NK homeobox 4

Overview
NameNK homeobox 4
Smed IDSMED30002616
Length (bp)1085
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NK homeobox 4 (SMED30002616) t-SNE clustered cells

Violin plots show distribution of expression levels for NK homeobox 4 (SMED30002616) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NK homeobox 4 (SMED30002616) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NK homeobox 4 (SMED30002616) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002616

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30002616SMESG000018735.1 SmedASXL_008877SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal-ventral muscle cellSMED30002616SMESG000018735.1 dd_Smed_v4_9259_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30002616SMESG000018735.1 dd_Smed_v6_9259_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NK homeobox 4 vs. Ensembl Human
Match: NKX2-6 (NK2 homeobox 6 [Source:HGNC Symbol;Acc:HGNC:32940])

HSP 1 Score: 53.5286 bits (127), Expect = 2.277e-7
Identity = 33/82 (40.24%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMP----VTNYNNSGFSYSNIP 634
            QVKIWFQNRRYK KRQ QDKSLE     +   +T   ++      + + CL P     +F  P    V+ Y+  G  YS  P
Sbjct:  175 QVKIWFQNRRYKCKRQRQDKSLE----LAGHPLTPRRVAVPVLVRDGKPCLGPGPGAPAFPSPYSAAVSPYSCYG-GYSGAP 251          
BLAST of NK homeobox 4 vs. Ensembl Human
Match: NKX2-3 (NK2 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:7836])

HSP 1 Score: 50.0618 bits (118), Expect = 3.894e-6
Identity = 21/23 (91.30%), Postives = 21/23 (91.30%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLE 469
            QVKIWFQNRRYK KRQ QDKSLE
Sbjct:  191 QVKIWFQNRRYKCKRQRQDKSLE 213          
BLAST of NK homeobox 4 vs. Ensembl Human
Match: NKX2-3 (NK2 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:7836])

HSP 1 Score: 49.2914 bits (116), Expect = 4.831e-6
Identity = 21/23 (91.30%), Postives = 21/23 (91.30%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLE 469
            QVKIWFQNRRYK KRQ QDKSLE
Sbjct:  191 QVKIWFQNRRYKCKRQRQDKSLE 213          
BLAST of NK homeobox 4 vs. Ensembl Zebrafish
Match: nkx2.7 (NK2 transcription factor related 7 [Source:ZFIN;Acc:ZDB-GENE-990415-179])

HSP 1 Score: 49.2914 bits (116), Expect = 2.631e-6
Identity = 22/25 (88.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDKSLE A
Sbjct:  167 QVKIWFQNRRYKCKRQRQDKSLELA 191          
BLAST of NK homeobox 4 vs. Ensembl Zebrafish
Match: nkx2.3 (NK2 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-990415-178])

HSP 1 Score: 49.2914 bits (116), Expect = 3.843e-6
Identity = 21/25 (84.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDK+LE A
Sbjct:  185 QVKIWFQNRRYKCKRQRQDKTLEMA 209          
BLAST of NK homeobox 4 vs. Ensembl Zebrafish
Match: nkx2.3 (NK2 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-990415-178])

HSP 1 Score: 49.2914 bits (116), Expect = 3.843e-6
Identity = 21/25 (84.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDK+LE A
Sbjct:  185 QVKIWFQNRRYKCKRQRQDKTLEMA 209          
BLAST of NK homeobox 4 vs. Ensembl Xenopus
Match: mtm1 (myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030])

HSP 1 Score: 52.7582 bits (125), Expect = 2.357e-7
Identity = 38/105 (36.19%), Postives = 49/105 (46.67%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNT 715
            QVKIWFQNRRYK KRQ QD+SLE         V    L       + + CL P   T +F+ P  N + + ++Y    G   NS +  G  S+  M       NT
Sbjct:  137 QVKIWFQNRRYKCKRQKQDRSLELGHPIPPRRVAVPVLVR-----DGKPCLGP---TQTFASPY-NVSATPYTYPVCYGNYTNSPYYSGAPSVPTMGSQLISMNT 232          
BLAST of NK homeobox 4 vs. Ensembl Xenopus
Match: NKX2-3 (NK2 homeobox 3 [Source:NCBI gene;Acc:100486189])

HSP 1 Score: 50.0618 bits (118), Expect = 2.591e-6
Identity = 22/26 (84.62%), Postives = 22/26 (84.62%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEAT 478
            QVKIWFQNRRYK KRQ QDKSLE  T
Sbjct:  189 QVKIWFQNRRYKCKRQRQDKSLEMGT 214          
BLAST of NK homeobox 4 vs. Ensembl Mouse
Match: Nkx2-3 (NK2 homeobox 3 [Source:MGI Symbol;Acc:MGI:97348])

