity = 119/440 (27.05%), Postives = 204/440 (46.36%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMT-----DLLSSPSSHSTFKL--QDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD-----EISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T     +L S+P      +   Q   NE++  +  +  +  D          G L +R +LH E   +N+ L   +Y +++L  E       S     LD     E  NF + +       S +  M N IL +      H F     +   ++       + I+   V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLLWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDAENLSSAPQLDQALRQFNQSVSNELNIGVGTSFCLCTD----------GQLHIRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTESLNFEKSDSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDSTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKELLGKRYIELFRSTAAEVQQVL 413          

HSP 2 Score: 50.8322 bits (120), Expect = 8.436e-6
Identity = 28/89 (31.46%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 1590 LIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVA-QKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
             IR++GLPY  T  +IL+F      +++   +G+ +V    G  +GDAF+  ++   A   A+     T+ +RY+E+F  +  EMN V+
Sbjct:  446 CIRLRGLPYAATIEDILDFLGEFSTDIR--THGVHMVLNHQGRPSGDAFIQMKSTDRAFMAAQKYHKKTMKDRYVEVFQCSAEEMNFVL 532          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Match: Esrp1 (epithelial splicing regulatory protein 1 [Source:MGI Symbol;Acc:MGI:1917326])

HSP 1 Score: 145.591 bits (366), Expect = 1.873e-35
Identity = 119/440 (27.05%), Postives = 204/440 (46.36%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMT-----DLLSSPSSHSTFKL--QDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD-----EISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T     +L S+P      +   Q   NE++  +  +  +  D          G L +R +LH E   +N+ L   +Y +++L  E       S     LD     E  NF + +       S +  M N IL +      H F     +   ++       + I+   V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLLWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDAENLSSAPQLDQALRQFNQSVSNELNIGVGTSFCLCTD----------GQLHIRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTESLNFEKSDSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDSTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKELLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Match: Esrp1 (epithelial splicing regulatory protein 1 [Source:MGI Symbol;Acc:MGI:1917326])