HSP 1 Score: 50.447 bits (119), Expect = 1.733e-6
Identity = 22/26 (84.62%), Postives = 22/26 (84.62%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEAT 478
            QVKIWFQNRRYK KRQ QDKSLE  T
Sbjct:  188 QVKIWFQNRRYKCKRQRQDKSLELGT 213          
BLAST of NK homeobox 4 vs. TrEMBL
Match: A0A3G8G7N6 (NK homeobox 4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=nk4 PE=2 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 6.554e-131
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDXXXXXXXXXXXNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLF 1003
            QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLF
Sbjct:  225 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLF 425          
BLAST of NK homeobox 4 vs. TrEMBL
Match: A0A183AGR6 (Homeobox domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6151 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 8.656e-7
Identity = 27/41 (65.85%), Postives = 32/41 (78.05%), Query Frame = 2
Query:  386 NYIFIQVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGS 508
            +Y F+QVKIWFQNRRYK+KRQAQDKS+EE T   +S    S
Sbjct:   91 HYRFMQVKIWFQNRRYKVKRQAQDKSIEEVTALQHSVNCAS 131          
BLAST of NK homeobox 4 vs. TrEMBL
Match: A0A448XKR9 (Homeobox domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS32472 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.431e-6
Identity = 23/32 (71.88%), Postives = 27/32 (84.38%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSF 496
            QVKIWFQNRRYK+KRQAQDKSLE+A    ++ 
Sbjct:   16 QVKIWFQNRRYKVKRQAQDKSLEQAAALQHTL 47          
BLAST of NK homeobox 4 vs. TrEMBL
Match: Q49QY1 (Tinman (Fragment) OS=Euprymna scolopes OX=6613 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 9.486e-6
Identity = 35/78 (44.87%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIP 634
            QVKIWFQNRRYK KRQ QDKSLE +T      V    L       + + CL  + ++  +S P   YN + F+YSN+P
Sbjct:  198 QVKIWFQNRRYKCKRQRQDKSLEMSTMHPPRRVAVPVLVR-----DGKPCLGQSNVSPPYSTP---YNVNPFAYSNVP 267          
BLAST of NK homeobox 4 vs. TrEMBL
Match: A0A4E0RAU0 (Homeobox protein Nkx-2.6 OS=Fasciola hepatica OX=6192 GN=D915_005726 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.799e-6
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGS 508
            QVKIWFQNRRYK+KRQAQDKS+EEAT F ++    S
Sbjct:  368 QVKIWFQNRRYKVKRQAQDKSIEEATVFQHNLRCSS 403          
BLAST of NK homeobox 4 vs. Ensembl Cavefish
Match: ENSAMXT00000050209.1 (NK2 homeobox 6 [Source:NCBI gene;Acc:103037868])

HSP 1 Score: 51.2174 bits (121), Expect = 5.491e-7
Identity = 22/27 (81.48%), Postives = 23/27 (85.19%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATG 481
            QVKIWFQNRRYK KRQ QD+SLE A G
Sbjct:  165 QVKIWFQNRRYKCKRQRQDRSLELAGG 191          
BLAST of NK homeobox 4 vs. Ensembl Cavefish
Match: nkx2.3 (NK2 homeobox 3 [Source:NCBI gene;Acc:103034978])

HSP 1 Score: 49.2914 bits (116), Expect = 3.304e-6
Identity = 21/25 (84.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDK+LE A
Sbjct:  192 QVKIWFQNRRYKCKRQRQDKTLEMA 216          
BLAST of NK homeobox 4 vs. Ensembl Medaka
Match: nkx2.7 (NK2 transcription factor related 7 [Source:ZFIN;Acc:ZDB-GENE-990415-179])

HSP 1 Score: 50.447 bits (119), Expect = 2.694e-7
Identity = 22/25 (88.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDKSLE A
Sbjct:   60 QVKIWFQNRRYKCKRQRQDKSLELA 84          
BLAST of NK homeobox 4 vs. Ensembl Medaka
Match: NKX2-3 (homeobox protein Nkx-2.5-like [Source:NCBI gene;Acc:111947865])

HSP 1 Score: 50.8322 bits (120), Expect = 1.118e-6
Identity = 22/25 (88.00%), Postives = 22/25 (88.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEA 475
            QVKIWFQNRRYK KRQ QDKSLE A
Sbjct:  211 QVKIWFQNRRYKCKRQRQDKSLEAA 235          
BLAST of NK homeobox 4 vs. Ensembl Medaka
Match: nkx2.3 (NK2 homeobox 3 [Source:NCBI gene;Acc:101163760])

HSP 1 Score: 50.0618 bits (118), Expect = 1.761e-6
Identity = 36/110 (32.73%), Postives = 51/110 (46.36%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCL------NPNEITNS-----FSMPVTNYNNSGF------SYSNIPGRMPNSIFNHGVNSM 679
            QVKIWFQNRRYK KRQ QDK+LE A    +       ++      + R CL      NP+    +        P  +YNNS +      +YS++P   P     + + +M
Sbjct:  200 QVKIWFQNRRYKCKRQRQDKTLEIAGHHHHHPPPPRRVAVPVLVRDGRPCLSGSQNYNPHYAVGAPNPYYSGYPTYSYNNSAYTNTYSCTYSSLPALPPTHTPTNALMTM 309          
BLAST of NK homeobox 4 vs. Planmine SMEST
Match: SMESG000018735.1 (SMESG000018735.1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.175e-135
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDXXXXXXXXXXXNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 1006
            QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ
Sbjct:  198 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 399          
BLAST of NK homeobox 4 vs. Planmine SMEST
Match: SMESG000018735.1 (SMESG000018735.1)

HSP 1 Score: 392.889 bits (1008), Expect = 2.400e-135
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDXXXXXXXXXXXNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 1006
            QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ
Sbjct:  223 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 424          
BLAST of NK homeobox 4 vs. Planmine SMEST
Match: SMESG000018735.1 (SMESG000018735.1)

HSP 1 Score: 392.889 bits (1008), Expect = 2.679e-135
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 2
Query:  401 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDXXXXXXXXXXXNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 1006
            QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ
Sbjct:  225 QVKIWFQNRRYKMKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 426          
BLAST of NK homeobox 4 vs. Planmine SMEST
Match: SMESG000018735.1 (SMESG000018735.1)