HSP 1 Score: 145.206 bits (365), Expect = 2.389e-35
Identity = 119/440 (27.05%), Postives = 204/440 (46.36%), Query Frame = 3
Query:  585 MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMT-----DLLSSPSSHSTFKL--QDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFT--SSKCQNLD-----EISNFLQIEKPGGTTMSIICYMSNAILQLTQ--LGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            M  S   L+    +T G  G  LG DE  ++ + ++++DL+N +             L +    PD++ ++   +E T     +L S+P      +   Q   NE++  +  +  +  D          G L +R +LH E   +N+ L   +Y +++L  E       S     LD     E  NF + +       S +  M N IL +      H F     +   ++       + I+   V+  + + +++    I  FF+GLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM    +R+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  E++ FF  +   +     GI  V    G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+
Sbjct:    1 MTASPDYLVVLFGITAGATGAKLGSDEKELILLLWKVVDLANKKV----------GQLHEVLVRPDQLELTEDCKEETKIDAENLSSAPQLDQALRQFNQSVSNELNIGVGTSFCLCTD----------GQLHIRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVAAMTESLNFEKSDSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDSTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM---GTRYIEVYKATGEDFLKIAGGTSNEVAQFLSK---ENQVIVRMRGLPFTATAEEVVAFFGQH-CPITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKELLGKRYIELFRSTAAEVQQVL 413          
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Match: sp|Q9BJZ5|FUSIL_DROME (RNA-binding protein fusilli OS=Drosophila melanogaster OX=7227 GN=fus PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 2.655e-42
Identity = 135/475 (28.42%), Postives = 225/475 (47.37%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQ------------------------ASS--LLDPSANPDKIHISVPAREMTD----LLSSPSSHSTFK-LQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQN----LDEISNFLQI----------EKPGGTTMSII----CY------MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND---VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            +++ ++ TCG  G+ LG DE  I+ + F L+++S  Q +G K IL++                        ASS  L    AN      S     + +    +L    + +  K L +A+ E D+++    L       E+  V  G LPLR  LHRE   +++ L  Y+  + +L  E   + S         + ++   LQ           E  G   +S +     Y      M   I  L Q GH F +  ++    +P +  ++DE++ + ++  + + +++    I  FFRGLN+A GG+A+ +S  GRR+ + LI+F  +  RD+AL R KHH+    +R+I +      +F+ IAG  +   + +L +     Q++IR++GLPY  T  ++L+FF + D     V   + G+  V+K  G   GDAFV+F NE  A KA      +IG RY+E+F ST  E+ QV+
Sbjct:    7 VVSLYIATCGQNGSGLGSDEKEIILLVFVLLEVSTGQIVGTKQILVRPDGYFIKDRTISSSSDNSSVTNNTASSPPLAIGDANNGSGSTSGNGNSLENGSELILPIAEAQAAGKPLSEAIEEFDAYLRSLSL----HDTEIKLVTDGQLPLRQCLHREASAKDVELPAYYNRFSDLRKEFLRYKSGDLARALVPVKDVKKMLQAPTLPMPQSIAEMLGELNISSVEDNDFYIRESRDMVTVIQTLLQAGHKFAANELVNLVLEPGICSIDDEVDGNCIVRARGLPWQSSDQDIAKFFRGLNVAKGGVALCLSPLGRRNGEALIRFVCQEHRDMALKRHKHHI---GTRYIEVYRASGEDFLAIAGGASNEAQAFLSK---GAQVIIRMRGLPYDATAKQVLDFFTTGDTPPCHVLDGNEGVLFVKKPDGRATGDAFVLFANETDAPKALGRHRESIGQRYIELFRSTTAEVQQVL 471          
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Match: sp|B2RYJ8|ESRP2_RAT (Epithelial splicing regulatory protein 2 OS=Rattus norvegicus OX=10116 GN=Esrp2 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 6.980e-38
Identity = 129/437 (29.52%), Postives = 217/437 (49.66%), Query Frame = 3
Query:  591 PSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQ--AIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVIL---GHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLD----EISNFLQIEKPGGT---TMSIICYMSNAILQLTQL--GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKA-KNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            P    L+     T G  G DLG DET ++ + +Q+++  + Q   +   L+  +A++L            S   RE + L S+ S      L   L +    ++ +V +     +   P +L   G   LR VLH E   +N+ L + ++ +Y+L  E  +   S C   D     ++  L +E         +  +  M   IL L +   GHLF    V+K  Y+       D ++ + V+  + + +++    +  FF+GLNIA GG+A+ + ++GRR+ + LI+FED  QRD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   +DQ+++R++GLP++    ++L+F    +  V    +G+  V+   G   GDAF +F  E +AQ A +  KGM +G RY+E+F ST  E+ QV+
Sbjct:   25 PEPQSLVVLFGATAGALGPDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAAL------------SPQCREASGL-SADSLARAESLDKVLQQFSQLVSGDVAL-----LGGGPYVLCTDGQQLLRQVLHPEASRKNLVLPDTFFSFYDLRREFHVQHPSTCSARDLTVGTMAQDLGLETDATEDDFGVWEVKTMVAVILHLLEGPNGHLFSKPEVVKQKYETGPCKA-DVVDNETVVRARGLPWQSSDQDVARFFKGLNIARGGVALCLNAQGRRNGEALIRFEDSEQRDLALQRHKHHM---GVRYIEVYKATGEEFVKIAGGTSLEVARFLSR---EDQVILRLRGLPFSAGPADVLDFL-GPECPVTGGVDGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGM-LGKRYIELFRSTAAEVQQVL 434          
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Match: sp|Q5ZLR4|ESRP2_CHICK (Epithelial splicing regulatory protein 2 OS=Gallus gallus OX=9031 GN=ESRP2 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.691e-37
Identity = 123/441 (27.89%), Postives = 217/441 (49.21%), Query Frame = 3
Query:  606 LMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEV-SIFTSS---KCQNLDEISNFL-----QIEKPGG-----TTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKP 1883
            L+     T G  G  LG DE  ++ + +Q++DL + +            +L       D + +S   RE++ L +     +   L   L +    ++ ++ V    +  +     G L +R VLH ET  +N  L++ +Y +Y+L  E  + + SS   K Q +  ++ +L     + E+  G     T ++II  M +         H+F     +K  Y+      ++ ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +  QRD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T+ ++L F    +  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P  P
Sbjct:    9 LVVLFGATAGAYGAKLGSDERELILLVWQVVDLPSKKV----------GTLHKSLVKADNLELSDQCREVSGLTAEGLGKAE-PLDRVLQQFIQLVSSDLKVFGRNSYTLCSD--GQLLIRQVLHPETSKKNFLLSDCFYSFYDLRKEFHTCYPSSAAVKDQTIKTMAEYLGLGTDEAEEDFGVWQVKTMVAIIFSMLS-----ENCDHIFTDPETVKYKYETGPCSKSETVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFVNSEQRDLALERHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATQEDVLGFL-GPECPVTGGKEGLLFVKYPDGRPTGDAFVLFSCEEYAQNALKKHKEILGKRYIELFRSTAAEVQQVLNRYMSTPLIP 424          
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Match: sp|Q8K0G8|ESRP2_MOUSE (Epithelial splicing regulatory protein 2 OS=Mus musculus OX=10090 GN=Esrp2 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 7.387e-37
Identity = 127/437 (29.06%), Postives = 214/437 (48.97%), Query Frame = 3
Query:  591 PSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQ--AIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVIL---GHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLD----EISNFLQIEKPGGT---TMSIICYMSNAILQLTQL--GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKA-KNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            P    L+     T G  G DLG DET ++ + +Q+++  + Q   +   L+  +A++L            S   RE + L S+ S      L   L +    ++ +V +     +   P +L   G   LR VLH E   +N+ L + ++ +Y+L  E  +   S C   D     ++  L +E         +  +  M   IL L +   G LF    V+K  Y+       D ++ + V+  + + +++    +  FF+GLNIA GG+A+ + ++GRR+ + LI+F D  QRD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   +DQ+++R++GLP++    ++L F    +  V    +G+  V+   G   GDAF +F  E +AQ A +  KGM +G RY+E+F ST  E+ QV+
Sbjct:   25 PEPQSLVVLFGATAGALGPDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAAL------------SPQCREASGL-SADSLARAESLDKVLQQFSQLVSGDVAL-----LGGGPYVLCTDGQQLLRQVLHPEASRKNLVLPDTFFSFYDLRREFHMQHPSTCSARDLTVGTMAQDLGLETDATEDDFGVWEVKTMVAVILHLLEGSNGQLFSKPEVVKQKYETGPCSKADVVDNETVVRARGLPWQSSDQDVARFFKGLNIARGGVALCLNAQGRRNGEALIRFVDSEQRDLALQRHKHHM---GVRYIEVYKATGEEFVKIAGGTSLEVARFLSR---EDQVILRLRGLPFSAGPTDVLGFL-GPECPVTGGADGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGM-LGKRYIELFRSTAAEVQQVL 435          
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Match: sp|A1L1G1|ESRP1_DANRE (Epithelial splicing regulatory protein 1 OS=Danio rerio OX=7955 GN=esrp1 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.373e-36
Identity = 130/478 (27.20%), Postives = 229/478 (47.91%), Query Frame = 3
Query:  651 LGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQ----NLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQL---------GHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI---SAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADH 2033
            LG DE  I+Q+ +Q++DL+  +A        Q + LL     PD I +S   +E++ L +  +      L+ A+++++  +   V      T  +     G L +R VLH E   +NI L + ++ +++L  E      S+ +    NL  +++ L +        S+  + +  + Q+  +          H F     +   ++       + ++ + V+  + + +++    I  FFRGLNIA GG A+ + ++GRR+ + L++FE +  RD+AL R KHHM     R+I +      +F+KIAG  +  V  +L +   ++QI++R++GLP+  T  ++L FF S    V     GI  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV+   S+A  IP  P     +  P   V Q    ++   V      + +P +AS  D + +L ++
Sbjct:   23 LGSDEKEIVQLVWQVVDLATKKAG-------QVNELL---VKPDHIELSEECQELSGL-TDEALTPVDPLEVAIDQLNQRLCAEVDTGAGNTFYL--CTDGQLHVRQVLHPEASSKNILLPDCFFSFFDLRKEFKKEFPSEVKLKDLNLQVMADHLNV----AVDSSLHAFTAYKVQQMVDIVLALISEPTCHEFTFPEKVNEKFETGTCSKMERVDDNTVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCLNAQGRRNGEALVRFESEEHRDLALQRHKHHM---GGRYIEVYKATGEDFLKIAGGTSNEVASFLSR---ENQIIVRMRGLPFNATAEQVLQFF-SPACPVTDGSEGILFVRFPDGRPTGDAFVLFSCEEHAQNALKKHKDMLGKRYIELFKSTAAEVQQVLNKYSSAPLIPVAPSPILSVVAPPTFVPQ---TAAVPGVRDCVRLRGLPYDASIQDILVFLGEY 473          
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Match: A0A267EB47 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017860g1 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 7.928e-57
Identity = 150/457 (32.82%), Postives = 231/457 (50.55%), Query Frame = 3
Query:  561 NDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIH-----------ISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNF------LQIE---KPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQN 1868
            N  N    + P    L+A HL TCG QG ++G DE  I  + + + D+ +N+      I+     L+ P  NP +             IS   R  T L S+ S HS   L+  L E+D F+    +  +        V+ G  P+R V H ET  + I+L  + Y Y   FD    F   +    D I +       L+++    P   T   I  MS  I +L   GH F     +   Y P +    D ++ + V+  + + ++     I  FFRGLNI+ GGIA+++S+ GRR+ + LI+F+ +  RDIAL + +HHM+    R+I +     R+F+ +AG + +  + +L ++    Q L+R++GLPYTV+  EIL+FF+  +  VQF   G+  V    G   GDAFVIFENE +A++A       IGNRY+E+F STP E+NQV+ + +N
Sbjct:   68 NPGNSNSSIMPQPDYLVALHLTTCGKQGEEIGTDEAPICLIAYLIHDVRHNK------IIAVEQHLVKPQVNPGQTGSDSSEEDGLATISEECRSETGL-SADSFHSASYLESVLEEMDKFLRNKGIHPESGGKTFTLVLEGQHPMRLVFHPETCSKKISLEQFPYFYS-FFDLRKEFLKGRNSEPDTIVSLKDMLDSLEMQFDNSPDYGTRQCIA-MSRVISRLLNDGHTFKEPEKVNQFYYPAIVRKTDTVDDESVVRARGLPWQATDADIHKFFRGLNISAGGIALVLSKVGRRNGEALIRFDSQEHRDIALKKHRHHMQ---QRYIEVYRATGRDFVAVAGADTKEGENFLAKLTEPTQSLVRMRGLPYTVSADEILDFFRKAECPVQFDSEGVLFVNHKDGRATGDAFVIFENEILAERALQNHRQHIGNRYIELFKSTPAEVNQVLCSFKN 512          
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Match: A0A267FI41 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034309g1 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.155e-57
Identity = 150/457 (32.82%), Postives = 231/457 (50.55%), Query Frame = 3
Query:  561 NDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIH-----------ISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNF------LQIE---KPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQN 1868
            N  N    + P    L+A HL TCG QG ++G DE  I  + + + D+ +N+      I+     L+ P  NP +             IS   R  T L S+ S HS   L+  L E+D F+    +  +        V+ G  P+R V H ET  + I+L  + Y Y   FD    F   +    D I +       L+++    P   T   I  MS  I +L   GH F     +   Y P +    D ++ + V+  + + ++     I  FFRGLNI+ GGIA+++S+ GRR+ + LI+F+ +  RDIAL + +HHM+    R+I +     R+F+ +AG + +  + +L ++    Q L+R++GLPYTV+  EIL+FF+  +  VQF   G+  V    G   GDAFVIFENE +A++A       IGNRY+E+F STP E+NQV+ + +N
Sbjct:   68 NPGNSNSSIMPQPDYLVALHLTTCGKQGEEIGTDEAPICLIAYLIHDVRHNK------IIAVEQHLVKPQVNPGQTGSDNSEEDGLATISEECRSETGL-SADSFHSASYLESVLEEMDKFLRNKGIHPESGGKTFTLVLEGQHPMRLVFHPETCSKKISLEQFPYFYS-FFDLRKEFLKGRNSEPDTIVSLKDMLDSLEMQFDNSPDYGTRQCIA-MSRVISRLLNDGHTFKEPEKVNQFYYPAIVRKTDTVDDESVVRARGLPWQATDADIHKFFRGLNISAGGIALVLSKVGRRNGEALIRFDSQEHRDIALKKHRHHMQ---QRYIEVYRATGRDFVAVAGADTKEGENFLAKLTEPTQSLVRMRGLPYTVSADEILDFFRKAECPVQFDSEGVLFVNHKDGRATGDAFVIFENEILAERALQNHRQHIGNRYIELFKSTPAEVNQVLCSFKN 512          
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Match: J9JKD1 (RRM domain-containing protein OS=Acyrthosiphon pisum OX=7029 GN=100159234 PE=4 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 2.272e-50
Identity = 155/562 (27.58%), Postives = 285/562 (50.71%), Query Frame = 3
Query:  564 DINKKLK---MNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSAN--PDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSS-KCQNLDEIS---NFLQI--EKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMS-EGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND--VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPK---QNKQITKPTDSVNQENIKSS------------QKAVMSGTVTKYI-----PMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKAL 2147
            D+ K +K   M  +   L A ++ T G QGN LG DE  I+ + + ++D++ N  +G +  L++ + + D + N   D++   +   E           S   LQDA+++ D+++    L  + QT     V  G LP+R  LHRE+  ++I L  Y+  +++L  + S F ++ + Q  + I+   N+L+I  E      ++ +  M N + +L   GH F+S  +++   +P +   N+E++ + V+  + + +++    I  FFRGLNIA GG+A+ +S  GRR+ + +++F ++  RD+A+ R KHH+    SR+I +   +  +F+ +AG  +   + +L +     Q+++R++GLPY  T  +++ FF++ +    V    +G+  V+K  G   GDAFV+F +E  A KA +     IG RY+E+F ST  E+ QV++ A +   +      N  IT P  +    N   +            Q  + SGT    I     P EA+    + +L +H    +      +Y+ +G+ S  AF + +++ SA   A+
Sbjct:   29 DVCKSIKVTNMRAATPYLCALYVATAGHQGNLLGSDEQEIVLLIYVVVDMTTNTVVGIQQYLVKPTEV-DQNENMLSDQVTSDIGITEKM------VKTSGIPLQDAIDKFDTYVKS--LNIEPQTPMFRIVTDGQLPIRQCLHRESSIKDIELPEYYNVFHDLRKDFSKFYNAPQDQTFNSITDLVNYLEITHEIDSQFYVAEVKDMVNIVQRLIADGHTFNSPEIVQLKLEPGICWKNEEVDNNCVVRARGLPWQSSDQDIAKFFRGLNIAKGGVALCLSAHGRRNGEAVVRFVNQEHRDMAMKRHKHHI---GSRYIEVYKANGEDFINVAGGNSSEAQTFLTK---GAQVIVRMRGLPYDCTAKDVITFFENGEQTCSVMDGEDGVLFVKKPDGRATGDAFVLFADEDDAPKALSKHRDLIGTRYIELFRSTTAEVQQVLNRAMDPSVRSTASDSNGNITTPVTTTAGVNNSPTALLGHVPLLPLPQHVITSGTRKDCIRLRGLPYEANVEHILEFLGEHSKNIVFQGVHMVYNSVGHASGEAFIQMNNEGSAAQAAM 575          
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Match: A0A5E4N7I8 (RRM domain-containing protein OS=Cinara cedri OX=506608 GN=CINCED_3A017892 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 4.860e-50
Identity = 152/564 (26.95%), Postives = 284/564 (50.35%), Query Frame = 3
Query:  549 SELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSAN--PDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQ----NLDEISNFLQI--EKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMS-EGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND--VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPK---QNKQITKPTDSVNQENIKSS------------QKAVMSGTVTKYI-----PMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKAL 2147
            S  N++  K   M  +   L A ++ T G QGN LG DE  I+ + + ++D++ N  +G +  L++ + + D + N   D++   +   E           S   LQDA+ + D+++    L  + Q      V  G LP+R  LHRE   ++I L  Y+  +++L  + S F ++  +    ++ ++ N+L+I  E      ++ +  M N + +L   GH F+S  +++   +P +   N+E++ + V+  + + +++    I  FFRGLNIA GG+A+ +S  GRR+ + +++F ++  RD+A+ R KHH+    SR+I +   +  +F+ +AG  +   + +L +     Q+++R++GLPY  T  +++ FF++ +    V  + +G+  V+K+ G   GDAFV+F +E  A KA +     IG RY+E+F ST  E+ QV++ A +   +      N  IT P  +    N   +            Q  + SGT    I     P EA+    + +L +H    +      +Y+ +G+ S  AF + +++ SA   A+
Sbjct:   31 STCNSNSVKVGNMRAATPYLCALYVATAGYQGNLLGSDEQEIVLLIYVVVDMTTNAIVGIQQYLVKPTEV-DQNENMLSDQVTSDIGITEKM------VKTSGIPLQDAIEKFDTYVKS--LNIEPQAPMFRIVTDGQLPIRQCLHREASIKDIELPEYYNVFHDLRKDFSKFYNAPQEQTFNSITDLVNYLEITHEIDSQFYVAEVKDMVNIVQRLIADGHTFNSPEIVQLKLEPGICWKNEEVDNNCVVRARGLPWQSSDQDIAKFFRGLNIAKGGVALCLSAHGRRNGEAVVRFVNQEHRDMAMKRHKHHI---GSRYIEVYKANGEDFINVAGGNSSEAQAFLTK---GAQVIMRMRGLPYDCTAKDVITFFENGEQTCSVMDAEDGVLFVKKTDGRATGDAFVLFADEDDASKALSKHRDLIGTRYIELFRSTTAEVQQVLNRAMDPTVRSTVSDSNGNITTPVTTTAGVNNSPTAILGHMPLLPLPQHVITSGTRKDCIRLRGLPYEANVEHILEFLGEHSKNIVFQGVHMVYNSVGHASGEAFIQMNNEGSAAQAAM 579          
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Match: A0A0V0J5S0 (RNA-binding protein fusilli (Fragment) OS=Schistocephalus solidus OX=70667 GN=FUSIL PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 9.092e-50
Identity = 109/273 (39.93%), Postives = 161/273 (58.97%), Query Frame = 3
Query: 1065 SSKCQNLD----EISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQN 1868
            SS C ++D    E+ N L   KPG   M     ++   L++T  G  +     I   Y+P +  V DE+E D+V+  + + ++   + I  FFRGLNIA GGIA+++++ GRR+ + LI+F D+ QRD+AL + KHHM   N R+I I +    +F+ +AG E E  + +L++     Q LIR++GLPYTVT  +IL FF + + EVQF   G+  V +  G   GDAF +F N+  AQKA       IGNRY+E+F STP E+NQV++   N
Sbjct:  457 SSCCTHMDYPGDEMRNSL---KPGYWPMEYCRNLAKLCLKMTLDGVEWKFYECIFAYYQPGIVKVTDEVEDDVVVRARGLPWQATDSDIQFFFRGLNIAPGGIALVLNKSGRRNGEALIRFTDREQRDLALRKHKHHM---NQRYIEIYMAQGSDFISVAGGETEEAEKFLQKFTEPSQALIRMRGLPYTVTAEQILEFFSNANCEVQFGEEGVLFVNRHDGRATGDAFALFANDHEAQKALKNHRQHIGNRYIELFRSTPAEVNQVMNVVLN 723          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:NCBI gene;Acc:103047742])

HSP 1 Score: 162.54 bits (410), Expect = 5.587e-41
Identity = 132/505 (26.14%), Postives = 240/505 (47.52%), Query Frame = 3
Query:  579 LKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQ----NLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLG---------HLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVT------KYIPMEASDNDFVRYLADH 2033
            + +NP   +L  F   TCG  G  LG DET  +Q+ +Q+++L   +      +L++          P+ + +S    E++ + +   S S   L++ALN+ +  +     ++ D          G L LR VLH E   +N+ L   ++ +++L  E      S+      +L  ++++L + +     +    + +  I Q++ +          H+F     +   ++       + I+ + V+  + + +++    +  FFRGLNIA GG A+ + ++GRR+ + L++FE +  RD+AL R KHHM    SR+I +      +F+KIAG  +  V  +L +   ++Q+++R++GLP+T T  ++L FF S    V     GI  V+   G   GDAFV+F  E  A+ A       +G RY+E+F ST  E+ QV++   + P  P     I      V Q     S  A+ +   T      + +P +AS  D + +L ++
Sbjct:    1 MTVNPENLVL--FFTTTCGASGELLGSDETEAVQLVWQVLNLVTKKPGRVNEVLVK----------PESLCVSEECVEVSGVTTEALS-SAAPLEEALNQFNERLCSE--INTDAANSFCLCTDGQLHLRQVLHPEASNKNVLLPECFFSFFDLRKEFKKCFPSEADHKELDLKFMTDYLNLSEDSSDQV----FTAQKIHQMSSIAQALISEPTCHVFSCPEKVNEKFETGTCSKMERIDDNTVIRARGLPWQSSDQDVARFFRGLNIAKGGAALCLNAQGRRNGEALVRFESEEHRDLALQRHKHHM---GSRYIEVYKATGEDFLKIAGGTSNEVANFLSR---ENQVIVRMRGLPFTATAEQVLQFF-SPSCPVTDDGEGILFVRFPDGRPTGDAFVLFSCEEYAENALKKHKEILGKRYIELFRSTAAEVQQVLNKYSSAPLIPVAPSPILP---IVPQPTFVPSPAAIAAVVGTRDCLRLRGLPYDASVQDILLFLGEY 476          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:103029380])

HSP 1 Score: 141.354 bits (355), Expect = 3.430e-34
Identity = 77/231 (33.33%), Postives = 128/231 (55.41%), Query Frame = 3
Query: 1188 HLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            H F S   +K  ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T+ ++L F    D  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  197 HKFSSLEPVKYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALERHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATQQDVLGFL-GPDSPVTDGTEGLLFVKFPDGRPTGDAFVLFACEQYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:103029380])

HSP 1 Score: 141.354 bits (355), Expect = 3.552e-34
Identity = 77/231 (33.33%), Postives = 128/231 (55.41%), Query Frame = 3
Query: 1188 HLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            H F S   +K  ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T+ ++L F    D  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  197 HKFSSLEPVKYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALERHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATQQDVLGFL-GPDSPVTDGTEGLLFVKFPDGRPTGDAFVLFACEQYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:103029380])

HSP 1 Score: 141.354 bits (355), Expect = 3.552e-34
Identity = 77/231 (33.33%), Postives = 128/231 (55.41%), Query Frame = 3
Query: 1188 HLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            H F S   +K  ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T+ ++L F    D  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  197 HKFSSLEPVKYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALERHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATQQDVLGFL-GPDSPVTDGTEGLLFVKFPDGRPTGDAFVLFACEQYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:103029380])

HSP 1 Score: 141.354 bits (355), Expect = 4.176e-34
Identity = 77/231 (33.33%), Postives = 128/231 (55.41%), Query Frame = 3
Query: 1188 HLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            H F S   +K  ++       + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F +   RD+AL R KHHM    SR+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T+ ++L F    D  V     G+  V+   G   GDAFV+F  E  AQ A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  197 HKFSSLEPVKYKFESGACSKTEAVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFINSEHRDMALERHKHHM---GSRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATQQDVLGFL-GPDSPVTDGTEGLLFVKFPDGRPTGDAFVLFACEQYAQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Sea Lamprey
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:572992])

HSP 1 Score: 135.576 bits (340), Expect = 2.603e-33
Identity = 74/215 (34.42%), Postives = 118/215 (54.88%), Query Frame = 3
Query: 1242 HVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKP 1883
            H N  +  D V+ ++ + +++    I  FF+GLNIA GGIA+ ++  GRR+ + L+  +D+ QRD+AL R KHHM    SR+I +    + EF KIA   +  V  +L +   + Q+++R++GLP+     ++L FF +    V     G+  V+   G   GDAFV+F  E  A  A       +G RY+E+F ST  E+ QV++   + P  P
Sbjct:  127 HYNS-VHGDTVVRVRGLPWQSSDQDIALFFKGLNIAKGGIALCLNPLGRRNGEALVMLQDEQQRDLALSRHKHHM---GSRYIEVYRSSAEEFSKIAVGASSEVSQFLAR---EGQVIVRMRGLPFAAAPDDVLAFFGAA-CPVTAGRQGLLFVRHPDGRPTGDAFVLFAGEECAAAALAKHRHMLGKRYIELFRSTAAELQQVLNRVMSTPLLP 333          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Sea Lamprey
Match: HNRNPH1 (heterogeneous nuclear ribonucleoprotein H1 [Source:HGNC Symbol;Acc:HGNC:5041])

HSP 1 Score: 73.1738 bits (178), Expect = 1.074e-13
Identity = 57/200 (28.50%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 1251 DEIEPDIVLMIKPIDYKTPINQIIPFFRG---LNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEM 1841
            DE+    V+ ++ + +     ++I F  G   +N ADG       EGR S +  ++ E +   D AL RD  +M     R+I +      E   +    N+   V L +   + +  +R++GLP++ +K EI  FF      ++   NGI L     G   G+AFV F ++  A+KA       IG+RY+E+F S   E+
Sbjct:    5 DEVVEGFVVRLRGLPWSCSSEEVIKFLSGCAIVNSADGVHFTNSREGRPSGEAFVELESEEDLDRALERDHKNM---GHRYIEVFRSKLSELNWVL---NQQNPVALPE-SGEAEGCVRLRGLPFSCSKEEIAQFFTG----LEIVPNGITLPVDYQGRSTGEAFVQFASQEAAEKALGKHKERIGHRYIEVFKSNRGEV 193          

HSP 2 Score: 51.9878 bits (123), Expect = 5.399e-7
Identity = 26/94 (27.66%), Postives = 49/94 (52.13%), Query Frame = 3
Query: 1572 ETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            E  +  ++R++GLP++ +  E++ F       +  S +G+       G  +G+AFV  E+E    +A       +G+RY+E+F S   E+N V+
Sbjct:    6 EVVEGFVVRLRGLPWSCSSEEVIKFLSG--CAIVNSADGVHFTNSREGRPSGEAFVELESEEDLDRALERDHKNMGHRYIEVFRSKLSELNWVL 97          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Nematostella
Match: EDO47286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMK7])

HSP 1 Score: 125.561 bits (314), Expect = 2.430e-31
Identity = 65/199 (32.66%), Postives = 115/199 (57.79%), Query Frame = 3
Query: 1266 DIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMS-EGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISA 1859
            D VL  + + ++     +  FFRGLNI  GGIA  ++ +GRR+ +  I+FE+   RD+AL R K H+    +R+I +    +++F++I       + +    + T  +++IR++GLP++    +++ FF  +DV V     GI +V+  +G+  GDAFV+FE E   + A       +G+RY+E+F S+  E+ QV+S+
Sbjct:   10 DTVLRARGLPWQASDQDVANFFRGLNIPRGGIAFCLNMQGRRNGEAFIRFENGDHRDLALRRHKMHL---GTRYIEVYKASAQDFLRIV----RGMSIAANFVSTNAEVIIRMRGLPFSTKAADVVRFF-GDDVPVYRGEGGILMVRGRNGKATGDAFVLFETEEHGRAALKKHREVLGSRYVELFRSSQSEVQQVLSS 200          

HSP 2 Score: 51.2174 bits (121), Expect = 1.010e-6
Identity = 24/93 (25.81%), Postives = 46/93 (49.46%), Query Frame = 3
Query: 1581 DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISA 1859
            D  ++R +GLP+  +  ++ NFF+  ++       GI       G  NG+AF+ FEN      A     M +G RY+E++ ++  +  +++  
Sbjct:    9 DDTVLRARGLPWQASDQDVANFFRGLNI----PRGGIAFCLNMQGRRNGEAFIRFENGDHRDLALRRHKMHLGTRYIEVYKASAQDFLRIVRG 97          

HSP 3 Score: 50.0618 bits (118), Expect = 2.481e-6
Identity = 26/92 (28.26%), Postives = 53/92 (57.61%), Query Frame = 3
Query: 1590 LIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFV-IFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAA 1862
             +R++GLP++ T  ++L+F K +   V  +  G+ +V  + G  +GDA+V +   +  A  A  L    +G RY+E+F  +  +++ VI+++
Sbjct:  247 CLRLRGLPFSATVQDVLDFLKEHAAYV--APGGVHMVYNTQGRPSGDAYVQLLSPDFAAAAANELHKHHMGERYIEVFPCSNSDISAVIASS 336          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Nematostella
Match: EDO37823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEP3])

HSP 1 Score: 63.5438 bits (153), Expect = 1.354e-10
Identity = 48/200 (24.00%), Postives = 89/200 (44.50%), Query Frame = 3
Query: 1266 DIVLMIKPIDYKTPINQIIPFFRGLNIADG---GIAVIMS-EGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            + V+  + + +      I  FF+  NI  G   G+      +GR S +  ++F  +   + AL  +  HM     R+I +    + E   +       +K      +   + +++++GLPY  +K EI  FF      ++   NGI +     G+  G+ FV F +  +A +A       IG+RY+EIF S+  ++  V+
Sbjct:    4 ECVVRARGLPWSATPEDIQNFFKDCNIVGGPQNGVHFTFGIDGRPSGECFVQFVSEKDVEKALEMNNEHM---GKRYIEVFRSKAEEMEWV-------IKRMGPPSDRDQEAVVKLRGLPYGCSKEEIAQFFTG----LEIVPNGITITLDEEGKTTGEGFVEFASPEIAGQAMQKHKEKIGHRYIEIFKSSKSDIKYVL 189          

HSP 2 Score: 59.3066 bits (142), Expect = 3.158e-9
Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 1581 DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            ++ ++R +GLP++ T  +I NFFK  ++ V    NG+       G  +G+ FV F +E   +KA  +    +G RY+E+F S   EM  VI
Sbjct:    3 NECVVRARGLPWSATPEDIQNFFKDCNI-VGGPQNGVHFTFGIDGRPSGECFVQFVSEKDVEKALEMNNEHMGKRYIEVFRSKAEEMEWVI 92          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:NCBI gene;Acc:101168983])

HSP 1 Score: 139.043 bits (349), Expect = 1.824e-33
Identity = 77/218 (35.32%), Postives = 122/218 (55.96%), Query Frame = 3
Query: 1248 NDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND-----VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKP 1883
             +++  + V+  + + +++    I  FFRGLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG     V ++L +   +DQI++R++GLP+T T  ++L FF   D       V    +GI  V+   G   GDAFV+F  E  A  A       +G RY+E+F ST  E+ QV++   + P  P
Sbjct:  186 KEKVCDNTVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTTNEVAMFLSR---EDQIIVRMRGLPFTATYEQVLAFFSPKDGLNETCPVSGGKDGILFVRYPDGRPTGDAFVLFSCEEHALCALRKHKEILGKRYIELFKSTAAEVQQVLNRYSSTPLIP 397          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:101173047])

HSP 1 Score: 138.272 bits (347), Expect = 2.971e-33
Identity = 74/217 (34.10%), Postives = 122/217 (56.22%), Query Frame = 3
Query: 1233 IVFHVNDE-IEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
            ++ H   E ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F D   RD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  E+L+F    +  V     G+  V+   G   GDAFV+F  E   Q A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  168 LLAHCKTEPVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFIDSEHRDLALERHKHHM---GCRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATSQEVLSFL-GPESPVTDGAEGLLFVKYPDGRPTGDAFVLFSCEEYVQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 377          

HSP 2 Score: 50.8322 bits (120), Expect = 7.445e-6
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query: 1575 TQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEG----VAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            T  +  +R++GLPYT    +IL F   + V+++   +G+ +V    G  +GDAF+  ++      VAQK       T+ +RY+E+F  +  EM+ V+
Sbjct:  400 TSTRDCVRLRGLPYTAGIEDILEFMGEHTVDIK--PHGVHMVLNQQGRPSGDAFIQMKSADRAFMVAQKCHK---KTMKDRYVEVFQCSTEEMSIVL 491          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:NCBI gene;Acc:101168983])

HSP 1 Score: 138.658 bits (348), Expect = 3.414e-33
Identity = 77/217 (35.48%), Postives = 122/217 (56.22%), Query Frame = 3
Query: 1251 DEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND-----VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKP 1883
            +++  + V+  + + +++    I  FFRGLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG     V ++L +   +DQI++R++GLP+T T  ++L FF   D       V    +GI  V+   G   GDAFV+F  E  A  A       +G RY+E+F ST  E+ QV++   + P  P
Sbjct:  239 EKVCDNTVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTTNEVAMFLSR---EDQIIVRMRGLPFTATYEQVLAFFSPKDGLNETCPVSGGKDGILFVRYPDGRPTGDAFVLFSCEEHALCALRKHKEILGKRYIELFKSTAAEVQQVLNRYSSTPLIP 449          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Match: esrp1 (epithelial splicing regulatory protein 1 [Source:NCBI gene;Acc:101168983])

HSP 1 Score: 138.272 bits (347), Expect = 3.604e-33
Identity = 77/217 (35.48%), Postives = 122/217 (56.22%), Query Frame = 3
Query: 1251 DEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSND-----VEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKP 1883
            +++  + V+  + + +++    I  FFRGLNIA GG A+ + ++GRR+ + L++F  +  RD+AL R KHHM  GN R+I +      +F+KIAG     V ++L +   +DQI++R++GLP+T T  ++L FF   D       V    +GI  V+   G   GDAFV+F  E  A  A       +G RY+E+F ST  E+ QV++   + P  P
Sbjct:  239 EKVCDNTVIRARGLPWQSSDQDIARFFRGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHM--GN-RYIEVYKATGEDFLKIAGGTTNEVAMFLSR---EDQIIVRMRGLPFTATYEQVLAFFSPKDGLNETCPVSGGKDGILFVRYPDGRPTGDAFVLFSCEEHALCALRKHKEILGKRYIELFKSTAAEVQQVLNRYSSTPLIP 449          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Match: esrp2 (epithelial splicing regulatory protein 2 [Source:NCBI gene;Acc:101173047])

HSP 1 Score: 137.887 bits (346), Expect = 4.902e-33
Identity = 72/211 (34.12%), Postives = 119/211 (56.40%), Query Frame = 3
Query: 1248 NDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIM-SEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPF 1877
             + ++ + V+  + + +++    I  FF+GLNIA GG+A+ + ++GRR+ + L++F D   RD+AL R KHHM     R+I +      EF+KIAG  +  V  +L +   ++Q++IR++GLP+T T  E+L+F    +  V     G+  V+   G   GDAFV+F  E   Q A       +G RY+E+F ST  E+ QV++   + P 
Sbjct:  217 TEPVDSETVIRARGLPWQSSDQDIARFFKGLNIAKGGVALCLNAQGRRNGEALVRFIDSEHRDLALERHKHHM---GCRYIEVYKATGEEFLKIAGGTSNEVAQFLSK---ENQVIIRMRGLPFTATSQEVLSFL-GPESPVTDGAEGLLFVKYPDGRPTGDAFVLFSCEEYVQNALKKHKQILGKRYIELFRSTAAEVQQVLNRYMSTPL 420          

HSP 2 Score: 50.8322 bits (120), Expect = 7.338e-6
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query: 1575 TQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEG----VAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            T  +  +R++GLPYT    +IL F   + V+++   +G+ +V    G  +GDAF+  ++      VAQK       T+ +RY+E+F  +  EM+ V+
Sbjct:  443 TSTRDCVRLRGLPYTAGIEDILEFMGEHTVDIK--PHGVHMVLNQQGRPSGDAFIQMKSADRAFMVAQKCHK---KTMKDRYVEVFQCSTEEMSIVL 534          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Match: SMESG000044612.1 (SMESG000044612.1)

HSP 1 Score: 1221.45 bits (3159), Expect = 0.000e+0
Identity = 630/640 (98.44%), Postives = 631/640 (98.59%), Query Frame = 3
Query:  468 MTSGNLKRKXXXXXXXXXXKSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKXXXXXXXXLPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLPNHSVQMPQPMNISNPLNFPFL 2387
            MTSGNLKRKQQQQ  +   KSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVL SDDQTIEVIPVILGHLPLRSVLHRETRFRNINLNNYWYHYYNLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKEVTVETVELPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLP HSVQMPQPMNISNPLNFP  
Sbjct:    1 MTSGNLKRKQQQQLDQYQ-KSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLFSDDQTIEVIPVILGHLPLRSVLHRETRFRNINLNNYWYHYYNLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKEVTVETVELPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLPYHSVQMPQPMNISNPLNFPIF 639          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Match: SMESG000044612.1 (SMESG000044612.1)

HSP 1 Score: 1196.8 bits (3095), Expect = 0.000e+0
Identity = 630/692 (91.04%), Postives = 631/692 (91.18%), Query Frame = 3
Query:  468 MTSGNLKRKXXXXXXXXXXKSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEI----------------------------------------------------LNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKXXXXXXXXLPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLPNHSVQMPQPMNISNPLNFPFL 2387
            MTSGNLKRKQQQQ  +   KSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVL SDDQTIEVIPVILGHLPLRSVLHRETRFRNINLNNYWYHYYNLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEI                                                    LNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKEVTVETVELPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLP HSVQMPQPMNISNPLNFP  
Sbjct:    1 MTSGNLKRKQQQQLDQYQ-KSDNLYLDSELNNDINKKLKMNPSKTILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDPSANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLFSDDQTIEVIPVILGHLPLRSVLHRETRFRNINLNNYWYHYYNLFDEVSIFTSSKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEIVSELNFLYFMSSLKVLLIFVYIIMCISAHPQIHRADPGLNYLWLDKRNEIIQLNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSGTVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNSSDASATIKALRDKPFKVESSNKEVTVETVELPLVSKLEERPAMYSQVLHNMYPNSLPVNYVASLQNMLPYHSVQMPQPMNISNPLNFPIF 691          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Match: SMESG000023329.1 (SMESG000023329.1)

HSP 1 Score: 204.912 bits (520), Expect = 9.635e-55
Identity = 143/434 (32.95%), Postives = 226/434 (52.07%), Query Frame = 3
Query:  603 ILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQAS----SLLDPSANPDKIHISVPARE--MTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVS----IFTSSKCQNLDEI---SNFLQIEKPGGTTMSIICY-MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISA 1859
            IL+ FH+VT G Q +DLG DET+I+ +   + D   +++I  KL   Q S    S+ +   N +++       E  + D L + +   +F L+D    + S     + +      +   V  G  P+R   H E   RN      + +Y+N  D        +   K   LDE+    N   I   GG    I C+ M   I ++T  G  +     +   Y   +   +D +  ++V+  + + ++   + I  FFRGLNI  GGIA+++S+ GRR+ + LI+F+ +  RD+AL + KHHM     R+I + +   R+F+++AG + E  +V+L++I    Q LIR++GLPYT T  +IL FF S +  V+F  +GI  V    G   GDAFVIFENE VA++A       IGNRY+E+F STP E+NQV+++
Sbjct:    4 ILVVFHIVTAGKQADDLGTDETSIVLITIAIYDTIQSKSI--KLEQYQVSGRHESMTEEEKNQNRLLTEDCCLETNLNDSLFTGAQPLSFVLKDLHKSLIS-----IGIPSISQCDFCLVTDGQAPMRLAFHPEIA-RNNIDLTNYDYYFNFIDLRKEFQRFYNKEKSLVLDEMIQECNIF-INDSGGNYGIIQCHKMLEIIRKMTDDGFKWKETETVAKHYYSAIVRKSDYVSDEVVVRARGLPWQATDSDINKFFRGLNIEKGGIALVLSKVGRRNGEALIRFKSREHRDMALRKHKHHM---GQRYIEVYMATGRDFIQVAGGDTEEAEVFLQRITKPSQTLIRMRGLPYTATANQILEFFTSTNCPVEFGEDGILFVNHKDGRATGDAFVIFENEEVAEEALKSHRENIGNRYIELFKSTPAEVNQVMNS 425          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Match: SMESG000023329.1 (SMESG000023329.1)

HSP 1 Score: 129.798 bits (325), Expect = 2.103e-32
Identity = 106/360 (29.44%), Postives = 178/360 (49.44%), Query Frame = 3
Query:  603 ILMAFHLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQAS----SLLDPSANPDKIHISVPARE--MTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSDDQTIEVIPVILGHLPLRSVLHRETRFRXXXXXXXXXXXXXLFDEVS----IFTSSKCQNLDEI---SNFLQIEKPGGTTMSIICY-MSNAILQLTQLGHLFHSKHVIKNGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSE-GRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEI 1637
            IL+ FH+VT G Q +DLG DET+I+ +   + D   +++I  KL   Q S    S+ +   N +++       E  + D L + +   +F L+D    + S     + +      +   V  G  P+R   H E   RN      + +Y+N  D        +   K   LDE+    N   I   GG    I C+ M   I ++T  G  +     +   Y   +   +D +  ++V+  + + ++   + I  FFRGLNI  GGIA+++S+ GRR+ + LI+F+ +  RD+AL + KHHM     R+I + +   R+F+++AG + E  +V+L++I    Q LIR++GLPYT T  +I
Sbjct:    4 ILVVFHIVTAGKQADDLGTDETSIVLITIAIYDTIQSKSI--KLEQYQVSGRHESMTEEEKNQNRLLTEDCCLETNLNDSLFTGAQPLSFVLKDLHKSLIS-----IGIPSISQCDFCLVTDGQAPMRLAFHPEIA-RNNIDLTNYDYYFNFIDLRKEFQRFYNKEKSLVLDEMIQECNIF-INDSGGNYGIIQCHKMLEIIRKMTDDGFKWKETETVAKHYYSAIVRKSDYVSDEVVVRARGLPWQATDSDINKFFRGLNIEKGGIALVLSKVGRRNGEALIRFKSREHRDMALRKHKHHM---GQRYIEVYMATGRDFIQVAGGDTEEAEVFLQRITKPSQTLIRMRGLPYTATANQI 351          

HSP 2 Score: 53.1434 bits (126), Expect = 5.960e-7
Identity = 32/114 (28.07%), Postives = 58/114 (50.88%), Query Frame = 3
Query: 1581 DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSV 1922
            D++++R +GLP+  T  +I  FF+  ++E      GI LV    G  NG+A + F++      A       +G RY+E++ +T  +  QV  A  +        ++ITKP+ ++
Sbjct:  229 DEVVVRARGLPWQATDSDINKFFRGLNIE----KGGIALVLSKVGRRNGEALIRFKSREHRDMALRKHKHHMGQRYIEVYMATGRDFIQV--AGGDTEEAEVFLQRITKPSQTL 336          
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Match: SMESG000055008.1 (SMESG000055008.1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.538e-8
Identity = 53/206 (25.73%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 1275 LMIKPIDYKTPINQIIPFFRGLNIADGGIAVIMSEGRRSNKILIKF-EDKVQRDIALLRDKHHMEPGNSRFITISVHDSREFMK------IAGYENESVKVYLEQIETQ------DQILIRIKGLPYTVTKPEILNFFKSNDVEVQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEIFYSTPPEMNQVI 1853
            + ++ + Y+T ++ II F   + I  G   +     +R+ +    F E + + D+   +D+H+   G  R+I +      + +K      +A  EN   +   E+  +Q      +  ++R+KGLPY  +K +I  FF+     ++   +G+ ++   +G   GDAFV F     A+ AK   G  I +RY+E+F S   E N  I
Sbjct:    6 IKLRGMPYRTTMDDIIEFLPDIGIKGGKRGIHFPISQRNIEWGEAFIELESEEDLNKAKDRHNQHMGR-RYIEVFSSTKADMLKACKDMPVAVNENGRERPRRERSRSQVHERINENYVLRLKGLPYNASKTDIKEFFQG----LKILPDGMSILVDHNGRALGDAFVQFATYHDAKLAKERNGNKIAHRYIEVFDSNIEEANNEI 206          
The following BLAST results are available for this feature:
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ESRP22.605e-3728.77epithelial splicing regulatory protein 2 [Source:H... [more]
ESRP13.136e-3627.42epithelial splicing regulatory protein 1 [Source:H... [more]
ESRP14.136e-3627.42epithelial splicing regulatory protein 1 [Source:H... [more]
ESRP15.224e-3627.42epithelial splicing regulatory protein 1 [Source:H... [more]
ESRP15.369e-3627.42epithelial splicing regulatory protein 1 [Source:H... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sym-26.528e-2727.76RNA-binding protein sym-2 [Source:UniProtKB/Swiss... [more]
sym-27.143e-1327.46RNA-binding protein sym-2 [Source:UniProtKB/Swiss... [more]
sym-27.143e-1327.46RNA-binding protein sym-2 [Source:UniProtKB/Swiss... [more]
hrpf-12.343e-632.50HnRNP F homolog [Source:UniProtKB/TrEMBL;Acc:H2KZ... [more]
hrpf-16.334e-632.50HnRNP F homolog [Source:UniProtKB/TrEMBL;Acc:H2KZ... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fus2.284e-4328.42gene:FBgn0023441 transcript:FBtr0302330[more]
fus2.557e-4328.42gene:FBgn0023441 transcript:FBtr0087345[more]
fus2.648e-4328.42gene:FBgn0023441 transcript:FBtr0087343[more]
fus2.648e-4328.42gene:FBgn0023441 transcript:FBtr0087344[more]
fus2.648e-4328.42gene:FBgn0023441 transcript:FBtr0087346[more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esrp13.144e-3727.20epithelial splicing regulatory protein 1 [Source:N... [more]
esrp22.298e-3527.77epithelial splicing regulatory protein 2 [Source:N... [more]
esrp22.298e-3527.77epithelial splicing regulatory protein 2 [Source:N... [more]
esrp22.325e-3527.77epithelial splicing regulatory protein 2 [Source:N... [more]
esrp22.325e-3527.77epithelial splicing regulatory protein 2 [Source:N... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atf12.153e-3425.69activating transcription factor 1 [Source:Xenbase;... [more]
atf11.127e-3227.07activating transcription factor 1 [Source:Xenbase;... [more]
atf11.173e-3227.32activating transcription factor 1 [Source:Xenbase;... [more]
atf14.456e-3227.45activating transcription factor 1 [Source:Xenbase;... [more]
atf11.546e-3128.42activating transcription factor 1 [Source:Xenbase;... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Esrp21.056e-3729.06epithelial splicing regulatory protein 2 [Source:M... [more]
Esrp21.724e-3629.06epithelial splicing regulatory protein 2 [Source:M... [more]
Esrp11.726e-3527.05epithelial splicing regulatory protein 1 [Source:M... [more]
Esrp11.873e-3527.05epithelial splicing regulatory protein 1 [Source:M... [more]
Esrp12.389e-3527.05epithelial splicing regulatory protein 1 [Source:M... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BJZ5|FUSIL_DROME2.655e-4228.42RNA-binding protein fusilli OS=Drosophila melanoga... [more]
sp|B2RYJ8|ESRP2_RAT6.980e-3829.52Epithelial splicing regulatory protein 2 OS=Rattus... [more]
sp|Q5ZLR4|ESRP2_CHICK2.691e-3727.89Epithelial splicing regulatory protein 2 OS=Gallus... [more]
sp|Q8K0G8|ESRP2_MOUSE7.387e-3729.06Epithelial splicing regulatory protein 2 OS=Mus mu... [more]
sp|A1L1G1|ESRP1_DANRE2.373e-3627.20Epithelial splicing regulatory protein 1 OS=Danio ... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EB477.928e-5732.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FI418.155e-5732.82Uncharacterized protein OS=Macrostomum lignano OX=... [more]
J9JKD12.272e-5027.58RRM domain-containing protein OS=Acyrthosiphon pis... [more]
A0A5E4N7I84.860e-5026.95RRM domain-containing protein OS=Cinara cedri OX=5... [more]
A0A0V0J5S09.092e-5039.93RNA-binding protein fusilli (Fragment) OS=Schistoc... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esrp15.587e-4126.14epithelial splicing regulatory protein 1 [Source:N... [more]
esrp23.430e-3433.33epithelial splicing regulatory protein 2 [Source:N... [more]
esrp23.552e-3433.33epithelial splicing regulatory protein 2 [Source:N... [more]
esrp23.552e-3433.33epithelial splicing regulatory protein 2 [Source:N... [more]
esrp24.176e-3433.33epithelial splicing regulatory protein 2 [Source:N... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
esrp22.603e-3334.42epithelial splicing regulatory protein 2 [Source:N... [more]
HNRNPH11.074e-1328.50heterogeneous nuclear ribonucleoprotein H1 [Source... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO472862.430e-3132.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378231.354e-1024.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
esrp11.824e-3335.32epithelial splicing regulatory protein 1 [Source:N... [more]
esrp22.971e-3334.10epithelial splicing regulatory protein 2 [Source:N... [more]
esrp13.414e-3335.48epithelial splicing regulatory protein 1 [Source:N... [more]
esrp13.604e-3335.48epithelial splicing regulatory protein 1 [Source:N... [more]
esrp24.902e-3334.12epithelial splicing regulatory protein 2 [Source:N... [more]
back to top
BLAST of Epithelial splicing regulatory protein 1/2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044612.10.000e+098.44SMESG000044612.1[more]
SMESG000044612.10.000e+091.04SMESG000044612.1[more]
SMESG000023329.19.635e-5532.95SMESG000023329.1[more]
SMESG000023329.12.103e-3229.44SMESG000023329.1[more]
SMESG000055008.17.538e-825.73SMESG000055008.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002619 ID=SMED30002619|Name=Epithelial splicing regulatory protein 1/2|organism=Schmidtea mediterranea sexual|type=transcript|length=2884bp
CTTAGTTATTATTGATTTCTACAATTATTATTTGATTCTTAAATTTCTGT
AAATAATTCCAACAAATCGAATCTACAGCTGGAAAGTAAGTTTCTCAAGT
TGTTATTAAAACTCACCAAGAGTCGTAAAATTGAATTTGAATAAGCACCG
AGCACGAATAAATACACACACACGCTTACTTATTTCGGTAATCTGCCAAA
CGAATAACAACTCGATCGGATTGGAGCATAATCATCGGCATCATCTCATG
AAAATGTGTGATGCACCTCGTTATCTTTCGATGCAACTCGACACAGCTCA
CAATTGATTGGATGATGATTTGATCAATCAATTTAGTATCAATTTGCTAT
CTTTAATGATAACTTTTCAAACATGCTTGAAAATTAATTCAATCTCAATT
TTAAAAACAAACTGGAAAACAATTTAAATTTGATAACTCTTAGCAGTATT
CGTGATTATTTTGTTCGATGACGAGTGGAAATCTCAAACGAAAACAACAA
CAACAGCAACTGGAGCAATATCAAAAATCAGATAATCTCTATCTTGATTC
AGAATTGAATAACGATATCAATAAAAAACTCAAAATGAATCCATCGAAAA
CAATTTTGATGGCTTTCCATTTGGTGACATGTGGCTTGCAAGGTAACGAT
TTGGGTCGGGATGAAACTGCAATTTTGCAGGTTGGCTTCCAACTGATTGA
TTTGTCAAATAATCAGGCAATTGGAGGCAAGCTCATACTTTTGCAAGCTT
CATCATTATTGGATCCATCAGCCAATCCAGATAAGATCCATATTTCGGTT
CCAGCACGGGAAATGACCGATTTGTTGTCTTCTCCAAGCAGTCATTCAAC
ATTCAAATTGCAAGATGCTCTCAACGAAATTGATAGTTTCATTAACCAAA
ATGTGCTAGTTTCTGATGATCAAACCATTGAAGTCATACCTGTCATCCTG
GGACACTTACCCCTACGAAGTGTTTTACACAGAGAGACCAGATTTCGAAA
CATTAATTTGAATAATTATTGGTATCATTATTACAATCTTTTTGATGAAG
TTTCTATTTTTACATCTTCAAAATGTCAGAATTTAGACGAAATATCAAAT
TTTCTTCAAATTGAAAAACCTGGAGGGACGACAATGAGTATAATTTGTTA
CATGAGCAATGCGATTCTACAATTAACGCAATTAGGACATTTATTTCATT
CCAAGCACGTTATTAAAAATGGATACAAGCCTATCGTATTTCATGTGAAT
GACGAAATAGAACCTGATATTGTCCTAATGATCAAACCAATAGATTACAA
AACACCTATTAATCAAATCATTCCATTTTTTCGAGGTTTAAACATTGCTG
ATGGTGGCATAGCTGTAATCATGTCAGAAGGTAGAAGAAGTAACAAGATT
CTTATAAAGTTTGAAGACAAGGTTCAAAGAGATATCGCGTTACTGAGAGA
CAAGCACCACATGGAACCTGGCAATAGCCGATTCATTACAATATCAGTAC
ACGATAGTCGGGAGTTCATGAAAATAGCTGGCTATGAAAATGAGAGTGTC
AAGGTCTATTTGGAGCAAATAGAAACTCAGGACCAAATCCTGATTCGTAT
CAAAGGTTTGCCGTACACAGTTACAAAACCGGAAATCCTGAACTTTTTCA
AGTCAAATGATGTTGAAGTTCAATTTTCTCACAATGGAATCTTTCTGGTT
CAAAAGTCATCCGGTGAACTCAATGGAGATGCCTTTGTCATTTTTGAAAA
TGAAGGTGTCGCACAAAAGGCGAAAAATCTGAAAGGAATGACCATTGGAA
ATCGATATATGGAAATATTTTATTCCACCCCTCCTGAAATGAATCAAGTA
ATTTCTGCAGCACAAAATATTCCTTTCAAACCGAAACAAAATAAACAAAT
TACAAAACCCACAGACTCAGTCAATCAAGAAAATATCAAGAGTTCTCAAA
AAGCAGTCATGTCTGGAACCGTAACTAAATACATTCCAATGGAAGCTTCT
GATAACGACTTTGTCAGGTACCTTGCCGATCACCGAGGACTTTGCTTACT
AAGCAGTAGAAGTCATTTGTATAGTCCAATTGGATACATATCTTATGTCG
CATTTTTCAAAAACTCTTCAGATGCTTCTGCTACCATAAAAGCATTGCGT
GATAAACCTTTTAAAGTAGAATCTTCAAATAAAGAAGTCACGGTGGAAAC
CGTAGAATTGCCTTTGGTGTCAAAATTAGAAGAGCGTCCAGCTATGTATT
CTCAGGTCCTTCATAATATGTATCCAAACTCCTTGCCAGTTAACTATGTT
GCTTCTCTCCAAAATATGTTACCAAATCACTCTGTCCAAATGCCACAACC
AATGAACATATCAAATCCATTAAATTTCCCATTTTTGAATGTGCCAATGC
TCAATTATAACGTCCTGCCAAATGTCTTCTTAGCAAATCAGCAAATTAAT
CCTATACCCGACCAGAATTTGCTAATGCCTTTTCAAATCCCCATAACAAT
GTCCCTCAATTCCACTCCTAATCTCAAATTGCTCCCTCCCTCGAATATGT
TTACTAACCCCTTCAATCAGCAGAATGCACTTGCAGATTACCGACAAGCC
GCTTCTGTGTCTTCGTCAGTTTTGAATAGATCTAAAATTTTATTCATGTC
TGGAATGCCATATAAATTTACTCAGTCAGATTTAGATTCAATATTTCATT
CTATCGTTTCACACATATCTATGGCCCCGAAATTGTTGCAGCATAATCAA
AATTGTTATGCAGTTTTCAATAGCGTAGAAGATGCCAATATTGCCTTACA
GAGATGTCCTATTATTTTGTTTAATAGTCAACTGATACATTTGATTCCGA
CACATGAATGAGAGCGCCATCTTCAAACTGCAGA
back to top

protein sequence of SMED30002619-orf-1

>SMED30002619-orf-1 ID=SMED30002619-orf-1|Name=SMED30002619-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=798bp
MTSGNLKRKQQQQQLEQYQKSDNLYLDSELNNDINKKLKMNPSKTILMAF
HLVTCGLQGNDLGRDETAILQVGFQLIDLSNNQAIGGKLILLQASSLLDP
SANPDKIHISVPAREMTDLLSSPSSHSTFKLQDALNEIDSFINQNVLVSD
DQTIEVIPVILGHLPLRSVLHRETRFRNINLNNYWYHYYNLFDEVSIFTS
SKCQNLDEISNFLQIEKPGGTTMSIICYMSNAILQLTQLGHLFHSKHVIK
NGYKPIVFHVNDEIEPDIVLMIKPIDYKTPINQIIPFFRGLNIADGGIAV
IMSEGRRSNKILIKFEDKVQRDIALLRDKHHMEPGNSRFITISVHDSREF
MKIAGYENESVKVYLEQIETQDQILIRIKGLPYTVTKPEILNFFKSNDVE
VQFSHNGIFLVQKSSGELNGDAFVIFENEGVAQKAKNLKGMTIGNRYMEI
FYSTPPEMNQVISAAQNIPFKPKQNKQITKPTDSVNQENIKSSQKAVMSG
TVTKYIPMEASDNDFVRYLADHRGLCLLSSRSHLYSPIGYISYVAFFKNS
SDASATIKALRDKPFKVESSNKEVTVETVELPLVSKLEERPAMYSQVLHN
MYPNSLPVNYVASLQNMLPNHSVQMPQPMNISNPLNFPFLNVPMLNYNVL
PNVFLANQQINPIPDQNLLMPFQIPITMSLNSTPNLKLLPPSNMFTNPFN
QQNALADYRQAASVSSSVLNRSKILFMSGMPYKFTQSDLDSIFHSIVSHI
SMAPKLLQHNQNCYAVFNSVEDANIALQRCPIILFNSQLIHLIPTHE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0043484regulation of RNA splicing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR012337RNaseH-like_sf