HSP 1 Score: 360.533 bits (924), Expect = 3.683e-126
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 2
Query:  437 MKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDXXXXXXXXXXXNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 1006
            MKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ
Sbjct:    1 MKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSMPVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTESSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSGSLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ 190          
The following BLAST results are available for this feature:
BLAST of NK homeobox 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NKX2-62.277e-740.24NK2 homeobox 6 [Source:HGNC Symbol;Acc:HGNC:32940][more]
NKX2-33.894e-691.30NK2 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:7836][more]
NKX2-34.831e-691.30NK2 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:7836][more]
back to top
BLAST of NK homeobox 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nkx2.72.631e-688.00NK2 transcription factor related 7 [Source:ZFIN;Ac... [more]
nkx2.33.843e-684.00NK2 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-990415-17... [more]
nkx2.33.843e-684.00NK2 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-990415-17... [more]
back to top
BLAST of NK homeobox 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mtm12.357e-736.19myotubularin 1 [Source:Xenbase;Acc:XB-GENE-1002030... [more]
NKX2-32.591e-684.62NK2 homeobox 3 [Source:NCBI gene;Acc:100486189][more]
back to top
BLAST of NK homeobox 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nkx2-31.733e-684.62NK2 homeobox 3 [Source:MGI Symbol;Acc:MGI:97348][more]
back to top
BLAST of NK homeobox 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3G8G7N66.554e-131100.00NK homeobox 4 (Fragment) OS=Schmidtea mediterranea... [more]
A0A183AGR68.656e-765.85Homeobox domain-containing protein OS=Echinostoma ... [more]
A0A448XKR91.431e-671.88Homeobox domain-containing protein (Fragment) OS=P... [more]
Q49QY19.486e-644.87Tinman (Fragment) OS=Euprymna scolopes OX=6613 PE=... [more]
A0A4E0RAU09.799e-672.22Homeobox protein Nkx-2.6 OS=Fasciola hepatica OX=6... [more]
back to top
BLAST of NK homeobox 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000050209.15.491e-781.48NK2 homeobox 6 [Source:NCBI gene;Acc:103037868][more]
nkx2.33.304e-684.00NK2 homeobox 3 [Source:NCBI gene;Acc:103034978][more]
back to top
BLAST of NK homeobox 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NK homeobox 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nkx2.72.694e-788.00NK2 transcription factor related 7 [Source:ZFIN;Ac... [more]
NKX2-31.118e-688.00homeobox protein Nkx-2.5-like [Source:NCBI gene;Ac... [more]
nkx2.31.761e-632.73NK2 homeobox 3 [Source:NCBI gene;Acc:101163760][more]
back to top
BLAST of NK homeobox 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018735.11.175e-135100.00SMESG000018735.1[more]
SMESG000018735.12.400e-135100.00SMESG000018735.1[more]
SMESG000018735.12.679e-135100.00SMESG000018735.1[more]
SMESG000018735.13.683e-126100.00SMESG000018735.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002616 ID=SMED30002616|Name=NK homeobox 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1085bp
ATAAACTCTCTAGTTGACAAACACGTGCTGTTGCGGTTCAGTGAACGGTT
CGGTACAAAAATTATTATTAATATACAGGAAAAATAAATATTTATGTTAA
AACTGTCGCATAATTATTTATTGTGTCAATCGACTAAACATAGCCACTCC
AGTCTAGTTTATATTGGAACATGATATTTAGCTTGAATATTAGCTTGATA
CCGTGTCACAGCTTGATAACGCAGATCTATTGCGTTTGGTGGCGAGTAAT
TTCCTTTTTATTCCGATTTCACTTCTGACAAAACACAATCGGATAATCTT
GCCTGGATAATCTCGAGACCAATTGAAAGGGTTGAAAGTTTTGATTTTGT
TTTGTTTTATTAAAGATTTTGGAAAATTTTTAAGCAATTATATTTTCATC
CAGGTAAAAATATGGTTTCAAAATCGGCGATATAAAATGAAACGACAAGC
CCAAGATAAGAGTCTTGAAGAAGCGACGGGGTTTTCGAATTCTTTCGTTA
CGGGTAGCGCTTTATCAAATGCTTCAAATTCAATGAACCGAAGAAATTGT
TTGAATCCAAACGAAATCACAAACTCATTTTCAATGCCTGTTACAAATTA
CAACAATTCCGGATTCTCTTATTCGAATATTCCCGGTCGAATGCCGAATT
CTATTTTCAATCATGGAGTCAATTCGATGTGGAATATGCCAGAAAGTTTT
TATTGGAATAACACTATCCTTAACCATCCAACCGAATCATCAGCAATCAA
CCAAAACATGTCAACAAATTCCTGTTTACCGAAACCTTATCATTATCCAG
ATGTTGCAGCAGCAGCGGCCGCAGCAGCTGTTGTCAATTATCCATCATGG
AATGAAGATCCATTCAAATATGTTCCACAATCTGGTTCACTGAAGCTGGA
TTCGTATTCGTCGACATTCAGAACAATGATAGAAAACAACAACATTAAAT
TGAATGCAACTGCAGACAAGTTTATTCCAACACCTCCCACAGCAGATTTA
TTCCAATAATGATTGCTATTAAATATTAATTACTATTATTATTTGTACAA
AATTTGATTAATTAATCGAAATAGAACTTTTGAAA
back to top

protein sequence of SMED30002616-orf-1

>SMED30002616-orf-1 ID=SMED30002616-orf-1|Name=SMED30002616-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MKRQAQDKSLEEATGFSNSFVTGSALSNASNSMNRRNCLNPNEITNSFSM
PVTNYNNSGFSYSNIPGRMPNSIFNHGVNSMWNMPESFYWNNTILNHPTE
SSAINQNMSTNSCLPKPYHYPDVAAAAAAAAVVNYPSWNEDPFKYVPQSG
SLKLDSYSSTFRTMIENNNIKLNATADKFIPTPPTADLFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000421tail
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009057Homeobox-like_sf
IPR001356Homeobox_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0001776leukocyte homeostasis
GO:0002317plasma cell differentiation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006641triglyceride metabolic process
GO:0006955immune response
GO:0007275multicellular organism development
GO:0009791post-embryonic development
GO:0022612gland morphogenesis
GO:0030183B cell differentiation
GO:0030225macrophage differentiation
GO:0042127regulation of cell proliferation
GO:0042475odontogenesis of dentin-containing tooth
GO:0043367CD4-positive, alpha-beta T cell differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048535lymph node development
GO:0048536spleen development
GO:0048537mucosal-associated lymphoid tissue development
GO:0048541Peyer's patch development
GO:0048565digestive tract development
GO:0048621post-embryonic digestive tract morphogenesis
GO:0050900leukocyte migration
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus