Liprin-alpha-4

Overview
NameLiprin-alpha-4
Smed IDSMED30002609
Length (bp)5512
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Liprin-alpha-4 (SMED30002609) t-SNE clustered cells

Violin plots show distribution of expression levels for Liprin-alpha-4 (SMED30002609) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Liprin-alpha-4 (SMED30002609) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Liprin-alpha-4 (SMED30002609) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002609

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002609SMESG000048912.1 SMESG000048911.1 Contig38009uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002609SMESG000048912.1 SMESG000048911.1 Contig38009newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002609SMESG000048912.1 SMESG000048911.1 Contig15514uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002609SMESG000048912.1 SMESG000048911.1 Contig15514newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30002609SMESG000048911.1 dd_Smed_v4_5468_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Liprin-alpha-4 vs. Ensembl Human
Match: PPFIA2 (PTPRF interacting protein alpha 2 [Source:HGNC Symbol;Acc:HGNC:9246])

HSP 1 Score: 371.318 bits (952), Expect = 4.018e-114
Identity = 174/256 (67.97%), Postives = 209/256 (81.64%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P         ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  112 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 366          
BLAST of Liprin-alpha-4 vs. Ensembl Human
Match: PPFIA2 (PTPRF interacting protein alpha 2 [Source:HGNC Symbol;Acc:HGNC:9246])

HSP 1 Score: 374.015 bits (959), Expect = 7.552e-111
Identity = 174/256 (67.97%), Postives = 209/256 (81.64%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P         ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  462 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 716          

HSP 2 Score: 94.3597 bits (233), Expect = 1.156e-18
Identity = 67/179 (37.43%), Postives = 99/179 (55.31%), Query Frame = 2
Query: 1427 RLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQ-----------------------NYELATQLQAYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +  R+ LE++  D+++L  E+++ + +                       + EL   + + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:   17 RARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDR 195          
BLAST of Liprin-alpha-4 vs. Ensembl Human
Match: PPFIA2 (PTPRF interacting protein alpha 2 [Source:HGNC Symbol;Acc:HGNC:9246])

HSP 1 Score: 377.481 bits (968), Expect = 1.600e-108
Identity = 176/260 (67.69%), Postives = 210/260 (80.77%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPA--PGPRPNKS--------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  R  +S        LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  821 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTKESEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 1079          

HSP 2 Score: 211.846 bits (538), Expect = 1.118e-54
Identity = 212/565 (37.52%), Postives = 319/565 (56.46%), Query Frame = 2
Query:  293 QDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSN----GTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQ-----------------------NYELATQLQAYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            Q+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E+N+   H    + SS       GS  +    G +    ++E  KRLSN           +D  D   +  + ++   + N+E+ +      ++ + + L++R+ +++ +    +K+L +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +  R+ LE++  D+++L  E+++ + +                       + EL   + + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:   27 QEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALREQNV---HIQRKMASS------EGSTESEHLEGMEPGQKVHE--KRLSNG---------SIDSTDETSQIVELQELLEKQNYEMAQ------MKERLAALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDR 554          
BLAST of Liprin-alpha-4 vs. Ensembl Human
Match: PPFIA4 (PTPRF interacting protein alpha 4 [Source:HGNC Symbol;Acc:HGNC:9248])

HSP 1 Score: 362.073 bits (928), Expect = 1.314e-107
Identity = 171/273 (62.64%), Postives = 207/273 (75.82%), Query Frame = 2
Query: 3767 NNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS---------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
              + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                     LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP    QARQ + RE ++L+  G
Sbjct:  338 KGMPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLETSTKTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALILQIPTQNTQARQVMEREFNNLLALG 609          
BLAST of Liprin-alpha-4 vs. Ensembl Human
Match: PPFIA4 (PTPRF interacting protein alpha 4 [Source:HGNC Symbol;Acc:HGNC:9248])

HSP 1 Score: 362.073 bits (928), Expect = 1.314e-107
Identity = 171/273 (62.64%), Postives = 207/273 (75.82%), Query Frame = 2
Query: 3767 NNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS---------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
              + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                     LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP    QARQ + RE ++L+  G
Sbjct:  338 KGMPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLETSTKTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALILQIPTQNTQARQVMEREFNNLLALG 609          
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Match: syd-2 (Liprin-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q21049])

HSP 1 Score: 334.339 bits (856), Expect = 1.255e-94
Identity = 155/251 (61.75%), Postives = 196/251 (78.09%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNK-SLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  WNGPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+ EIQ+EIGISNPLHRLKLRLAIQEMV LTSP+  PR  + +LAFG++NHE++GN WLP LGL+Q+R AFMECL+DARML+HL+K+DLR HL+M++ FHR+SL YG+ CLK++NYD+K L  R++  +  ++ D+LVWS ERV  W+E I L  ++ NL DSG+HGAL+ LD+ FDA+     LQI +     RQ L ++   LV   R+
Sbjct:  864 FALWNGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDQEIQKEIGISNPLHRLKLRLAIQEMVSLTSPS-APRTARLTLAFGDMNHEYIGNDWLPCLGLAQYRSAFMECLLDARMLEHLSKRDLRTHLRMVDTFHRTSLQYGIMCLKKVNYDKKVLADRRKACDNINT-DLLVWSNERVQRWVEEIGLGVFSRNLVDSGIHGALIALDETFDASAFAYALQIGSQDVPNRQLLEKKFIGLVNDHRQ 1112          

HSP 2 Score: 142.51 bits (358), Expect = 1.202e-33
Identity = 121/382 (31.68%), Postives = 201/382 (52.62%), Query Frame = 2
Query:  908 SNHEIVRQEALDNLRS------KQS-ELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLN-------ETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDT-------QIDRDKLYAEVDRWKRQNYELAT-QLQAYMDS--------------------------------KKVQV----RPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAFNA--GLSDIRSS 1864
            +N  I  QEAL+ +++      KQS E+T R  +L++QL    +E   A E I RLKN++ E +  R  Q  R+  FE R +  Q+E T   +  D  + +L++K+  V+  EEK+ +L E+L        ++  + ++  S EA  Q R+E+  A   + V   E+++ +++N++    E      R  QRE++N+EH++RLS+TVD LL+ESN+RLQ HL+E+M  L +KN+L  +LD  ++I +         Q D + L  E++  ++Q Y   T Q Q+ M +                                ++ Q     RP +GR + L   P++V T+ E EWD+LQQ+ V++NV QAF++   L+D+  S
Sbjct:  239 ANRLIEMQEALERMKTELANSLKQSTEITTRNAELEDQLTEDAREKHAAQESIVRLKNQICELDAQRTDQETRITTFESRFLTAQRESTCIRDLNDKLEHQLANKDAAVRLNEEKVHSLQERLELAEKQLAQSLKKAESLPSVEAELQQRMEALTAAEQKSVSAEERIQRLDRNIQELSAELE----RAVQRERMNEEHSQRLSSTVDKLLSESNDRLQLHLKERMQALDDKNRLTQQLDGTKKIYDQAERIKDRLQRDNESLRQEIEALRQQLYNARTAQFQSRMHAIPFTHAQNIVQQQPQASIAQQSAYQMYKQQPAQQYQTVGMRRPNKGRISALQDDPNKVQTLNEQEWDRLQQAHVLANVQQAFSSSPSLADVGQS 616          
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 93.5893 bits (231), Expect = 6.046e-19
Identity = 66/249 (26.51%), Postives = 118/249 (47.39%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQ-LTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEH--RQELANAKDSNDVLV-WSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            F +W    +  W+   +G P +     R +V+SG   + +S  E +  + I NP+HR ++ + ++ + + +  PA     +++L             WL  +GL Q++  F E +VD  +L  LT  D  V +K++   H ++L   +  LK+ ++    +E    Q +       DV+V W+      W+  IDL E+  NL  +GV GAL++ +  F A  L  +LQ+P      R+ LT   + L+
Sbjct:  332 FVDWRSEQLADWIA-EIGYPQYMNEVSR-HVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEEDIMEPANKWDVHQTL------------RWLDDIGLPQYKDVFAENVVDGPLLLSLTANDA-VEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVEKYPCPDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLL 565          
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 93.5893 bits (231), Expect = 7.538e-19
Identity = 66/249 (26.51%), Postives = 118/249 (47.39%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQ-LTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEH--RQELANAKDSNDVLV-WSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            F +W    +  W+   +G P +     R +V+SG   + +S  E +  + I NP+HR ++ + ++ + + +  PA     +++L             WL  +GL Q++  F E +VD  +L  LT  D  V +K++   H ++L   +  LK+ ++    +E    Q +       DV+V W+      W+  IDL E+  NL  +GV GAL++ +  F A  L  +LQ+P      R+ LT   + L+
Sbjct:  374 FVDWRSEQLADWIA-EIGYPQYMNEVSR-HVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEEDIMEPANKWDVHQTL------------RWLDDIGLPQYKDVFAENVVDGPLLLSLTANDA-VEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVEKYPCPDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLL 607          
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 93.9745 bits (232), Expect = 7.892e-19
Identity = 66/249 (26.51%), Postives = 118/249 (47.39%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQ-LTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEH--RQELANAKDSNDVLV-WSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            F +W    +  W+   +G P +     R +V+SG   + +S  E +  + I NP+HR ++ + ++ + + +  PA     +++L             WL  +GL Q++  F E +VD  +L  LT  D  V +K++   H ++L   +  LK+ ++    +E    Q +       DV+V W+      W+  IDL E+  NL  +GV GAL++ +  F A  L  +LQ+P      R+ LT   + L+
Sbjct:  564 FVDWRSEQLADWIA-EIGYPQYMNEVSR-HVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEEDIMEPANKWDVHQTLR------------WLDDIGLPQYKDVFAENVVDGPLLLSLTANDA-VEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVEKYPCPDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLL 797          
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 93.9745 bits (232), Expect = 7.892e-19
Identity = 66/249 (26.51%), Postives = 118/249 (47.39%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQ-LTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEH--RQELANAKDSNDVLV-WSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            F +W    +  W+   +G P +     R +V+SG   + +S  E +  + I NP+HR ++ + ++ + + +  PA     +++L             WL  +GL Q++  F E +VD  +L  LT  D  V +K++   H ++L   +  LK+ ++    +E    Q +       DV+V W+      W+  IDL E+  NL  +GV GAL++ +  F A  L  +LQ+P      R+ LT   + L+
Sbjct:  564 FVDWRSEQLADWIA-EIGYPQYMNEVSR-HVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEEDIMEPANKWDVHQTLR------------WLDDIGLPQYKDVFAENVVDGPLLLSLTANDA-VEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVEKYPCPDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALMIYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLL 797          
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Match: Liprin-alpha (gene:FBgn0046704 transcript:FBtr0329941)

HSP 1 Score: 369.007 bits (946), Expect = 4.831e-106
Identity = 169/246 (68.70%), Postives = 199/246 (80.89%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVK 4516
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+       +LAFG++NHEW+GNYWLP LGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG++ LKRLNYDR +LEHR++++      DVLVWS ERV+ W+  I L+EYA NL +SGVHG L+ LD+ FDAN + + LQIP    QARQ L  E ++L++
Sbjct:  899 FALWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSE-NGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQ 1143          

HSP 2 Score: 173.326 bits (438), Expect = 4.485e-43
Identity = 114/190 (60.00%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            M+CD+MPTISE+      R SQ S + AN E ++++MLDERD LM+ LR++ E L  T+ +L +++KE+D L+ QIN++LPQ+   L KEL + +E + ER+EE  ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+    GVSSEVEVLKALKSLFEHHKALDEKVRERLR+S+++   +E+EL
Sbjct:    4 MMCDVMPTISEDS--ISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETENKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLSIEKNNMMEEEL 191          

HSP 3 Score: 87.4261 bits (215), Expect = 9.657e-17
Identity = 68/238 (28.57%), Postives = 120/238 (50.42%), Query Frame = 2
Query:  938 LDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDR 1651
            L   + + S+L  ++ +L+  +   QKE  +A +Q  +L+ +L E+   +E Q ER+   E+R ++ Q+E T+ H+  +  + EL  K  ++K                       Q +  S ++R+     + T L ++  ++                  +RL QR K+N+EH  RLS+TVD LL+ESNERLQ HL+E+M  L EKN L  EL+  R++ E+   ++ ++  E+ +
Sbjct:  273 LSQWQRRVSDLNNKISELEENMSRVQKEHCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLK----------------------AQERHGSAEDRIR---GLETNLDEKTNEV------------------VRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSK 467          
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Match: Liprin-alpha (gene:FBgn0046704 transcript:FBtr0079300)

HSP 1 Score: 369.392 bits (947), Expect = 8.785e-106
Identity = 169/246 (68.70%), Postives = 199/246 (80.89%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVK 4516
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+       +LAFG++NHEW+GNYWLP LGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG++ LKRLNYDR +LEHR++++      DVLVWS ERV+ W+  I L+EYA NL +SGVHG L+ LD+ FDAN + + LQIP    QARQ L  E ++L++
Sbjct:  942 FALWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSE-NGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQ 1186          

HSP 2 Score: 173.326 bits (438), Expect = 5.125e-43
Identity = 114/190 (60.00%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            M+CD+MPTISE+      R SQ S + AN E ++++MLDERD LM+ LR++ E L  T+ +L +++KE+D L+ QIN++LPQ+   L KEL + +E + ER+EE  ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+    GVSSEVEVLKALKSLFEHHKALDEKVRERLR+S+++   +E+EL
Sbjct:    4 MMCDVMPTISEDS--ISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETENKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLSIEKNNMMEEEL 191          

HSP 3 Score: 95.9005 bits (237), Expect = 2.944e-19
Identity = 101/326 (30.98%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  962 SELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREIN----------KXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAE-------VDRWKRQ--NYELATQLQ-------------------AYMDS---KKVQVRPLR-------GRENVLPDQVNTIGEGEWDKL 1795
            S+L  ++ +L+  +   QKE  +A +Q  +L+ +L E+   +E Q ER+   E+R ++ Q+E T+ H+  +  + EL  K  ++K  EEKI  + EKL E + +   Q +K          +P M  +L   +E L +            + LE  L+E   E++RL QR K+N+EH  RLS+TVD LL+ESNERLQ HL+E+M  L EKN L  EL+  R++ E+   ++ ++  E       ++ +KRQ    E+A  +Q                   A+  S      +   LR         EN L   V ++ E EW+KL
Sbjct:  281 SDLNNKISELEENMSRVQKEHCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLKLHEEKIGAIEEKL-ELSEQKLAQHAK---------LQPDMEEQLKARMEALTKAQERHGSAEDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENAL---VRSMAEQEWEKL 593          
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Match: Liprin-alpha (gene:FBgn0046704 transcript:FBtr0079301)

HSP 1 Score: 369.392 bits (947), Expect = 8.785e-106
Identity = 169/246 (68.70%), Postives = 199/246 (80.89%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVK 4516
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+       +LAFG++NHEW+GNYWLP LGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG++ LKRLNYDR +LEHR++++      DVLVWS ERV+ W+  I L+EYA NL +SGVHG L+ LD+ FDAN + + LQIP    QARQ L  E ++L++
Sbjct:  942 FALWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSE-NGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQ 1186          

HSP 2 Score: 173.326 bits (438), Expect = 5.125e-43
Identity = 114/190 (60.00%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            M+CD+MPTISE+      R SQ S + AN E ++++MLDERD LM+ LR++ E L  T+ +L +++KE+D L+ QIN++LPQ+   L KEL + +E + ER+EE  ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+    GVSSEVEVLKALKSLFEHHKALDEKVRERLR+S+++   +E+EL
Sbjct:    4 MMCDVMPTISEDS--ISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETENKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLSIEKNNMMEEEL 191          

HSP 3 Score: 95.9005 bits (237), Expect = 2.944e-19
Identity = 101/326 (30.98%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  962 SELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREIN----------KXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAE-------VDRWKRQ--NYELATQLQ-------------------AYMDS---KKVQVRPLR-------GRENVLPDQVNTIGEGEWDKL 1795
            S+L  ++ +L+  +   QKE  +A +Q  +L+ +L E+   +E Q ER+   E+R ++ Q+E T+ H+  +  + EL  K  ++K  EEKI  + EKL E + +   Q +K          +P M  +L   +E L +            + LE  L+E   E++RL QR K+N+EH  RLS+TVD LL+ESNERLQ HL+E+M  L EKN L  EL+  R++ E+   ++ ++  E       ++ +KRQ    E+A  +Q                   A+  S      +   LR         EN L   V ++ E EW+KL
Sbjct:  281 SDLNNKISELEENMSRVQKEHCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLKLHEEKIGAIEEKL-ELSEQKLAQHAK---------LQPDMEEQLKARMEALTKAQERHGSAEDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENAL---VRSMAEQEWEKL 593          
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Match: Liprin-alpha (gene:FBgn0046704 transcript:FBtr0329942)

HSP 1 Score: 369.392 bits (947), Expect = 9.169e-106
Identity = 169/246 (68.70%), Postives = 199/246 (80.89%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVK 4516
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+       +LAFG++NHEW+GNYWLP LGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG++ LKRLNYDR +LEHR++++      DVLVWS ERV+ W+  I L+EYA NL +SGVHG L+ LD+ FDAN + + LQIP    QARQ L  E ++L++
Sbjct:  946 FALWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSE-NGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQ 1190          

HSP 2 Score: 173.326 bits (438), Expect = 4.858e-43
Identity = 114/190 (60.00%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            M+CD+MPTISE+      R SQ S + AN E ++++MLDERD LM+ LR++ E L  T+ +L +++KE+D L+ QIN++LPQ+   L KEL + +E + ER+EE  ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+    GVSSEVEVLKALKSLFEHHKALDEKVRERLR+S+++   +E+EL
Sbjct:    4 MMCDVMPTISEDS--ISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETENKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLSIEKNNMMEEEL 191          

HSP 3 Score: 96.2857 bits (238), Expect = 1.948e-19
Identity = 101/330 (30.61%), Postives = 162/330 (49.09%), Query Frame = 2
Query:  962 SELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREIN--------------KXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAE-------VDRWKRQ--NYELATQLQ-------------------AYMDS---KKVQVRPLR-------GRENVLPDQVNTIGEGEWDKL 1795
            S+L  ++ +L+  +   QKE  +A +Q  +L+ +L E+   +E Q ER+   E+R ++ Q+E T+ H+  +  + EL  K  ++K  EEKI  + EKL E + +   Q +K          +P M  +L   +E L ++               + LE  L+E   E++RL QR K+N+EH  RLS+TVD LL+ESNERLQ HL+E+M  L EKN L  EL+  R++ E+   ++ ++  E       ++ +KRQ    E+A  +Q                   A+  S      +   LR         EN L   V ++ E EW+KL
Sbjct:  281 SDLNNKISELEENMSRVQKEHCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLKLHEEKIGAIEEKL-ELSEQKLAQHAK---------LQPDMEEQLKARMEALTKVGNKAQERHGSAEDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENAL---VRSMAEQEWEKL 597          
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Match: Liprin-alpha (gene:FBgn0046704 transcript:FBtr0329943)

HSP 1 Score: 369.007 bits (946), Expect = 1.081e-105
Identity = 169/246 (68.70%), Postives = 199/246 (80.89%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVK 4516
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+       +LAFG++NHEW+GNYWLP LGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG++ LKRLNYDR +LEHR++++      DVLVWS ERV+ W+  I L+EYA NL +SGVHG L+ LD+ FDAN + + LQIP    QARQ L  E ++L++
Sbjct:  942 FALWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSE-NGLCDVLVWSNERVIRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQ 1186          

HSP 2 Score: 173.711 bits (439), Expect = 4.153e-43
Identity = 114/190 (60.00%), Postives = 150/190 (78.95%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            M+CD+MPTISE+      R SQ S + AN E ++++MLDERD LM+ LR++ E L  T+ +L +++KE+D L+ QIN++LPQ+   L KEL + +E + ER+EE  ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+    GVSSEVEVLKALKSLFEHHKALDEKVRERLR+S+++   +E+EL
Sbjct:    4 MMCDVMPTISEDS--ISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETENKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLSIEKNNMMEEEL 191          

HSP 3 Score: 96.2857 bits (238), Expect = 2.006e-19
Identity = 101/326 (30.98%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  962 SELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREIN----------KXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAE-------VDRWKRQ--NYELATQLQ-------------------AYMDS---KKVQVRPLR-------GRENVLPDQVNTIGEGEWDKL 1795
            S+L  ++ +L+  +   QKE  +A +Q  +L+ +L E+   +E Q ER+   E+R ++ Q+E T+ H+  +  + EL  K  ++K  EEKI  + EKL E + +   Q +K          +P M  +L   +E L +            + LE  L+E   E++RL QR K+N+EH  RLS+TVD LL+ESNERLQ HL+E+M  L EKN L  EL+  R++ E+   ++ ++  E       ++ +KRQ    E+A  +Q                   A+  S      +   LR         EN L   V ++ E EW+KL
Sbjct:  281 SDLNNKISELEENMSRVQKEHCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHKEAQLKLHEEKIGAIEEKL-ELSEQKLAQHAK---------LQPDMEEQLKARMEALTKAQERHGSAEDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENAL---VRSMAEQEWEKL 593          
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Match: ppfia2 (PTPRF interacting protein alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7905])

HSP 1 Score: 363.999 bits (933), Expect = 1.195e-103
Identity = 175/281 (62.28%), Postives = 209/281 (74.38%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPR--------------------PNKS-----------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                     P+K+           LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E ++  D  DVLVWS ERV+ W++ I LR+YA  L +SGVHGAL+ LD +FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  881 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMETMAAPSKTSDSEEGSWSQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRE-SSQHDIRDVLVWSNERVIRWVQSIGLRDYANILLESGVHGALIALDDNFDYSSLALLLQIPNQNTQARQILEREYNNLLALGTE 1160          

HSP 2 Score: 270.011 bits (689), Expect = 4.820e-73
Identity = 245/649 (37.75%), Postives = 376/649 (57.94%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG--ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIM--TDINESY-KRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEA-LDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR-------DKLYAEVDRWKRQNYELA--TQLQAYMD---------------------SKKVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTISE+ +    R SQ S+    ++ E +++NMLDERD L++ LR++ E+L   ++ L ++  ++D L+ Q++S+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E   +N+H          I+    S     D++  TD  + + KRLSN  +                E+GD+    VE    + +Q   L  ++ + S L++R+ +++ +L   +K+L ++ +   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL+R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  + ++ R+ LED+  ++       +KL +E+D+++ +   L   T  ++++D                     S KV  RP RGR  +  ++    ++GE EW + QQ  V+       +  +SDI   +R
Sbjct:    1 MMCEVMPTISED-TALSQRGSQSSASDPDSHFEQLMVNMLDERDRLLDTLRETQESLALAQQHLQDVIYDRDSLQRQLSSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALRE---QNAH----------IQRKVASGDGAEDLLEGTDAQKLHSKRLSNGSM----------------ESGDEASQVVELQELLEKQNYELAQMKERMSSLSSRVSEVEQELETARKDLIKSEDMNNKFQRDIKEAMCQKEDMEERIVTLEKRYLSAQRESTSLHDITDKLENELANKEAFLRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGSIEERMRHLEGQLEEKNQELLRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQDSESYRKQLEDSIQEKSHISEEMEKLRSELDQYRLRAGSLTEPTLSRSHLDASGDLRFSLGSLAETQSDHYRSTKVIRRPRRGRMGLRREEQKAKSLGEHEW-RSQQLGVLGGHPFESDTEMSDIDDDDR 607          
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:ZFIN;Acc:ZDB-GENE-070720-14])

HSP 1 Score: 361.303 bits (926), Expect = 4.478e-103
Identity = 187/345 (54.20%), Postives = 242/345 (70.14%), Query Frame = 2
Query: 3590 FVDQQNLQIDQPITAN--ITNPMV-PFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  ++  ++DQP++ +  +T P++  F ++  ++++L    +    DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  +++                               LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E     D  D LVW+ ++VM WI++I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  765 FGKKEKARLDQPLSKDGQMTPPVIQDFEMSIGDTMTLSKLGTQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPS-APLTSRTSSGNVWVTHEEMENMATSTKMDNEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLHYGIMCLKRLNYDRKELERRRE-DFQHDIKDTLVWTNDQVMQWIQNIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1107          

HSP 2 Score: 270.781 bits (691), Expect = 1.756e-73
Identity = 235/607 (38.71%), Postives = 350/607 (57.66%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSN-NILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSD 1852
            M+C++MPTI+E  S    R SQ  +D  +N E +++NMLDERD L+E LR++ E L  ++ +L ++  E+D+L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E V + ++      KD              +  +  D M     ++KRL N +I A     + ++  ++LD+A          N E+ +       R +   LT R+ +L+ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+   ++++L  E+++ + +   L  +  A+ D       P R       D   ++ EG+ D    + V+    +     L D
Sbjct:    1 MMCEVMPTINEGDSVSSQRGSQNGTDAESNFEQLMVNMLDERDKLLESLRETQETLIQSQTKLQDVLHERDVLQRQLNSALPQEFATLTKELNLCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLSAATQEVVMLRQR------KD------------GRADGDAVDRMDSSKPTWKRLPNGSIDAHDDTSRCLELQELLDKA----------NKELAQN------RERIGGLTNRMSELETELATARKDLLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLEAQLEEKNQELGRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHNKERLIGEIEKLRAELDHLKRRSGAFGDG----THP-RSHLGSATDLRFSVVEGQGDHYSSTGVIRRAQKGRMVALRD 557          
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:ZFIN;Acc:ZDB-GENE-070720-14])

HSP 1 Score: 361.303 bits (926), Expect = 4.974e-103
Identity = 187/345 (54.20%), Postives = 242/345 (70.14%), Query Frame = 2
Query: 3590 FVDQQNLQIDQPITAN--ITNPMV-PFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  ++  ++DQP++ +  +T P++  F ++  ++++L    +    DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  +++                               LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E     D  D LVW+ ++VM WI++I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  777 FGKKEKARLDQPLSKDGQMTPPVIQDFEMSIGDTMTLSKLGTQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPS-APLTSRTSSGNVWVTHEEMENMATSTKMDNEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLHYGIMCLKRLNYDRKELERRRE-DFQHDIKDTLVWTNDQVMQWIQNIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1119          

HSP 2 Score: 270.781 bits (691), Expect = 2.240e-73
Identity = 235/607 (38.71%), Postives = 350/607 (57.66%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSN-NILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSD 1852
            M+C++MPTI+E  S    R SQ  +D  +N E +++NMLDERD L+E LR++ E L  ++ +L ++  E+D+L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E V + ++      KD              +  +  D M     ++KRL N +I A     + ++  ++LD+A          N E+ +       R +   LT R+ +L+ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+   ++++L  E+++ + +   L  +  A+ D       P R       D   ++ EG+ D    + V+    +     L D
Sbjct:    1 MMCEVMPTINEGDSVSSQRGSQNGTDAESNFEQLMVNMLDERDKLLESLRETQETLIQSQTKLQDVLHERDVLQRQLNSALPQEFATLTKELNLCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLSAATQEVVMLRQR------KD------------GRADGDAVDRMDSSKPTWKRLPNGSIDAHDDTSRCLELQELLDKA----------NKELAQN------RERIGGLTNRMSELETELATARKDLLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLEAQLEEKNQELGRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHNKERLIGEIEKLRAELDHLKRRSGAFGDG----THP-RSHLGSATDLRFSVVEGQGDHYSSTGVIRRAQKGRMVALRD 557          
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:ZFIN;Acc:ZDB-GENE-070720-14])

HSP 1 Score: 361.303 bits (926), Expect = 5.653e-103
Identity = 187/345 (54.20%), Postives = 242/345 (70.14%), Query Frame = 2
Query: 3590 FVDQQNLQIDQPITAN--ITNPMV-PFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  ++  ++DQP++ +  +T P++  F ++  ++++L    +    DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  +++                               LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E     D  D LVW+ ++VM WI++I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  777 FGKKEKARLDQPLSKDGQMTPPVIQDFEMSIGDTMTLSKLGTQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPS-APLTSRTSSGNVWVTHEEMENMATSTKMDNEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLHYGIMCLKRLNYDRKELERRRE-DFQHDIKDTLVWTNDQVMQWIQNIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1119          

HSP 2 Score: 271.552 bits (693), Expect = 1.178e-73
Identity = 234/607 (38.55%), Postives = 350/607 (57.66%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSN-NILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSD 1852
            M+C++MPTI+E  S    R SQ  +D  +N E +++NMLDERD L+E LR++ E L  ++ +L ++  E+D+L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E V + ++  ++   D                 +  D M     ++KRL N +I A     + ++  ++LD+A          N E+ +       R +   LT R+ +L+ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+   ++++L  E+++ + +   L  +  A+ D       P R       D   ++ EG+ D    + V+    +     L D
Sbjct:    1 MMCEVMPTINEGDSVSSQRGSQNGTDAESNFEQLMVNMLDERDKLLESLRETQETLIQSQTKLQDVLHERDVLQRQLNSALPQEFATLTKELNLCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLSAATQEVVMLRQR--KDGRADG----------------DAVDRMDSSKPTWKRLPNGSIDAHDDTSRCLELQELLDKA----------NKELAQN------RERIGGLTNRMSELETELATARKDLLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLEAQLEEKNQELGRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHNKERLIGEIEKLRAELDHLKRRSGAFGDG----THP-RSHLGSATDLRFSVVEGQGDHYSSTGVIRRAQKGRMVALRD 557          
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:ZFIN;Acc:ZDB-GENE-070720-14])

HSP 1 Score: 361.303 bits (926), Expect = 5.731e-103
Identity = 187/345 (54.20%), Postives = 242/345 (70.14%), Query Frame = 2
Query: 3590 FVDQQNLQIDQPITAN--ITNPMV-PFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  ++  ++DQP++ +  +T P++  F ++  ++++L    +    DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  +++                               LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E     D  D LVW+ ++VM WI++I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  786 FGKKEKARLDQPLSKDGQMTPPVIQDFEMSIGDTMTLSKLGTQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPS-APLTSRTSSGNVWVTHEEMENMATSTKMDNEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLHYGIMCLKRLNYDRKELERRRE-DFQHDIKDTLVWTNDQVMQWIQNIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1128          

HSP 2 Score: 270.396 bits (690), Expect = 2.641e-73
Identity = 235/607 (38.71%), Postives = 350/607 (57.66%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSN-NILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSD 1852
            M+C++MPTI+E  S    R SQ  +D  +N E +++NMLDERD L+E LR++ E L  ++ +L ++  E+D+L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E V + ++      KD              +  +  D M     ++KRL N +I A     + ++  ++LD+A          N E+ +       R +   LT R+ +L+ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+   ++++L  E+++ + +   L  +  A+ D       P R       D   ++ EG+ D    + V+    +     L D
Sbjct:    1 MMCEVMPTINEGDSVSSQRGSQNGTDAESNFEQLMVNMLDERDKLLESLRETQETLIQSQTKLQDVLHERDVLQRQLNSALPQEFATLTKELNLCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLSAATQEVVMLRQR------KD------------GRADGDAVDRMDSSKPTWKRLPNGSIDAHDDTSRCLELQELLDKA----------NKELAQN------RERIGGLTNRMSELETELATARKDLLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLEAQLEEKNQELGRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHNKERLIGEIEKLRAELDHLKRRSGAFGDG----THP-RSHLGSATDLRFSVVEGQGDHYSSTGVIRRAQKGRMVALRD 557          
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Match: ino80b (INO80 complex subunit B [Source:Xenbase;Acc:XB-GENE-6257528])

HSP 1 Score: 377.481 bits (968), Expect = 3.141e-109
Identity = 170/250 (68.00%), Postives = 206/250 (82.40%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E  +  +  DVLVWS +RV+ WI+ I LR+YA N+ +SG+HG+L+ LD++FD   L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  750 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRE-TSQHEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGIHGSLIALDENFDYTSLALLLQIPTQNTQARQILEREYNNLLALGTE 998          

HSP 2 Score: 178.718 bits (452), Expect = 1.570e-44
Identity = 189/616 (30.68%), Postives = 303/616 (49.19%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSI--RMMNGSCSNGTDI--MTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQV--RPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R                         VS  E+ L  ++++ + +    I  R+ NGS  +  D   M ++ E  ++                                  N+E+ +      ++ + S L+AR+ +++ +    +KEL +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q    K        E+ P +  EL +                        R+A   K  + H                  ++  +R   A L EKNQ       ++R+     +                Y + + + +  D +  +V  RP RGR  V  ++  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQRLQDVIYDRDSLQRQLNSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLER-------------------------VSALEEELTAANQEIIFLLESLILQRLSNGSIDSNDDASQMVELQELLEK---------------------------------QNYEMTQ------MKERLSSLSARVGEVEQEAESARKELVKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQREATSIHDINDKLENELANKEAILRQMEEKNRQLQERLEMAEQKLQQTMRK-------AETLPEVEAELAQ------------------------RIAALTKAEERHGN----------------IEERMRHLEAQLEEKNQ------ELQRVCISCNL---------------RYSVGSLVDSQSDYRSTKVIRRPRRGRMGVRREEQPVKSLGDHEWNRTQQIGVLSSHAFESDTEMSDIDDDDR 484          
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Match: ino80b (INO80 complex subunit B [Source:Xenbase;Acc:XB-GENE-6257528])

HSP 1 Score: 377.867 bits (969), Expect = 5.097e-109
Identity = 170/250 (68.00%), Postives = 206/250 (82.40%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E  +  +  DVLVWS +RV+ WI+ I LR+YA N+ +SG+HG+L+ LD++FD   L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  796 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRE-TSQHEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGIHGSLIALDENFDYTSLALLLQIPTQNTQARQILEREYNNLLALGTE 1044          

HSP 2 Score: 186.808 bits (473), Expect = 5.997e-47
Identity = 200/617 (32.41%), Postives = 320/617 (51.86%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSI--RMMNGSCSNGTDI--MTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEK-NQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMD--SKKVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R                         VS  E+ L  ++++ + +    I  R+ NGS  +  D   M ++ E  ++                                  N+E+ +      ++ + S L+AR+ +++ +    +KEL +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q    K        E+ P +  EL + +  L    K  E             AQ E+ N E  +R+  +  N+L  + E +   +      L E+  +L SE+D + +I   + I+       +D      Y + + + +  D  S KV  RP RGR  V  ++  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQRLQDVIYDRDSLQRQLNSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLER-------------------------VSALEEELTAANQEIIFLLESLILQRLSNGSIDSNDDASQMVELQELLEK---------------------------------QNYEMTQ------MKERLSSLSARVGEVEQEAESARKELVKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQREATSIHDINDKLENELANKEAILRQMEEKNRQLQERLEMAEQKLQQTMRK-------AETLPEVEAELAQRIAAL---TKAEERHGNIEERMRHLEAQLEEKNQE-LQRVCIS-SNILHNTCENISGIIVIFQDRLQEEVEKLRSEVDQV-KIRTGSLIEPTLTRPHLDSSAELRYSVGSLVDSQSDYRSTKVIRRPRRGRMGVRREEQPVKSLGDHEWNRTQQIGVLSSHAFESDTEMSDIDDDDR 540          
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Match: ino80b (INO80 complex subunit B [Source:Xenbase;Acc:XB-GENE-6257528])

HSP 1 Score: 370.933 bits (951), Expect = 2.713e-106
Identity = 170/259 (65.64%), Postives = 207/259 (79.92%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN---------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P            ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E +   +  DVLVWS +RV+ WI+ I LR+YA N+ +SG+HG+L+ LD++FD   L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  838 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTVIPLDITLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRETSQ-HEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGIHGSLIALDENFDYTSLALLLQIPTQNTQARQILEREYNNLLALGTE 1095          

HSP 2 Score: 211.846 bits (538), Expect = 1.122e-54
Identity = 210/618 (33.98%), Postives = 335/618 (54.21%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLY------AEVDRWKRQNYELATQLQAYMD--SKKVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL      T + +    E V++ E+N     K       P    + G    G  I        KRLSN           +D +D   +  + ++   + N+E+ +      ++ + S L+AR+ +++ +    +KEL +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q    K        E+ P +  EL + +  L    K  E             AQ E+ N E  +R+  + +N+L + +E  +  L E    L +K++L  E++ +R  ++  +I    L         +D      Y + + + +  D  S KV  RP RGR  V  ++  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQRLQDVIYDRDSLQRQLNSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL------TAANQ----EIVALREQNAHIQRKMG-TGEGPEQEALEG-MEQGQKIHD------KRLSNG---------SIDSNDDASQMVELQELLEKQNYEMTQ------MKERLSSLSARVGEVEQEAESARKELVKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQREATSIHDINDKLENELANKEAILRQMEEKNRQLQERLEMAEQKLQQTMRK-------AETLPEVEAELAQRIAAL---TKAEERHGNIEERMRHLEAQLEEKNQE-LQRVCISCNNILLQESETFRKQLEE---CLHDKDRLQEEVEKLRSEVDQVKIRTGSLIEPTLTRPHLDSSAELRYSVGSLVDSQSDYRSTKVIRRPRRGRMGVRREEQPVKSLGDHEWNRTQQIGVLSSHAFESDTEMSDIDDDDR 571          
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Match: ino80b (INO80 complex subunit B [Source:Xenbase;Acc:XB-GENE-6257528])

HSP 1 Score: 365.155 bits (936), Expect = 5.422e-105
Identity = 172/273 (63.00%), Postives = 208/273 (76.19%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPR--------------------PNKS---LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                     P K+   LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E  +  +  DVLVWS +RV+ WI+ I LR+YA N+ +SG+HG+L+ LD++FD   L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  748 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLTAPTKTVSTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRE-TSQHEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGIHGSLIALDENFDYTSLALLLQIPTQNTQARQILEREYNNLLALGTE 1019          

HSP 2 Score: 168.318 bits (425), Expect = 2.712e-41
Identity = 157/420 (37.38%), Postives = 247/420 (58.81%), Query Frame = 2
Query:   53 ICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDI--MTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALD-----NLR---SKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSES--------ENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKL 1255
            +C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL        +   F  E++ +                    R+ NGS  +  D   M ++ E  ++ +  +    T  KE     +    G+ E+ A  +  E+V+ E ++     ++R   +++ ++  R+  L+ + +  Q+E    H+  ++L+NEL+          E +R++Q ERL   EQ+L    ++     E L   +AEL+ +   + + EE+  N+ E++
Sbjct:    1 MCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQRLQDVIYDRDSLQRQLNSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL--------TAIIFLLESLILQ-------------------RLSNGSIDSNDDASQMVELQELLEKQNYEM----TQMKE-RLSSLSARVGEVEQEAESARKELVKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQREATSIHDINDKLENELANKEAILRQMEEKNRQLQ-ERLEMAEQKLQQTMRKA----ETLPEVEAELAQRIAALTKAEERHGNIEERM 383          
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Match: ino80b (INO80 complex subunit B [Source:Xenbase;Acc:XB-GENE-6257528])

HSP 1 Score: 367.081 bits (941), Expect = 6.456e-105
Identity = 172/269 (63.94%), Postives = 208/269 (77.32%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPA--PGPRPNKS-----------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P  R  +S                 LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E +   +  DVLVWS +RV+ WI+ I LR+YA N+ +SG+HG+L+ LD++FD   L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  838 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTKESEEGSWAQVIPLDITLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRETSQ-HEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGIHGSLIALDENFDYTSLALLLQIPTQNTQARQILEREYNNLLALGTE 1105          

HSP 2 Score: 211.46 bits (537), Expect = 1.642e-54
Identity = 210/618 (33.98%), Postives = 335/618 (54.21%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLY------AEVDRWKRQNYELATQLQAYMD--SKKVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL      T + +    E V++ E+N     K       P    + G    G  I        KRLSN           +D +D   +  + ++   + N+E+ +      ++ + S L+AR+ +++ +    +KEL +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q    K        E+ P +  EL + +  L    K  E             AQ E+ N E  +R+  + +N+L + +E  +  L E    L +K++L  E++ +R  ++  +I    L         +D      Y + + + +  D  S KV  RP RGR  V  ++  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQRLQDVIYDRDSLQRQLNSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL------TAANQ----EIVALREQNAHIQRKMG-TGEGPEQEALEG-MEQGQKIHD------KRLSNG---------SIDSNDDASQMVELQELLEKQNYEMTQ------MKERLSSLSARVGEVEQEAESARKELVKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQREATSIHDINDKLENELANKEAILRQMEEKNRQLQERLEMAEQKLQQTMRK-------AETLPEVEAELAQRIAAL---TKAEERHGNIEERMRHLEAQLEEKNQE-LQRVCISCNNILLQESETFRKQLEE---CLHDKDRLQEEVEKLRSEVDQVKIRTGSLIEPTLTRPHLDSSAELRYSVGSLVDSQSDYRSTKVIRRPRRGRMGVRREEQPVKSLGDHEWNRTQQIGVLSSHAFESDTEMSDIDDDDR 571          
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Match: Ppfia4 (protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4 [Source:MGI Symbol;Acc:MGI:1915757])

HSP 1 Score: 364.77 bits (935), Expect = 1.075e-106
Identity = 171/269 (63.57%), Postives = 207/269 (76.95%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS---------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                     LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP  + QARQ + RE ++L+  G
Sbjct:  543 FAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATSTKTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALVLQIPTQSTQARQVMEREFNNLLALG 810          

HSP 2 Score: 91.2781 bits (225), Expect = 9.412e-18
Identity = 73/191 (38.22%), Postives = 107/191 (56.02%), Query Frame = 2
Query: 1064 LSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEK---IQNLLE----KLNETNYRCQTQQSKEASNQNRV------ESEPAMSTELVKELE-QLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIR 1594
            L E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K    ++CEEK   +Q LLE    KL +T  + +T    EA    R+      E       E +++LE QL E N+ L            R+ QREK+N++H KRLS TVD LL+ESNERLQ HL+E+MA L EK +L+ E++ +R
Sbjct:    1 LREALAQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRKAETLPEVEAELSQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELA-----------RVRQREKMNEDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKGRLSEEIEKLR 180          
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Match: Ppfia2 (protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2 [Source:MGI Symbol;Acc:MGI:2443834])

HSP 1 Score: 365.925 bits (938), Expect = 3.952e-104
Identity = 174/287 (60.63%), Postives = 209/287 (72.82%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-------------------------------------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                                        ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  894 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLTAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 1179          

HSP 2 Score: 261.922 bits (668), Expect = 2.170e-70
Identity = 248/665 (37.29%), Postives = 379/665 (56.99%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDV------------------VQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSN----GTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWK-------------------RQNYELATQLQ----AYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQD+                    L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E+N+   H    +VSS       GS  +    G +    ++E  KRLSN      +I    D   I++     EK     N+E+ +      ++ + + L++R+ +++ +    +K+L +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +N R+ LE++  D+++L  E+++ +                   R + + +T+L+    + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+ +     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDRDSLQRQLNSALPQDIESLTGGLTGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALREQNV---HIQRKMVSS------EGSTESEHLEGMEAGQKVHE--KRLSN-----GSIDSTDDTSQIVELQELLEKQ----NYEMAQ------MKERLTALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESENFRKNLEESLHDKERLAEEIEKLRSELDQMKMRTGSLIEPTISRTHIDTSTELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLGSHPFESDTEMSDIDDDDR 628          
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Match: Ppfia2 (protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 2 [Source:MGI Symbol;Acc:MGI:2443834])

HSP 1 Score: 365.925 bits (938), Expect = 3.970e-104
Identity = 174/287 (60.63%), Postives = 209/287 (72.82%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-------------------------------------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                                        ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  895 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLTAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 1180          

HSP 2 Score: 261.922 bits (668), Expect = 2.089e-70
Identity = 248/665 (37.29%), Postives = 379/665 (56.99%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDV------------------VQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSN----GTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWK-------------------RQNYELATQLQ----AYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQD+                    L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E+N+   H    +VSS       GS  +    G +    ++E  KRLSN      +I    D   I++     EK     N+E+ +      ++ + + L++R+ +++ +    +K+L +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +N R+ LE++  D+++L  E+++ +                   R + + +T+L+    + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+ +     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDRDSLQRQLNSALPQDIESLTGGLTGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALREQNV---HIQRKMVSS------EGSTESEHLEGMEAGQKVHE--KRLSN-----GSIDSTDDTSQIVELQELLEKQ----NYEMAQ------MKERLTALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESENFRKNLEESLHDKERLAEEIEKLRSELDQMKMRTGSLIEPTISRTHIDTSTELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLGSHPFESDTEMSDIDDDDR 628          
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Match: Ppfia4 (protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4 [Source:MGI Symbol;Acc:MGI:1915757])

HSP 1 Score: 362.844 bits (930), Expect = 1.585e-103
Identity = 171/278 (61.51%), Postives = 207/278 (74.46%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                              LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP  + QARQ + RE ++L+  G
Sbjct:  826 FAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALVLQIPTQSTQARQVMEREFNNLLALG 1102          

HSP 2 Score: 195.667 bits (496), Expect = 8.312e-50
Identity = 197/531 (37.10%), Postives = 287/531 (54.05%), Query Frame = 2
Query:   53 ICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTG---------ETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESEN-HREIQ------GERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELE-QLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIR 1594
            +C++MPTI+E   G        +   AN E +++NMLDER+ L+E LR+S E L  T+ +L +   E+D L+  +NS+LPQ+   L +EL   +EQ+ EREEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLR +L+R+  LE++L        + +   G          TV +  K L       +      +   N   S   + +  ++ +   L  ++           RD I  E        + S H+   +EAL    +++ ++  R+  L+ + +  Q+E    H+  ++L+NEL+  E+ HR+ +       E L   EQ+L    ++     E L   +AELS +   + + EE+  N+ E L                                ++LE QL E N+ L            R+ QREK+N++H KRLS TVD LL+ESNERLQ HL+E+MA L EK +L+ E++ +R
Sbjct:    1 MCEVMPTINE---GDPLGPPHGADAEANFEQLMVNMLDEREKLLESLRESQETLVATQSRLQDALHERDQLQRHLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQVSALQQGAGIRDGVAEEEGTVDLGPKRLWKDDTGRVEELQGLLEKQNYELSQARERLVTLSATVTELEEDL-------GTARRDLIKSE-------ELSSKHQRDLREAL----AQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRKA----ETLPEVEAELSQRIAALTKAEERHGNIEEHL--------------------------------RQLEGQLEEKNQELA-----------RVRQREKMNEDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKGRLSEEIEKLR 463          
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Match: Ppfia4 (protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4 [Source:MGI Symbol;Acc:MGI:1915757])

HSP 1 Score: 362.459 bits (929), Expect = 1.693e-103
Identity = 171/278 (61.51%), Postives = 207/278 (74.46%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                              LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP  + QARQ + RE ++L+  G
Sbjct:  826 FAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALVLQIPTQSTQARQVMEREFNNLLALG 1102          

HSP 2 Score: 196.052 bits (497), Expect = 6.540e-50
Identity = 197/524 (37.60%), Postives = 287/524 (54.77%), Query Frame = 2
Query:   53 ICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTG--ETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESEN-HREIQ------GERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELE-QLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIR 1594
            +C++MPTI+E   G        +   AN E +++NMLDER+ L+E LR+S E L  T+ +L +   E+D L+  +NS+LPQ+   L +EL   +EQ+ EREEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLR +L+R+  LE++L        + +   G  + V+  E  ++   K      +  +  + G        ++   E    LS  +           RD I  E        + S H+   +EAL    +++ ++  R+  L+ + +  Q+E    H+  ++L+NEL+  E+ HR+ +       E L   EQ+L    ++     E L   +AELS +   + + EE+  N+ E L                                ++LE QL E N+ L            R+ QREK+N++H KRLS TVD LL+ESNERLQ HL+E+MA L EK +L+ E++ +R
Sbjct:    1 MCEVMPTINE---GDPLGPPHGADAEANFEQLMVNMLDEREKLLESLRESQETLVATQSRLQDALHERDQLQRHLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQLAGAHQQVSALQQGAGIRDGVAEEEGTVDLGPKRLWKDDTGRVEELQGLLEKQNYELSQARERLVTLSATVTELEEDLGTARRDLIKSE-------ELSSKHQRDLREAL----AQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRKA----ETLPEVEAELSQRIAALTKAEERHGNIEEHL--------------------------------RQLEGQLEEKNQELA-----------RVRQREKMNEDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKGRLSEEIEKLR 463          
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Match: sp|O75334|LIPA2_HUMAN (Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2)

HSP 1 Score: 366.311 bits (939), Expect = 2.143e-103
Identity = 176/287 (61.32%), Postives = 210/287 (73.17%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPR--------------------PNKS-----------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                     P K+                 LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  895 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLAAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 1180          

HSP 2 Score: 257.684 bits (657), Expect = 2.986e-68
Identity = 243/665 (36.54%), Postives = 375/665 (56.39%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDV------------------VQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSN----GTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQ-----------------------NYELATQLQAYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQD+                    L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E+N+   H    + SS       GS  +    G +    ++E  KRLSN           +D  D   +  + ++   + N+E+ +      ++ + + L++R+ +++ +    +K+L +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +  R+ LE++  D+++L  E+++ + +                       + EL   + + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+S+     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDRDSLQRQLNSALPQDIESLTGGLAGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALREQNV---HIQRKMASS------EGSTESEHLEGMEPGQKVHE--KRLSNG---------SIDSTDETSQIVELQELLEKQNYEMAQ------MKERLAALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRSELDQLKMRTGSLIEPTIPRTHLDTSAELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDR 628          
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Match: sp|Q8BSS9|LIPA2_MOUSE (Liprin-alpha-2 OS=Mus musculus OX=10090 GN=Ppfia2 PE=1 SV=2)

HSP 1 Score: 365.925 bits (938), Expect = 2.485e-103
Identity = 174/287 (60.63%), Postives = 209/287 (72.82%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-------------------------------------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                                        ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E A+  +  DVLVWS +RV+ WI+ I LREYA N+ +SGVHG+L+ LD++FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  895 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLTAPAKTKESEEGSWAQCPVFLQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELERRRE-ASQHEIKDVLVWSNDRVIRWIQAIGLREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTE 1180          

HSP 2 Score: 261.536 bits (667), Expect = 2.076e-69
Identity = 251/665 (37.74%), Postives = 380/665 (57.14%), Query Frame = 2
Query:   50 MICDIMPTISENGS-GYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDV------------------VQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSN----GTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR-------DKLYAEVDRWK------------RQNYELATQLQ----AYMDSK------KVQVRPLRGRENVLPDQ--VNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTI+E+         S  S   ++ E +++NMLDERD L++ LR++ E+L   +++L ++  ++D L+ Q+NS+LPQD+                    L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               E V++ E+N+   H    +VSS       GS  +    G +    ++E  KRLSN      +I    D   I++     EK     N+E+ +      ++ + + L++R+ +++ +    +K+L +  E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  E +N R+ LE++  D+       +KL +E+D+ K            R + + +T+L+    + +DS+      KV  RP RGR  V  D+  V ++G+ EW++ QQ  V+ +     +  +SDI   +R
Sbjct:    1 MMCEVMPTINEDTPMSQRGSQSSGSDSDSHFEQLMVNMLDERDRLLDTLRETQESLSLAQQRLQDVIYDRDSLQRQLNSALPQDIESLTGGLTGSKGADPPEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL----------AAANQEIVALREQNV---HIQRKMVSS------EGSTESEHLEGMEAGQKVHE--KRLSN-----GSIDSTDDTSQIVELQELLEKQ----NYEMAQ------MKERLTALSSRVGEVEQEAETARKDLIKTEEMNTKYQRDIREAMAQKEDMEERITTLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESENFRKNLEESLHDKVSLAEEIEKLRSELDQMKMRTGSLIEPTISRTHIDTSTELRYSVGSLVDSQSDYRTTKVIRRPRRGRMGVRRDEPKVKSLGDHEWNRTQQIGVLGSHPFESDTEMSDIDDDDR 628          
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Match: sp|Q91Z80|LIPA4_RAT (Liprin-alpha-4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppfia4 PE=1 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 4.971e-103
Identity = 171/278 (61.51%), Postives = 206/278 (74.10%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                              LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP    QARQ + RE ++L+  G
Sbjct:  685 FAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLATSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALVLQIPTQNTQARQVMEREFNNLLALG 961          

HSP 2 Score: 135.191 bits (339), Expect = 2.068e-30
Identity = 129/384 (33.59%), Postives = 191/384 (49.74%), Query Frame = 2
Query:  491 VSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKR--LSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEK---IQNLLE----KLNETNYRCQTQQSKEASNQNRV------ESEPAMSTELVKELE-QLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIR 1594
            VSSEVEVLKALKSLFEHHKALDEKVRERLR +L+R                         V+  E+ L  +H+    VS+            G  I   + E  +   L    L K   G+  +   +L++           N+E      L   R +   L+A + +L+  L   +++L ++ E   + + +L E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K    ++CEEK   +Q LLE    KL +T  + +T    EA    R+      E       E +++LE QL E N+ L            R+ QREK+N++H KRLS TVD LL+ESNERLQ HL+E+MA L EK +L+ E++ +R
Sbjct:    2 VSSEVEVLKALKSLFEHHKALDEKVRERLRAALER-------------------------VTTLEEQLAGAHQQ---VSA---------LQQGAGIRDGVAEEEETVDLGPKRLWKDDTGRVEELQGLLEK----------QNYE------LSQARERLVTLSATVTELEEDLGTARRDLIKSEELSGKHQRDLREALAQKEDMEERITTLEKRYLAAQREATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRKAETLPEVEAELSQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELA-----------RVRQREKMNEDHNKRLSDTVDRLLSESNERLQLHLKERMAALEEKGRLSEEIEKLR 321          
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Match: sp|O75335|LIPA4_HUMAN (Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3)

HSP 1 Score: 360.918 bits (925), Expect = 3.845e-102
Identity = 171/278 (61.51%), Postives = 206/278 (74.10%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS------------------------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISN LHRLKLRLAIQEMV LTSP+  P    S                              LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLKRLNYDRK+LE R+E  +  +  DVLVW+ ++V+ W++ I LR+YAGNL +SGVHGALL LD++FD N L ++LQIP    QARQ + RE ++L+  G
Sbjct:  826 FAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVSLTSPSAPPTSRTSSGNVWVTHEEMETLETSTKTDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRRE-ESQHEIKDVLVWTNDQVVHWVQSIGLRDYAGNLHESGVHGALLALDENFDHNTLALILQIPTQNTQARQVMEREFNNLLALG 1102          

HSP 2 Score: 149.828 bits (377), Expect = 9.356e-35
Identity = 112/191 (58.64%), Postives = 145/191 (75.92%), Query Frame = 2
Query:   53 ICDIMPTISENGSGYEDR--DSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDEL 619
            +C++MPTI+E      DR      +   AN E +++NMLDER+ L+E LR+S E L  T+ +L +   E+D L+  +NS+LPQ+   L +EL   +EQ+ EREEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLR +L+R+  LE++L
Sbjct:    1 MCEVMPTINEG-----DRLGPPHGADADANFEQLMVNMLDEREKLLESLRESQETLAATQSRLQDAIHERDQLQRHLNSALPQEFATLTRELSMCREQLLEREEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVTTLEEQL 186          
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Match: sp|Q13136|LIPA1_HUMAN (Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 9.587e-102
Identity = 165/248 (66.53%), Postives = 199/248 (80.24%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+V WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQE++ LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+S   G+ CL+RLNYDRK+LE ++E + + +  DVLVWS +RV+ WI  I L+EYA NL +SGVHGALL LD+ FD + L +LLQIP    QAR  L RE ++L+  G
Sbjct:  875 FAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGIMCLRRLNYDRKELERKREESQS-EIKDVLVWSNDRVIRWILSIGLKEYANNLIESGVHGALLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVMG 1121          

HSP 2 Score: 251.136 bits (640), Expect = 2.947e-66
Identity = 244/641 (38.07%), Postives = 369/641 (57.57%), Query Frame = 2
Query:   50 MICDIMPTISE-------NGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLY-------AEVDRWKRQN-----------------YELATQLQAYMDSKKVQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAF--NAGLSD 1852
            M+C++MPTISE        G       SQ  +D ++ E ++++ML+ERD L++ LR++ E L  T+ +L E+  E+D L+ Q+N++LPQ+   L KEL   +EQ+ EREEE +ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R   LE+EL       G+T                  HK+ ++     ++  N      TD + DIN   +   +    +++ G     +D+      +E  + +S  +   +E L +L S  +EL    +DLD      +K+L ++ E   +L+ ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + E+++K+   ++ E+K + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  + +EAQLEE N EL R  QREK+N+EH KRLS TVD LL+ESNERLQ HL+E+MA L +KN L  E+++ ++ LE+TQ D+D+L        AE+D  + +                  + +A        +  V  RP +GR   L   P +V T+ E +W++ QQ+ V++NV QAF  +A +SD
Sbjct:    1 MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDAD-SHFEQLMVSMLEERDRLLDTLRETQETLALTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSLLEEEL-------GAT------------------HKELMI-----LKEQNNQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHVTELE---EDLD----TARKDLIKSEEMNTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSMHRQTEDKNRQLQERLELAEQKLQ-QTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQMEAQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLREVESAKKQLEETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMADGHTDSYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADVSD 602          
BLAST of Liprin-alpha-4 vs. TrEMBL
Match: A0A0R3T600 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2487 PE=4 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 6.505e-119
Identity = 181/250 (72.40%), Postives = 207/250 (82.80%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALSE EIQREIGISNPLHRLKLRLAIQEMV LT+P P PRPN S LAFG+++HEW+GN WLP LGL+Q+RPAFMECLVDARMLDHLTK+DLR HLKM++  HR+SLLYG+ CLKRLNYDR +LE RQ  +  +D+ D+LVW+CERV +W++ I LREYA +LT SGVHG LL L    DAN L ++LQIP+SA  AR  L REL  LV+R R
Sbjct:   75 FAQWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMAALSEQEIQREIGISNPLHRLKLRLAIQEMVALTAPTPTPRPNTSRLAFGDMDHEWIGNVWLPGLGLAQYRPAFMECLVDARMLDHLTKRDLRTHLKMVDAMHRTSLLYGIVCLKRLNYDRAELERRQRESLLRDNIDLLVWTCERVQAWLDQIGLREYASHLTGSGVHGGLLGLHTEVDANQLALILQIPSSATNARLILARELETLVQRYR 324          
BLAST of Liprin-alpha-4 vs. TrEMBL
Match: A0A0R3SBT6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1975 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 2.562e-117
Identity = 180/250 (72.00%), Postives = 206/250 (82.40%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
            F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALSE EIQREIGISNPLHRLKLRLAIQEMV LT+P P PRPN S LAFG+++HEW+GN WLP LGL+Q+RPAFMECLVDARMLDHLTK+DLR HLKM++  HR+SLLYG+ CLKRLNYDR +LE RQ  +  +D+ D+LVW+CERV +W++ I LREYA +L  SGVHG LL L    DAN L ++LQIP+SA  AR  L REL  LV+R R
Sbjct:   54 FAQWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMAALSEQEIQREIGISNPLHRLKLRLAIQEMVALTAPTPTPRPNTSRLAFGDMDHEWIGNVWLPGLGLAQYRPAFMECLVDARMLDHLTKRDLRTHLKMVDAMHRTSLLYGIVCLKRLNYDRAELERRQRESLHRDNIDLLVWTCERVQAWLDQIGLREYASHLNGSGVHGGLLGLHIEVDANQLALILQIPSSATNARLILARELESLVQRYR 303          
BLAST of Liprin-alpha-4 vs. TrEMBL
Match: A0A564YE67 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5595 PE=4 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.432e-115
Identity = 180/253 (71.15%), Postives = 208/253 (82.21%), Query Frame = 2
Query: 3770 NVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
            ++ F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALSE EIQREIGISNPLHRLKLRLAIQEMV LT+P P PRPN S LAFG+++HEW+GN WLP LGL+Q+RPAFMECLVDARMLDHLTK+DLR HLKM++  HR+SLLYG+ CLKRLNYDR +LE RQ  +  +D+ D+LVW+CERV +W++ I LREYA +L  SGVHG LL L    DAN L ++LQIP+SA  AR  L REL  LV+R R
Sbjct:  305 HLPFAQWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMAALSEQEIQREIGISNPLHRLKLRLAIQEMVALTAPTPTPRPNTSRLAFGDMDHEWIGNVWLPGLGLAQYRPAFMECLVDARMLDHLTKRDLRTHLKMVDAMHRTSLLYGIVCLKRLNYDRAELERRQRESLHRDNIDLLVWTCERVQAWLDQIGLREYASHLNGSGVHGGLLGLHIEVDANQLALILQIPSSATNARLILARELESLVQRYR 557          
BLAST of Liprin-alpha-4 vs. TrEMBL
Match: A0A564YE78 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5595 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 3.904e-115
Identity = 180/253 (71.15%), Postives = 208/253 (82.21%), Query Frame = 2
Query: 3770 NVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
            ++ F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIM ALSE EIQREIGISNPLHRLKLRLAIQEMV LT+P P PRPN S LAFG+++HEW+GN WLP LGL+Q+RPAFMECLVDARMLDHLTK+DLR HLKM++  HR+SLLYG+ CLKRLNYDR +LE RQ  +  +D+ D+LVW+CERV +W++ I LREYA +L  SGVHG LL L    DAN L ++LQIP+SA  AR  L REL  LV+R R
Sbjct:  390 HLPFAQWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMAALSEQEIQREIGISNPLHRLKLRLAIQEMVALTAPTPTPRPNTSRLAFGDMDHEWIGNVWLPGLGLAQYRPAFMECLVDARMLDHLTKRDLRTHLKMVDAMHRTSLLYGIVCLKRLNYDRAELERRQRESLHRDNIDLLVWTCERVQAWLDQIGLREYASHLNGSGVHGGLLGLHIEVDANQLALILQIPSSATNARLILARELESLVQRYR 642          
BLAST of Liprin-alpha-4 vs. TrEMBL
Match: A0A5K3EM20 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 1.776e-114
Identity = 178/257 (69.26%), Postives = 208/257 (80.93%), Query Frame = 2
Query: 3758 VIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKS-LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
             +   + F  WNGPTIVAWLELWVGMPAWYVAACRANVKSGA+M ALSE EIQREIGISNPLHRLKLRLAIQEMV LT+P P PRPN S LAFG+++HEW+GN WLP LGL+Q+RPAFMECLVDARMLDHLTK+DLR HLKM++  HR+SLLYG+ CLKRLNYDR +LE RQ     +D+ D+LVW+CERV +W++ I LREYA +L  SGVHG LL L    DAN L ++LQIP+SA  AR  L+REL  L++R R
Sbjct:  318 AMEGRLPFAQWNGPTIVAWLELWVGMPAWYVAACRANVKSGAVMAALSEQEIQREIGISNPLHRLKLRLAIQEMVALTAPTPTPRPNTSRLAFGDMDHEWIGNVWLPGLGLAQYRPAFMECLVDARMLDHLTKRDLRTHLKMVDAMHRTSLLYGIVCLKRLNYDRTELERRQRECVHRDNIDLLVWTCERVQAWLDQIGLREYASHLNGSGVHGGLLGLHTDVDANQLALILQIPSSATNARLILSRELESLIQRYR 574          
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Match: ENSAMXT00000021039.2 (PTPRF interacting protein alpha 1 [Source:NCBI gene;Acc:103037839])

HSP 1 Score: 362.844 bits (930), Expect = 1.313e-103
Identity = 166/250 (66.40%), Postives = 200/250 (80.00%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+V WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQE++ LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FME LVDARMLDHLTKKDLR  LKM+++FHR+S   GV CL+R+NYDRK+LE R+E +   +  DVLVWS ERV+ W++ I L+EYA NL +SGVHGAL+ LD+ FD N L +LLQIP  + QAR  L RE ++L+  G E
Sbjct:  867 FAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNDWLPSLGLPQYRSYFMESLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGVMCLRRMNYDRKELEKRREESQV-EVKDVLVWSNERVIKWVQSIGLKEYANNLVESGVHGALMSLDETFDHNALALLLQIPTQSTQARAVLEREYNNLLSLGTE 1115          

HSP 2 Score: 251.521 bits (641), Expect = 2.605e-67
Identity = 240/645 (37.21%), Postives = 367/645 (56.90%), Query Frame = 2
Query:   50 MICDIMPTISE----NGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAK-ATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR----------------DKLYAEVDRWKRQ-----NYELATQLQAYMDSKK-------VQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAF--NAGLSDI 1855
            M+C++MPTISE    +  G     S + SD   + E ++++ML+ERD L++ LR++ E L  T+ +L E+  E+D L+ Q+NS+LPQ+   L KE+   +EQ+ EREEE +ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R   LE++L ++       ++ T +   + +   E +H      S+PS        +NG           KR S+  L     +GK ++  +++D                 + + L  ++ +   L+ R+ +L+  L   +K+L ++ +   RL+ +L ES   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K    ++ E+K + L E+L   + + Q Q  ++A     VE+E A     + + E+    + E  + +EAQLEE N EL+R  QREK+N+EH KRLS TVD LL+ESNERLQ HL+E+MA L +KN L  EL++ ++++ED   D+                 +L+A     +       ++       + MDS         V  RP +GR   L   P +V T+ E EW+++QQ+ V++ V  AF  +  LSD+
Sbjct:    1 MMCEVMPTISEAEVGSNGGGRGSGSPLQSDSEGHFESLMVSMLEERDRLLDTLRETQENLGLTQGKLHEVSHERDSLQRQLNSALPQEFAALTKEVNMCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSALEEQLTVSHKEMAILRDQTNQKKMLIDGQTEINHNSE---STPS--------TNG-----------KRSSDGSLGPDEDVGKVVELQEVMDR----------------QSKELLQMKERVVSLSNRVSELEEDLDTARKDLIKSEDMNTRLQRDLRESIAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENELANKESLFRQTEDKNRQLQERLELADQKLQ-QTIRKAETLPEVEAELAQRVAALTKAEERHGNVEERLRQMEAQLEEKNQELLRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNALIRELEHTKKLIEDAHHDKVSGSSAATVLLNKLCFIELFAVFSLQRSHMGSTPDFRYPVSASSMMDSHSDHYSSALVLRRPQKGRAAALRDEPSKVQTLNEQEWERVQQANVLAKVAYAFESDVDLSDM 606          
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Match: ENSAMXT00000040681.1 (PTPRF interacting protein alpha 1 [Source:NCBI gene;Acc:103037839])

HSP 1 Score: 362.844 bits (930), Expect = 1.360e-103
Identity = 166/250 (66.40%), Postives = 200/250 (80.00%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+V WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQE++ LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FME LVDARMLDHLTKKDLR  LKM+++FHR+S   GV CL+R+NYDRK+LE R+E +   +  DVLVWS ERV+ W++ I L+EYA NL +SGVHGAL+ LD+ FD N L +LLQIP  + QAR  L RE ++L+  G E
Sbjct:  878 FAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNDWLPSLGLPQYRSYFMESLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGVMCLRRMNYDRKELEKRREESQV-EVKDVLVWSNERVIKWVQSIGLKEYANNLVESGVHGALMSLDETFDHNALALLLQIPTQSTQARAVLEREYNNLLSLGTE 1126          

HSP 2 Score: 256.529 bits (654), Expect = 7.044e-69
Identity = 237/646 (36.69%), Postives = 369/646 (57.12%), Query Frame = 2
Query:   50 MICDIMPTISE----NGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQ-----------------------NYELATQLQAYMDSKK-------VQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAF--NAGLSDI 1855
            M+C++MPTISE    +  G     S + SD   + E ++++ML+ERD L++ LR++ E L  T+ +L E+  E+D L+ Q+NS+LPQ+   L KE+   +EQ+ EREEE +ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R   LE++L ++       ++ T +   + +   E +H      S+PS    NG  S+   +  D +               +GK ++  +++D                 + + L  ++ +   L+ R+ +L+  L   +K+L ++ +   RL+ +L ES   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K    ++ E+K + L E+L   + + Q Q  ++A     VE+E A     + + E+    + E  + +EAQLEE N EL+R  QREK+N+EH KRLS TVD LL+ESNERLQ HL+E+MA L +KN L  EL++ ++++ED   D+++L  +++  + +                       ++       + MDS         V  RP +GR   L   P +V T+ E EW+++QQ+ V++ V  AF  +  LSD+
Sbjct:    1 MMCEVMPTISEAEVGSNGGGRGSGSPLQSDSEGHFESLMVSMLEERDRLLDTLRETQENLGLTQGKLHEVSHERDSLQRQLNSALPQEFAALTKEVNMCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSALEEQLTVSHKEMAILRDQTNQKKMLIDGQTEINHNSE---STPST---NGKRSSDGSLGPDED---------------VGKVVELQEVMDR----------------QSKELLQMKERVVSLSNRVSELEEDLDTARKDLIKSEDMNTRLQRDLRESIAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENELANKESLFRQTEDKNRQLQERLELADQKLQ-QTIRKAETLPEVEAELAQRVAALTKAEERHGNVEERLRQMEAQLEEKNQELLRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNALIRELEHTKKLIEDAHHDKEQLLIQIETMRSESEQDRSRSNSILHQGRSHMGSTPDFRYPVSASSMMDSHSDHYSSALVLRRPQKGRAAALRDEPSKVQTLNEQEWERVQQANVLAKVAYAFESDVDLSDM 608          
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Match: ppfia2 (PTPRF interacting protein alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7905])

HSP 1 Score: 360.533 bits (924), Expect = 3.033e-103
Identity = 174/282 (61.70%), Postives = 208/282 (73.76%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPR--------------------PNKS------------LAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                     P+K+            LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E +   +  DVLVWS ERV+ W++ I LR+YA  L +SGVHGAL+ LD +FD + L +LLQIP    QARQ L RE ++L+  G E
Sbjct:  783 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTTRTPSGNVWVTHEEMETLAAPSKTKSESEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRETSQ-HEMRDVLVWSNERVIRWVQSIGLRDYANILLESGVHGALIALDDNFDYSSLALLLQIPNQNTQARQILEREYNNLLALGTE 1063          

HSP 2 Score: 192.2 bits (487), Expect = 7.555e-49
Identity = 188/467 (40.26%), Postives = 274/467 (58.67%), Query Frame = 2
Query:  296 DVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYK---RLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEA-LDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR-----DKLYAEVDRWK 1657
            +   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL      T + +    E V++ E   +N+H    + S             G D++   ++      R+SN  L                E+GD+    VE    + +Q   L  ++ + S L++R+ +++ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  + LE QLEE N EL+R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EK   NS+  N R  + D    +     +KL +E+D+++
Sbjct:    1 EFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL------TAANQ----EIVALRE---QNAHIQRKVAS-----------GEGEDLLETADQKVHGKVRMSNGSL----------------ESGDEAGQVVELQELLEKQNFELAQMKDRMSSLSSRVCEVEQELETARKDLIKSEEMNNKYQRDIKEAMCQKEDMEERIVTLEKRYLSAQRESTSLHDISDKLENELANKEAFLRQMEEKNRQLQERLELAEQKLQ-QTIRKAETLPEVEAELAQRIAALTKAEERHGSIEERMRQLEGQLEEKNQELLRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKVWSNSK--NTRMFVFDLYKGQLAEEIEKLRSELDQFR 424          
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:NCBI gene;Acc:103021714])

HSP 1 Score: 358.221 bits (918), Expect = 1.088e-102
Identity = 185/326 (56.75%), Postives = 233/326 (71.47%), Query Frame = 2
Query: 3620 QPITAN--ITNPMVP--FSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSP-AP--------------------GPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            QP++ +  +T P++P  F ++  ++++LG        DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP AP                          +LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+L+ R++     D  D LVW+ + VM W++ I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  706 QPMSKDGQMTPPIIPADFEMSIGDTMTLG---KQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPLTSRTSSGNVWVTHEEMENMAASTKATLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLQYGIMCLKRLNYDRKELDRRRDDCQ-NDIKDTLVWTNDHVMHWVQTIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1027          

HSP 2 Score: 196.438 bits (498), Expect = 3.511e-50
Identity = 188/475 (39.58%), Postives = 275/475 (57.89%), Query Frame = 2
Query:  296 DVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSI-RMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDS 1705
            +   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E   V +   E +  D +  S P+  R+ NGS         D+++   R              ++  ++LD+A +KE               L   R + + L +R+ +L+ +L   +KEL ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LE+QLEE N EL R  QREK+N+EH +RLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+    +++L  E+++ + +   L  +  A+ D 
Sbjct:    2 EFATLTKELNTCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLATTTQELSMVRQGKSEGNSVDRMDGSKPTWKRLPNGSI--------DVHDEASRC-------------LELQEMLDKA-NKE---------------LATSRERSNTLNSRVAELEGELAGVRKELLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLESQLEEKNQELGRARQREKMNEEHNRRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHTKERLIGEIEKLRAEIDHLKRRSGAFGDG 428          
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Match: ppfia4 (PTPRF interacting protein alpha 4 [Source:NCBI gene;Acc:103021714])

HSP 1 Score: 358.992 bits (920), Expect = 2.210e-102
Identity = 185/326 (56.75%), Postives = 233/326 (71.47%), Query Frame = 2
Query: 3620 QPITAN--ITNPMVP--FSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSP-AP--------------------GPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            QP++ +  +T P++P  F ++  ++++LG        DRR KKK ELLE+     + F  W+GPT+V+WLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP AP                          +LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR HLKM+++FHR+SL YG+ CLKRLNYDRK+L+ R++     D  D LVW+ + VM W++ I L+EY+ NL +SGVHGAL+ LD+ FD + L ++LQIP    QARQ L RE ++L+  G
Sbjct:  776 QPMSKDGQMTPPIIPADFEMSIGDTMTLG---KQAERDRRMKKKHELLEDARRKGLPFAQWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPLTSRTSSGNVWVTHEEMENMAASTKATLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRTHLKMVDSFHRASLQYGIMCLKRLNYDRKELDRRRDDCQ-NDIKDTLVWTNDHVMHWVQTIGLKEYSNNLLESGVHGALVALDETFDFSSLALILQIPMQNTQARQILEREFNNLLALG 1097          

HSP 2 Score: 268.47 bits (685), Expect = 9.504e-73
Identity = 227/558 (40.68%), Postives = 334/558 (59.86%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSI-RMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDS 1705
            M+C++MPTI+E  S    R SQ  S+  +N E +++NMLDERD L+E LR++ EAL  ++ +L +   E+D+L+ QINS+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+  P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE          G     T E   V +   E +  D +  S P+  R+ NGS         D+++   R              ++  ++LD+A +KE               L   R + + L +R+ +L+ +L   +KEL ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K+   ++ EEK+++L E L     R Q Q  ++A     VE+E A     + + E+    + E  + LE+QLEE N EL R  QREK+N+EH +RLS TVD LLTESNERLQ HL+E+MA L +KN L  +L+N ++ LE+    +++L  E+++ + +   L  +  A+ D 
Sbjct:    1 MMCEVMPTINEGDSVSSQRGSQNGSEQESNFEQLMVNMLDERDKLLESLRETQEALLQSQAKLQDALHERDVLQRQINSALPQEFATLTKELNTCREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAPPPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVTTLE----------GQLATTTQELSMVRQGKSEGNSVDRMDGSKPTWKRLPNGSI--------DVHDEASRC-------------LELQEMLDKA-NKE---------------LATSRERSNTLNSRVAELEGELAGVRKELLKSEELSTKHQRDIREAMAQKEDMEERITTLEKRYLAAQRETTSIHDLNDKLENELATKDSLHRQSEEKVRHLQELLELAEQRLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGNIEERLRQLESQLEEKNQELGRARQREKMNEEHNRRLSDTVDRLLTESNERLQLHLKERMAALEDKNALIHDLENSQKQLEEFHHTKERLIGEIEKLRAEIDHLKRRSGAFGDG 510          
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009262.1 (pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009262.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 353.984 bits (907), Expect = 2.263e-109
Identity = 167/254 (65.75%), Postives = 201/254 (79.13%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRP------NKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P         ++LA+ ++NHEWVGN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG+ CLKRLNYDR++LE ++E  +  +  DV+VWS ERV+ W++ + LREYA +L +SG+HGALL LD+ FD   L + LQIP    QARQ L RE ++L+  G
Sbjct:  114 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTVPTFRQTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKRE-DSQHEIQDVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLALDESFDHTSLALALQIPTQNTQARQVLEREYNNLLALG 366          
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009263.1 (pep scaffold:Pmarinus_7.0:GL476523:13919:40246:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009263.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 350.903 bits (899), Expect = 6.710e-109
Identity = 168/269 (62.45%), Postives = 201/269 (74.72%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPR---------------------PNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                      P  +LA+ ++NHEWVGN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG+ CLKRLNYDR++LE ++E  +  +  DV+VWS ERV+ W++ + LREYA +L +SG+HGALL LD+ FD   L + LQIP    QARQ L RE ++L+  G
Sbjct:   37 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTSTGNVWVTHEEMENMAAAPKTTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKRE-DSQHEIQDVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLALDESFDHTSLALALQIPTQNTQARQVLEREYNNLLALG 304          
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009265.1 (pep scaffold:Pmarinus_7.0:GL476523:20182:40240:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 344.739 bits (883), Expect = 6.177e-107
Identity = 168/278 (60.43%), Postives = 203/278 (73.02%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSP-----------------------APGPRPN-------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP                       A  P+ +       ++LA+ ++NHEWVGN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG+ CLKRLNYDR++LE ++E  +  +  DV+VWS ERV+ W++ + LREYA +L +SG+HGALL LD+ FD   L + LQIP    QARQ L RE ++L+  G
Sbjct:   10 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTSTGNVWVTHEEMENMAAAPKTDADEGSWAQTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKRE-DSQHEIQDVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLALDESFDHTSLALALQIPTQNTQARQVLEREYNNLLALG 286          
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006888.1 (pep scaffold:Pmarinus_7.0:GL476378:163929:311915:1 gene:ENSPMAG00000006049.1 transcript:ENSPMAT00000006888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 346.28 bits (887), Expect = 5.703e-99
Identity = 169/287 (58.89%), Postives = 200/287 (69.69%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-------------------------------------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRE 4528
            F  W+G T+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                                        ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLR  LKM+++FHR+SL YG+ CLKRLNYDRK LE ++E  +  +  DV+VWS ERV+ WI+ I LR+YA +L +SGVHGAL+ LD  FD   L + LQIP    QARQ L RE ++L+  G E
Sbjct:  809 FALWDGQTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTVAPRSLVSHPFRGLDASLVSAKEDEEGSWAQACLFAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRKDLERKRE-ESQHEMKDVMVWSNERVIRWIQSIGLRDYANSLVESGVHGALIALDDTFDHIALALSLQIPTQNTQARQVLEREFNNLLALGTE 1094          

HSP 2 Score: 207.994 bits (528), Expect = 1.922e-54
Identity = 167/503 (33.20%), Postives = 271/503 (53.88%), Query Frame = 2
Query:  443 ALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIR-MMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDR-------WKRQN--------------------YELATQ--LQAYMD--SKKVQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAF 1834
            +LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R+  LE+EL+     T        E  + +++   +  +D   + +P  +       +NGT  + DI                 G+ ++  D+LD+                R   +  ++ +   L+AR+ +L++ +   +++L ++ E   + + ++ E+   ++   ER+   E+R +  Q+E T+ H+  D  + EL++    +K+ E+K + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  + LE QLEE N E++R  QREK+N+EH KRLS TVD LL+ESNERLQ HL+E+M++L EKN L  ELDN R+ LE+  +D++++  EV++       W+ +                     Y L +   L+A  D       +R  +GR + L   P +V T+ E EW ++QQ+ V+++V QAF
Sbjct:   52 SLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERVAALEEELQ----ATSQELMLLREQAAHAQRRAGDGSEDATEMETPPTQNSAEARVTNGTG-LRDIEGP--------------GRLLELQDLLDK----------------RSMEVAQMKERLGTLSARVGELEDDVDTARRDLIKSEEMNTKYQRDIREAMAQKDDMEERITTLEKRYLGAQREATSLHDLKDKLENELANTEDLLKQSEDKTRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRVAALTKAEERHGDIEERLRQLETQLEEKNQEVLRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMSSLEEKNALTHELDNTRKQLEEAHMDKERMADEVEKVRLEMEQWRLKTSSMVDPVIPRSHLGSTSDIRYSLGSSVILEAPGDPFGSSAVLRRQKGRLSALRDEPGKVQTLNEQEWQRMQQAGVLASVAQAF 518          
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Match: kazna (kazrin, periplakin interacting protein a [Source:NCBI gene;Acc:100003663])

HSP 1 Score: 196.823 bits (499), Expect = 3.553e-53
Identity = 98/252 (38.89%), Postives = 152/252 (60.32%), Query Frame = 2
Query: 3758 VIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            V+    A   W   TI+AWLEL + MP  Y   CR N+KSG +++ LS+ E+++ +G++NPLH+ KLRLAI++  Q      GP         EL+H WV   WL  +GL Q+   F   LVD R+L  L +K+L   L +   FH++S+L+ +  L+ + +DR++L  R++L   +D  D +VW+ +RVM W+ ++DL+E++ +L  SGVHGALL+L+  F A  L  +L+IP +    R+ L  EL  +V
Sbjct:  338 VVPQVTAMSRWKSDTILAWLELNMSMPM-YGKHCRENIKSGKVLLGLSDEELEKALGVANPLHKRKLRLAIEDYRQAEQVLVGPSRCCLSRASELDHHWVAKTWLRDVGLPQYAQVFHSQLVDGRVLGSLGRKELEKLLGVTSKFHQTSILHAIELLRSVAFDREELSRRRQLCEVRDV-DTVVWTNQRVMQWVRNVDLKEFSEHLVSSGVHGALLVLEGSFTAEGLAAMLKIPHNNAFLRRHLASELAVIV 587          
BLAST of Liprin-alpha-4 vs. Ensembl Nematostella
Match: EDO42405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1P9])

HSP 1 Score: 176.022 bits (445), Expect = 1.418e-49
Identity = 96/246 (39.02%), Postives = 149/246 (60.57%), Query Frame = 2
Query: 3788 WNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGR 4525
            W    ++AWLE+   MP  Y   C  NVKSG +++ LS+ E++  +GISN +HR KLRLAI+E      P+    P  S    +++H WV   W+  LGLSQ+ PAF   ++D R+L+ LT+KD+  HL + + FH++S+L GV  L+ + +D++ L  R+   +  D  D +VW+ ++VM W   IDL+EYA NL DSGVHGA++++++ F  +++   L I  S    R+ LT E+  L+   R
Sbjct:    4 WKANMVLAWLEVECHMPM-YAQMCYENVKSGRVLLDLSDAELESGLGISNVMHRRKLRLAIEE---YRDPSSVKYPYMS----KIDHFWVARTWIRDLGLSQYGPAFESQMIDGRLLNVLTRKDMEKHLHISKKFHQTSILNGVDLLRLIAFDKQCLIDRRLSCDETDI-DPVVWTNDKVMRWCRSIDLQEYADNLRDSGVHGAMMVINETFGPDEMANCLAIHPSKNIIRRHLTSEMTALITSAR 240          
BLAST of Liprin-alpha-4 vs. Ensembl Nematostella
Match: EDO49181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH86])

HSP 1 Score: 144.821 bits (364), Expect = 1.446e-39
Identity = 102/173 (58.96%), Postives = 131/173 (75.72%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVR 568
            M+CDIMPTISE+    +       ++  N E +++NMLDERD LME LR++ ++L  T+ +L++ QKEKD L   + S L QD   + KEL++ +EQ+ E++EE  ELKAER NTRLLLEHLE LVARHER+LR+TV+KRQ+   GGVSSEVEVLKALKSLFEHHKALDEKV+
Sbjct:    1 MMCDIMPTISEDPPEIQFG----QNEETNFEQLMVNMLDERDKLMETLRETQDSLALTRSKLNDSQKEKDRLMAHLESVLAQDFASMLKELHQAREQLLEKDEEIIELKAERCNTRLLLEHLECLVARHERSLRMTVVKRQAAVAGGVSSEVEVLKALKSLFEHHKALDEKVK 169          
BLAST of Liprin-alpha-4 vs. Ensembl Nematostella
Match: EDO49639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFP8])

HSP 1 Score: 145.206 bits (365), Expect = 3.763e-38
Identity = 91/246 (36.99%), Postives = 130/246 (52.85%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLE-LWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV 4513
            F  W    I+ WL+ L +G    Y   C+ N+K G  ++  S  E+ R++GI +PLHR KL+LA+Q     TS +P          G L++ WV   WL  +GL  ++ AF +  VD RML+HLT  DL+ HLK+    H  S+   + CL+  N+    L+         +  DVL+W+  RVM W+  +DL EYA NL  SGVHGAL++L+  F    L  LL IP++    R+ L      LV
Sbjct:    5 FARWPPQMIMNWLDDLGLGC---YTDGCQRNIKCGEDLLRASGVELDRQLGIRHPLHRKKLQLALQA---FTSDSPD-------VMGRLSNHWVLG-WLEDIGLPHYKDAFSDACVDGRMLNHLTLDDLQ-HLKVTNALHHVSIQRAIQCLRFYNFHPNCLKRYP----IDEGADVLLWTNGRVMEWLRLVDLAEYAPNLRGSGVHGALMILEPRFTPETLAALLSIPSTKTLLRRHLASHFQSLV 231          
BLAST of Liprin-alpha-4 vs. Ensembl Nematostella
Match: EDO49183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH89])

HSP 1 Score: 128.257 bits (321), Expect = 2.812e-30
Identity = 130/467 (27.84%), Postives = 218/467 (46.68%), Query Frame = 2
Query:  563 VRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPS--IRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQN------RVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLA----------QREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRG-----------------------RENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNA 1840
            VRERLR +++R   LE +L   R+     K    E   +  +NL    +++    SPS  + + NG  S G  +            +N    A I +  ++ + +    DK            + + L+ +  +  +L  ++  L+ +L +  K+  R   Q++RL+ +L E+   +    +R+A  E+R + MQ E T  ++  +  + EL++K  E+ +CEEK+++L EKL             E S QN      + E+ P +  EL   +  L E  +      E+      +L           +REK+N++H  RLSTT+D LLTESNERLQAHL+E+M  L EK  +  EL++++  ++D Q +++ L  E+ R K + YEL    Q    S++++ R  R                        REN  P QV T+ E EW K++Q  V+ N+  AF+ 
Sbjct:    1 VRERLRQAVERGNSLEGDLDEARD---KIKQLEQENEDIRLRNLRRGRQED---GSPSQEVSLPNGDGSQGATM------------SNGPVMACIEEHEEQLEEMQFLLDK------------KSKELERITKESKDLKEKVTSLEEELRLSNKQSERLTSQVQRLERDLDEAAAQKSDMEDRIATLEKRYVRMQHEVTGLNDDNERLETELATKETELIQCEEKVRDLQEKL-------------ELSEQNLNQLLRKAEALPKIEEELAVRMAALNEAAEKQGTAEEQVTKLKTQLEDLQSELKRAREREKMNEDHNTRLSTTIDKLLTESNERLQAHLKERMNALEEKTAVTQELESMKLQVDDLQKEKEVLARELTRIKDE-YELLIHKQGMSKSRELEEREYRSVGEDSSQVSSSVPFREHRGRLCVREN--PSQVFTLNEQEWQKMEQENVLKNISLAFDT 421          
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Match: ppfia2 (PTPRF interacting protein alpha 2 [Source:NCBI gene;Acc:101160777])

HSP 1 Score: 364.77 bits (935), Expect = 7.873e-105
Identity = 171/259 (66.02%), Postives = 205/259 (79.15%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-----------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P              ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E  +  +  DVLVWS ERV+ W++ I LR+YA  L +SGVHGAL+ LD +FD + L +LLQIP    QARQ L RE ++L+  G
Sbjct:  786 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTTRTKSDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRRE-HSQHEIRDVLVWSNERVIRWVQSIGLRDYANILLESGVHGALVALDDNFDYSSLALLLQIPNQNTQARQILEREYNNLLALG 1043          

HSP 2 Score: 212.616 bits (540), Expect = 3.279e-55
Identity = 191/523 (36.52%), Postives = 290/523 (55.45%), Query Frame = 2
Query:   53 ICDIMPTISENGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSES--------ENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIR 1594
            +C++MPTISE+ +  +      SSD  ++ E +++NMLDERD L++ LR++ E+L   ++ L ++  ++D L+ Q++S+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL               + VS  E +     +D L   +  +  M    S+ +  ++++ +  +    +++    +  +  RD                      +EA+     ++ ++  R+  L+ + +  Q+E    H+  ++L+NEL+          E +R++Q ERL   EQ+L    ++     E L   +AEL+ +   + + EE+  ++ E++   +  CQ     E  NQ                                     L+R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EK+ L  E++ +R
Sbjct:    1 MCEVMPTISEDTALSQRGSQSGSSDPDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQHLQDVIYDRDSLQRQLSSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL-----------TAANQEVSAREASQVVELQDLLEKQNYELAQMKERMSSLSSRVSEVEQELETARKDLIKSEEMNNKYQRDI---------------------KEAM----CQKEDMEERIVTLEKRYLSAQRESTSVHDINDKLENELANKEAFLRQMEEKNRQLQ-ERLELAEQKLQQTMRKA----ETLPEVEAELAQRIAALTKAEERHGSIEERMR--HLECQL----EEKNQE------------------------------------LLRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKSHLAEEMEKLR 440          
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Match: ppfia2 (PTPRF interacting protein alpha 2 [Source:NCBI gene;Acc:101160777])

HSP 1 Score: 364.77 bits (935), Expect = 5.475e-104
Identity = 171/259 (66.02%), Postives = 205/259 (79.15%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN-----------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P              ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E +   +  DVLVWS ERV+ W++ I LR+YA  L +SGVHGAL+ LD +FD + L +LLQIP    QARQ L RE ++L+  G
Sbjct:  883 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTTRTKSDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRREHSQ-HEIRDVLVWSNERVIRWVQSIGLRDYANILLESGVHGALVALDDNFDYSSLALLLQIPNQNTQARQILEREYNNLLALG 1140          

HSP 2 Score: 268.47 bits (685), Expect = 1.253e-72
Identity = 245/650 (37.69%), Postives = 377/650 (58.00%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSD-GANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHK-------DNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKE-MDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR-------DKLYAEVDRWK------------RQNYELATQLQAYMD-----------SKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTISE+ +  +      SSD  ++ E +++NMLDERD L++ LR++ E+L   ++ L ++  ++D L+ Q++S+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL      T + +    E V++ E+N     K       ++LL  S + + ++G                KRLSN  L  A    + ++  D+L+          + N+E+ +      ++ + S L++R+ +++ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL+R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  + D  R+  E++  ++       +KL AE+D+++            R + + + +L+  M            S KV  RP RGR  V   +  ++GE EW + QQ  V+       +  +SDI   +R
Sbjct:    1 MMCEVMPTISEDTALSQRGSQSGSSDPDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQHLQDVIYDRDSLQRQLSSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL------TAANQ----EIVALREQNAHLQRKVATGDGGEDLLEGSEAQQKVHG----------------KRLSNGSLESAREASQVVELQDLLE----------KQNYELAQ------MKERMSSLSSRVSEVEQELETARKDLIKSEEMNNKYQRDIKEAMCQKEDMEERIVTLEKRYLSAQRESTSVHDINDKLENELANKEAFLRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGSIEERMRHLECQLEEKNQELLRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNMLIQDSDGYRKQYEESLQEKSHLAEEMEKLRAELDQYRLRAGSLTEPTLSRSHLDTSGELRFSMGSLAETQSDHYRSAKVIHRPRRGRMGVRDAKAKSLGEHEW-RSQQLGVLGGHPFESDTEMSDIDDDDR 606          
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Match: ENSORLT00000034854.1 (liprin-alpha-1 [Source:NCBI gene;Acc:101157600])

HSP 1 Score: 358.221 bits (918), Expect = 4.871e-102
Identity = 167/248 (67.34%), Postives = 197/248 (79.44%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQE++ LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FME LVDARMLDHLTKKDLR  LKM+++FHR+S   GV CL+RLNYD+K+LE R+E +   +  DVLVWS ERV+SWI+ I L+EY+ NL +SGVHGALL LD+ FD N L +LLQIP    QAR  L  E   L+  G
Sbjct:  883 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMESLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGVMCLRRLNYDKKELERRREDSQL-ELKDVLVWSNERVISWIQSIGLKEYSSNLYESGVHGALLALDETFDHNTLALLLQIPTQHTQARAALEHEYSGLLAVG 1129          

HSP 2 Score: 285.419 bits (729), Expect = 4.268e-78
Identity = 238/641 (37.13%), Postives = 374/641 (58.35%), Query Frame = 2
Query:   50 MICDIMPTISE-----NGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALD--NLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQN--------------------YELATQLQAYMD-------SKKVQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGL 1846
            M+C++MPTISE      G+G     S + SD   + E ++++ML+ERD L+E LR++ E L  T+ +L E+  E+D L+ Q+NS+LPQ+   L KE+   +EQ+ E+EEE +ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R   LE+EL ++       +  + +   +++  +E +H              N   +NG           KR S+      ++ +E +      +AGD +        E+V ++A D   ++ + + + +R+ +L+  L   +K+L ++ +   RL+ +L ES   +E   ER+   E+R +  Q+E T+ H+  D  + E+++K    ++ EE+ + L EKL     + Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL+R  QREK+N+EH +RLS TVD LL+ESNERLQ HL+E+M+ L +KN L  ELD++++++E++  ++++L  +++  + +N                    +       + MD       S  V  RP +GR   L   P +V T+ E EW+++QQ+ V++NV QAF + +
Sbjct:    1 MMCEVMPTISEAEGPGGGNGRRGSGSPLQSDSEGHFESLMVSMLEERDRLLETLRETQENLGLTQGKLHEVSHERDSLQRQLNSALPQEFAALTKEVNVCREQLLEKEEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSALEEELAISHKELSYLREQSSQKRGLADGTIEVNHN-----------FENAPSTNG-----------KRSSD-----GSLSQEEESGSAFGKAGDLQ--------EVVDRQAADLGQMKERMAAMVSRISELEEDLDTARKDLIKSEDMSTRLQRDLRESMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEVANKESLFRQAEERNRQLQEKLELAEQKLQ-QTIRKAETLPEVEAELAQRVAALTKAEERHGNVEERLRQLEAQLEEKNQELLRARQREKMNEEHNRRLSETVDKLLSESNERLQLHLKERMSALEDKNTLIRELDHMKKLIEESHHEKEQLLIQIETMRAENEIGRSNSSLHGRSQLGSTPDFRYPVSASSMMDGNSDSFGSALVLRRPQKGRMVALRDEPSKVQTLNEQEWERMQQANVLANVAQAFESDM 605          
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Match: ENSORLT00000000039.2 (liprin-alpha-1 [Source:NCBI gene;Acc:101157600])

HSP 1 Score: 356.681 bits (914), Expect = 1.067e-101
Identity = 167/248 (67.34%), Postives = 197/248 (79.44%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELWVGMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQE++ LTSP+  P    +LA+G++NHEW+GN WLPSLGL Q+R  FME LVDARMLDHLTKKDLR  LKM+++FHR+S   GV CL+RLNYD+K+LE R+E +   +  DVLVWS ERV+SWI+ I L+EY+ NL +SGVHGALL LD+ FD N L +LLQIP    QAR  L  E   L+  G
Sbjct:  855 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMESLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGVMCLRRLNYDKKELERRREDSQL-ELKDVLVWSNERVISWIQSIGLKEYSSNLYESGVHGALLALDETFDHNTLALLLQIPTQHTQARAALEHEYSGLLAVG 1101          

HSP 2 Score: 285.034 bits (728), Expect = 3.902e-78
Identity = 238/641 (37.13%), Postives = 374/641 (58.35%), Query Frame = 2
Query:   50 MICDIMPTISE-----NGSGYEDRDSQISSDG-ANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALD--NLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQN--------------------YELATQLQAYMD-------SKKVQVRPLRGRENVL---PDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGL 1846
            M+C++MPTISE      G+G     S + SD   + E ++++ML+ERD L+E LR++ E L  T+ +L E+  E+D L+ Q+NS+LPQ+   L KE+   +EQ+ E+EEE +ELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRV+L+R   LE+EL ++       +  + +   +++  +E +H              N   +NG           KR S+      ++ +E +      +AGD +        E+V ++A D   ++ + + + +R+ +L+  L   +K+L ++ +   RL+ +L ES   +E   ER+   E+R +  Q+E T+ H+  D  + E+++K    ++ EE+ + L EKL     + Q Q  ++A     VE+E A     + + E+    + E  + LEAQLEE N EL+R  QREK+N+EH +RLS TVD LL+ESNERLQ HL+E+M+ L +KN L  ELD++++++E++  ++++L  +++  + +N                    +       + MD       S  V  RP +GR   L   P +V T+ E EW+++QQ+ V++NV QAF + +
Sbjct:    1 MMCEVMPTISEAEGPGGGNGRRGSGSPLQSDSEGHFESLMVSMLEERDRLLETLRETQENLGLTQGKLHEVSHERDSLQRQLNSALPQEFAALTKEVNVCREQLLEKEEEIAELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSALEEELAISHKELSYLREQSSQKRGLADGTIEVNHN-----------FENAPSTNG-----------KRSSD-----GSLSQEEESGSAFGKAGDLQ--------EVVDRQAADLGQMKERMAAMVSRISELEEDLDTARKDLIKSEDMSTRLQRDLRESMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEVANKESLFRQAEERNRQLQEKLELAEQKLQ-QTIRKAETLPEVEAELAQRVAALTKAEERHGNVEERLRQLEAQLEEKNQELLRARQREKMNEEHNRRLSETVDKLLSESNERLQLHLKERMSALEDKNTLIRELDHMKKLIEESHHEKEQLLIQIETMRAENEIGRSNSSLHGRSQLGSTPDFRYPVSASSMMDGNSDSFGSALVLRRPQKGRMVALRDEPSKVQTLNEQEWERMQQANVLANVAQAFESDM 605          
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Match: ppfia2 (PTPRF interacting protein alpha 2 [Source:NCBI gene;Acc:101160777])

HSP 1 Score: 357.066 bits (915), Expect = 1.668e-101
Identity = 171/280 (61.07%), Postives = 205/280 (73.21%), Query Frame = 2
Query: 3779 FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPN--------------------------------KSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRG 4522
            F  W+GPT+VAWLELW+GMPAWYVAACRANVKSGAIM ALS+TEIQREIGISNPLHRLKLRLAIQEMV LTSP+  P                                   ++LA+G++NHEW+GN WLPSLGL Q+R  FMECLVDARMLDHLTKKDLRVHLKM+++FHR+SL YG+ CLK+LNYDRK+LE R+E +   +  DVLVWS ERV+ W++ I LR+YA  L +SGVHGAL+ LD +FD + L +LLQIP    QARQ L RE ++L+  G
Sbjct:  883 FAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTTRTPSGNVWVTHEEMETLAAPSRTKSDSEEGSWAQTLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKKLNYDRKELERRREHSQ-HEIRDVLVWSNERVIRWVQSIGLRDYANILLESGVHGALVALDDNFDYSSLALLLQIPNQNTQARQILEREYNNLLALG 1161          

HSP 2 Score: 268.085 bits (684), Expect = 1.529e-72
Identity = 245/650 (37.69%), Postives = 377/650 (58.00%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSD-GANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHK-------DNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKE-MDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQ----LREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDR-------DKLYAEVDRWK------------RQNYELATQLQAYMD-----------SKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSER 1870
            M+C++MPTISE+ +  +      SSD  ++ E +++NMLDERD L++ LR++ E+L   ++ L ++  ++D L+ Q++S+LPQ+   L KEL   +EQ+ E+EEE SELKAERNNTRLLLEHLE LV+RHER+LR+TV+KRQ+ +P GVSSEVEVLKALKSLFEHHKALDEKVRERLRVSL+R+  LE+EL      T + +    E V++ E+N     K       ++LL  S + + ++G                KRLSN  L  A    + ++  D+L+          + N+E+ +      ++ + S L++R+ +++ +L   +K+L ++ E   + + ++ E+   +E   ER+   E+R +  Q+E T+ H+  D  + EL++K   +++ EEK + L E+L     + Q Q  ++A     VE+E A     + + E+    + E  ++LE QLEE N EL+R  QREK+N+EH KRLS TVD LLTESNERLQ HL+E+MA L EKN L  + D  R+  E++  ++       +KL AE+D+++            R + + + +L+  M            S KV  RP RGR  V   +  ++GE EW + QQ  V+       +  +SDI   +R
Sbjct:    1 MMCEVMPTISEDTALSQRGSQSGSSDPDSHFEQLMVNMLDERDRLLDTLRETQESLGLAQQHLQDVIYDRDSLQRQLSSALPQEFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEEL------TAANQ----EIVALREQNAHLQRKVATGDGGEDLLEGSEAQQKVHG----------------KRLSNGSLESAREASQVVELQDLLE----------KQNYELAQ------MKERMSSLSSRVSEVEQELETARKDLIKSEEMNNKYQRDIKEAMCQKEDMEERIVTLEKRYLSAQRESTSVHDINDKLENELANKEAFLRQMEEKNRQLQERLELAEQKLQ-QTMRKAETLPEVEAELAQRIAALTKAEERHGSIEERMRHLECQLEEKNQELLRARQREKMNEEHNKRLSDTVDRLLTESNERLQLHLKERMAALEEKNMLIQDSDGYRKQYEESLQEKSHLAEEMEKLRAELDQYRLRAGSLTEPTLSRSHLDTSGELRFSMGSLAETQSDHYRSAKVIHRPRRGRMGVRDAKAKSLGEHEW-RSQQLGVLGGHPFESDTEMSDIDDDDR 606          
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 2876.66 bits (7456), Expect = 0.000e+0
Identity = 1553/1557 (99.74%), Postives = 1554/1557 (99.81%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSXXXXXXXXXXXXXLAYLXXXXXXXXXXXXXXXXXXXXXXXMRAEELESRVVSPRLDPAVMNYAYSPAMFEXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNXXXXXXXXXXXXXXXXQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTXXXXXXXXXXXXXXXXXXASPTSHLSQTQTG 4720
            MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGE VSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKA+IGKEMDRDDILDEAGD EKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIP CFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG
Sbjct:    1 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGEAVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKASIGKEMDRDDILDEAGDNEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPQCFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG 1557          
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 2864.33 bits (7424), Expect = 0.000e+0
Identity = 1548/1552 (99.74%), Postives = 1549/1552 (99.81%), Query Frame = 2
Query:   65 MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSXXXXXXXXXXXXXLAYLXXXXXXXXXXXXXXXXXXXXXXXMRAEELESRVVSPRLDPAVMNYAYSPAMFEXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNXXXXXXXXXXXXXXXXQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTXXXXXXXXXXXXXXXXXXASPTSHLSQTQTG 4720
            MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGE VSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKA+IGKEMDRDDILDEAGD EKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIP CFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG
Sbjct:    1 MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGEAVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKASIGKEMDRDDILDEAGDNEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLINHSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKLQNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPQCFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG 1552          
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 1381.31 bits (3574), Expect = 0.000e+0
Identity = 799/827 (96.61%), Postives = 806/827 (97.46%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSXXXXXXXXXXXXXLAYLXXXXXXXXXXXXXXXXXXXXXXXMRAEELESRVVSPRLDPAVMNYAYSPAMFEXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEH 2530
            MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGE VSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKA+IGKEMDRDDILDEAGD EKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFN     +Y ++  S  Q+  +  P P   + H
Sbjct:    1 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGEAVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKASIGKEMDRDDILDEAGDNEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHH 827          

HSP 2 Score: 1258.82 bits (3256), Expect = 0.000e+0
Identity = 647/659 (98.18%), Postives = 649/659 (98.48%), Query Frame = 2
Query: 2756 SFLSKNGYSPTK----LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNXXXXXXXXXXXXXXXXQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTXXXXXXXXXXXXXXXXXXASPTSHLSQTQTG 4720
            S LS +  +P K    LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIP CFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG
Sbjct:  781 SNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPQCFGSLDRRLLTSRKLIRRNSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG 1439          
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 1380.54 bits (3572), Expect = 0.000e+0
Identity = 799/827 (96.61%), Postives = 806/827 (97.46%), Query Frame = 2
Query:   50 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSXXXXXXXXXXXXXLAYLXXXXXXXXXXXXXXXXXXXXXXXMRAEELESRVVSPRLDPAVMNYAYSPAMFEXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEH 2530
            MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGE VSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKA+IGKEMDRDDILDEAGD EKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFN     +Y ++  S  Q+  +  P P   + H
Sbjct:    1 MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGEAVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKASIGKEMDRDDILDEAGDNEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHH 827          

HSP 2 Score: 1150.96 bits (2976), Expect = 0.000e+0
Identity = 605/659 (91.81%), Postives = 607/659 (92.11%), Query Frame = 2
Query: 2756 SFLSKNGYSPTK----LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNXXXXXXXXXXXXXXXXQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTXXXXXXXXXXXXXXXXXXASPTSHLSQTQTG 4720
            S LS +  +P K    LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTG                                           NSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG
Sbjct:  781 SNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTG-------------------------------------------NSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG 1396          
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 1369.37 bits (3543), Expect = 0.000e+0
Identity = 794/822 (96.59%), Postives = 801/822 (97.45%), Query Frame = 2
Query:   65 MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAXXXXXXXXXXXXXXXXXXXXXALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKXXXXXXXXXXXXXMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSXXXXXXXXXXXXXLAYLXXXXXXXXXXXXXXXXXXXXXXXMRAEELESRVVSPRLDPAVMNYAYSPAMFEXXXXXXXXXXXXXXXXXXXXXXXXXXXLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNLTKYSSYSKSTPQLSSKLFPAPPPYLEH 2530
            MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGE VSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKA+IGKEMDRDDILDEAGD EKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFN     +Y ++  S  Q+  +  P P   + H
Sbjct:    1 MPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRKSHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHEREEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGSTKNFTGEAVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINESYKRLSNNILAKASIGKEMDRDDILDEAGDNEKNAVESNHEIVRQEALDNLRSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQGERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLEKLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQLEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMATLAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYMDSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLSDIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQEQLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFESTPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQHPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHH 822          

HSP 2 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 605/659 (91.81%), Postives = 607/659 (92.11%), Query Frame = 2
Query: 2756 SFLSKNGYSPTK----LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGLSTALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNXXXXXXXXXXXXXXXXQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDXXXXXXXXXXXXVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTXXXXXXXXXXXXXXXXXXASPTSHLSQTQTG 4720
            S LS +  +P K    LSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTG                                           NSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG
Sbjct:  776 SNLSTSNQAPQKQNFNLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVAGGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTG-------------------------------------------NSFENNSMQSSPVSSGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDSTPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRSINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQPPSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSHLSQTQTG 1391          
The following BLAST results are available for this feature:
BLAST of Liprin-alpha-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPFIA24.018e-11467.97PTPRF interacting protein alpha 2 [Source:HGNC Sym... [more]
PPFIA27.552e-11167.97PTPRF interacting protein alpha 2 [Source:HGNC Sym... [more]
PPFIA21.600e-10867.69PTPRF interacting protein alpha 2 [Source:HGNC Sym... [more]
PPFIA41.314e-10762.64PTPRF interacting protein alpha 4 [Source:HGNC Sym... [more]
PPFIA41.314e-10762.64PTPRF interacting protein alpha 4 [Source:HGNC Sym... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd-21.255e-9461.75Liprin-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q21... [more]
hlb-16.046e-1926.51Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-17.538e-1926.51Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-17.892e-1926.51Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-17.892e-1926.51Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Liprin-alpha4.831e-10668.70gene:FBgn0046704 transcript:FBtr0329941[more]
Liprin-alpha8.785e-10668.70gene:FBgn0046704 transcript:FBtr0079300[more]
Liprin-alpha8.785e-10668.70gene:FBgn0046704 transcript:FBtr0079301[more]
Liprin-alpha9.169e-10668.70gene:FBgn0046704 transcript:FBtr0329942[more]
Liprin-alpha1.081e-10568.70gene:FBgn0046704 transcript:FBtr0329943[more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfia21.195e-10362.28PTPRF interacting protein alpha 2 [Source:ZFIN;Acc... [more]
ppfia44.478e-10354.20PTPRF interacting protein alpha 4 [Source:ZFIN;Acc... [more]
ppfia44.974e-10354.20PTPRF interacting protein alpha 4 [Source:ZFIN;Acc... [more]
ppfia45.653e-10354.20PTPRF interacting protein alpha 4 [Source:ZFIN;Acc... [more]
ppfia45.731e-10354.20PTPRF interacting protein alpha 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ino80b3.141e-10968.00INO80 complex subunit B [Source:Xenbase;Acc:XB-GEN... [more]
ino80b5.097e-10968.00INO80 complex subunit B [Source:Xenbase;Acc:XB-GEN... [more]
ino80b2.713e-10665.64INO80 complex subunit B [Source:Xenbase;Acc:XB-GEN... [more]
ino80b5.422e-10563.00INO80 complex subunit B [Source:Xenbase;Acc:XB-GEN... [more]
ino80b6.456e-10563.94INO80 complex subunit B [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppfia41.075e-10663.57protein tyrosine phosphatase, receptor type, f pol... [more]
Ppfia23.952e-10460.63protein tyrosine phosphatase, receptor type, f pol... [more]
Ppfia23.970e-10460.63protein tyrosine phosphatase, receptor type, f pol... [more]
Ppfia41.585e-10361.51protein tyrosine phosphatase, receptor type, f pol... [more]
Ppfia41.693e-10361.51protein tyrosine phosphatase, receptor type, f pol... [more]
back to top
BLAST of Liprin-alpha-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75334|LIPA2_HUMAN2.143e-10361.32Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 P... [more]
sp|Q8BSS9|LIPA2_MOUSE2.485e-10360.63Liprin-alpha-2 OS=Mus musculus OX=10090 GN=Ppfia2 ... [more]
sp|Q91Z80|LIPA4_RAT4.971e-10361.51Liprin-alpha-4 (Fragment) OS=Rattus norvegicus OX=... [more]
sp|O75335|LIPA4_HUMAN3.845e-10261.51Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 P... [more]
sp|Q13136|LIPA1_HUMAN9.587e-10266.53Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 P... [more]
back to top
BLAST of Liprin-alpha-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T6006.505e-11972.40Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SBT62.562e-11772.00Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YE671.432e-11571.15Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564YE783.904e-11571.15Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3EM201.776e-11469.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000021039.21.313e-10366.40PTPRF interacting protein alpha 1 [Source:NCBI gen... [more]
ENSAMXT00000040681.11.360e-10366.40PTPRF interacting protein alpha 1 [Source:NCBI gen... [more]
ppfia23.033e-10361.70PTPRF interacting protein alpha 2 [Source:ZFIN;Acc... [more]
ppfia41.088e-10256.75PTPRF interacting protein alpha 4 [Source:NCBI gen... [more]
ppfia42.210e-10256.75PTPRF interacting protein alpha 4 [Source:NCBI gen... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009262.12.263e-10965.75pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 g... [more]
ENSPMAT00000009263.16.710e-10962.45pep scaffold:Pmarinus_7.0:GL476523:13919:40246:1 g... [more]
ENSPMAT00000009265.16.177e-10760.43pep scaffold:Pmarinus_7.0:GL476523:20182:40240:1 g... [more]
ENSPMAT00000006888.15.703e-9958.89pep scaffold:Pmarinus_7.0:GL476378:163929:311915:1... [more]
kazna3.553e-5338.89kazrin, periplakin interacting protein a [Source:N... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO424051.418e-4939.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491811.446e-3958.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496393.763e-3836.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491832.812e-3027.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Liprin-alpha-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfia27.873e-10566.02PTPRF interacting protein alpha 2 [Source:NCBI gen... [more]
ppfia25.475e-10466.02PTPRF interacting protein alpha 2 [Source:NCBI gen... [more]
ENSORLT00000034854.14.871e-10267.34liprin-alpha-1 [Source:NCBI gene;Acc:101157600][more]
ENSORLT00000000039.21.067e-10167.34liprin-alpha-1 [Source:NCBI gene;Acc:101157600][more]
ppfia21.668e-10161.07PTPRF interacting protein alpha 2 [Source:NCBI gen... [more]
back to top
BLAST of Liprin-alpha-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048911.10.000e+099.74SMESG000048911.1[more]
SMESG000048911.10.000e+099.74SMESG000048911.1[more]
SMESG000048911.10.000e+096.61SMESG000048911.1[more]
SMESG000048911.10.000e+096.61SMESG000048911.1[more]
SMESG000048911.10.000e+096.59SMESG000048911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002609 ID=SMED30002609|Name=Liprin-alpha-4|organism=Schmidtea mediterranea sexual|type=transcript|length=5512bp
ATCTATATAAATCTTATATGAGATTTAACTGATAAACATATCTGGTACAA
TGATCTGTGATATTATGCCCACTATTAGTGAAAATGGTAGTGGATATGAA
GATAGGGATTCTCAAATTAGCAGTGACGGTGCCAATGTCGAAGATATGTT
GCTTAATATGCTCGATGAGCGTGATAATCTCATGGAAAAATTACGTAAAT
CACACGAAGCTTTGGAATGTACGAAAGAACAATTATCAGAATTACAAAAA
GAAAAGGATATTCTTGAAGATCAAATAAATTCATCATTACCTCAGGATGT
CGTGCAGCTGCACAAAGAGCTCTACAGGTTGAAGGAGCAAGTACACGAAA
GAGAAGAGGAAAATTCTGAATTGAAGGCAGAAAGAAATAACACCAGACTG
TTATTGGAGCACTTAGAACTACTAGTCGCTAGGCACGAGAGAGCACTGCG
TTTAACCGTAATTAAACGGCAATCAACTACACCAGGTGGTGTCAGTTCGG
AAGTTGAAGTTTTGAAAGCTTTAAAATCATTATTTGAACACCACAAAGCT
CTCGATGAAAAAGTTAGAGAACGTCTCCGAGTTTCTTTGGATAGAATCAA
AGAACTAGAAGATGAATTGCGACTTAATCGTAATGGAACCGGATCAACTA
AGAATTTTACAGGAGAAACTGTATCAGTTTCCGAGAAAAATCTAGAAAAT
TCACATAAAGACAATTTATTAGTGTCTTCACCAAGTATTCGAATGATGAA
TGGTTCATGTAGTAATGGAACGGATATAATGACAGACATCAACGAATCGT
ATAAAAGACTATCCAATAACATTTTGGCCAAAGCAACTATTGGAAAGGAA
ATGGATCGAGATGATATATTGGATGAGGCTGGCGATAAAGAAAAAAATGC
AGTAGAATCTAACCATGAAATTGTGCGACAAGAAGCATTGGATAATTTAC
GAAGCAAACAGTCTGAATTAACCGCTCGCTTACAAGATCTCGATAACCAG
TTGATAGTGGGTCAGAAAGAGCTATTTAGGGCGCATGAACAGATCGAACG
GTTAAAGAATGAGCTGTCAGAGTCGGAAAATCACCGAGAGATTCAAGGAG
AACGACTGGCAGCTTTTGAGCAGCGATTAATTGATATGCAGAAAGAAGGA
ACGGCAGCTCATGAAGCACTTGATCTAACAAAGGCTGAATTAAGCTCCAA
GAATGGAGAGGTGAAAAGGTGCGAAGAAAAAATACAAAATCTTCTCGAAA
AGCTCAACGAAACAAATTACAGATGTCAAACCCAGCAGTCGAAAGAGGCA
TCAAATCAAAACCGGGTAGAATCAGAACCGGCAATGTCGACAGAGTTAGT
CAAGGAACTCGAACAGTTGAGAGAGATTAATAAAAATCTTGAAGCGCAAT
TAGAGGAAGCCAATCTAGAGCTGATGAGGTTAGCCCAACGAGAAAAACTC
AATGACGAGCACACAAAACGCTTGTCCACAACCGTTGATAATCTATTAAC
TGAGTCGAATGAAAGATTACAAGCGCATTTGCGTGAAAAGATGGCTACAT
TAGCGGAAAAGAATCAATTGAATAGTGAACTTGATAATATCCGACGTATT
CTGGAAGACACGCAGATTGATCGAGATAAACTTTATGCAGAAGTTGATCG
ATGGAAACGACAAAATTATGAATTAGCCACTCAACTTCAAGCTTATATGG
ACAGTAAGAAGGTACAAGTTCGACCATTGAGAGGTCGAGAAAACGTGTTA
CCTGATCAAGTCAATACGATCGGTGAAGGAGAATGGGATAAGCTGCAGCA
GAGCCGAGTCGTGTCCAATGTGCATCAAGCATTCAATGCTGGACTCAGCG
ACATCCGCAGCTCAGAAAGAATGGACTGGATGGTGAAAGAAAGCCAATCC
CCAATGTCAACCTCTCTCGATCAAGGTGACTGGAACTCGACACAGCAAAA
TAATAAAGCTAATAACACGGCACAGAAATTAGCCTACCTCATCCAGGAGC
AATTAGAAGCAATCAATAACGAAATTCAAATTATCCAGGAAGAAAAGCAA
AATGCTGAAATGCGTGCAGAAGAATTGGAATCGAGAGTTGTTAGTCCTCG
ATTGGATCCCGCTGTCATGAATTATGCTTACTCACCGGCAATGTTTGAGT
CTACTCCAATGGGTCCTAGTGGCTGGTCACCTCCTGGCTCTCCTAGTCGG
CCGCACAGCAGTGGACATTCAACACCAACCTTGCTAGGACCCTCTCAGCA
GTATCAGACTCGATCGGCGTATTGCGGTGGATCCATGTGGTCACCACAGC
ATCCCCAGGATCAAAAGGTAAATATGAGGCGACCCAATTTCAACATGCCT
CCCACCGACCACGGATACAGCTCTATGCACAATTTCCAGAGCAACCTCAG
TACGTCCAACCAAGCACCTCAAAAACAGAATTTTAATGAGCCAAATTTGA
CAAAATACAGTTCATATTCGAAATCGACACCCCAACTTTCCAGTAAGTTA
TTTCCTGCACCGCCGCCTTATCTGGAACATGAAAATCATAAACTGTTTGC
TATTGAAATGTCAAAACTTCACAATTACTCTTCCGGGAACTTGATAAATC
ACTCGAAGCCCAAAACGAACAAAGATGATTTGTGGCTCTTGAATCAAGCT
AAGCTCAGTCGAAATAGTGAGGGTAATCTCATGTGTTGTGTTGGCCGAAC
TGGAACTAATGGTGCTGATAATAGTGGTAATAGACCGACAAATAAGTTAC
AAAATTCCTTTCTCTCTAAAAATGGATATTCACCGACTAAGTTGTCGGAA
GATATGGAGTATCACAACCATCCGATGTCCTACAATCAGATACAACAAGA
AGCTTCACCCCAACCCAGTAGGAAAATGCATCATATACCCAATGTTGCAG
GAGGTGCAACAATGTTCCACTCGGAATCGGCCAATCAGTTCCAAACTCAT
CAACAATTTCCTCAATCCCGACAGCCAACATCTCAAGGCAATTTAGTCTT
GCCATATTTCCAGCAACAGAACACTGGGCAGTTGACCTACGCTGGCCTCT
CCACAGCTCTGGCCCCCAGTAATACGTCACCTGGCTCAAATCCAATTCCG
CCGTGTTTCGGTAGTCTAGATAGACGACTGCTTACAAGTCGCAAATTGAT
CAGGAGGAACAGTTTTGAAAATAATTCAATGCAAAGCAGTCCCGTCAGTT
CTGGTAGTCAAGAAAGTTTGCAGCAACGCGGTATGAGATTCCACCCTCAA
ATGTTACAGATCTCATACAGTCCTTCTCCGACTCCAAGCGGTTCCAATTT
GCAGTCCAATCCTAACAATGTTCATGCAATGAATGTGTCTGGAGATTCCA
CTCCCGGCACAAAAAAGAAATCCAGATTGGGCTCATTGTCAAGAATATTC
AAACGAGGAGGAAGCATGAAAACGAGTGTCATTTCCTCGCCAATGCAACC
CAACGACATAACATCCAATTATAACTCGGATATAAATAATCTGAGATCAA
TCAACCAAATGACAAGGCATCCCACTCCTCAATTTCGAAATCCCCCCGAT
GCTTTTGATGAAAGATCAAGAAATTTCTCCCCGACCGGATTTGTCGATCA
ACAAAACCTTCAAATCGATCAGCCAATCACGGCCAACATCACCAATCCGA
TGGTTCCATTTTCCGTCACCAACTCCAACTCAATCAGCCTCGGAGTCGGG
TTTTCCAGCCACACAGAGGACAGACGTCGCAAAAAAAAGGAGGAGCTGCT
AGAAGAGGTTATAGCCAATAATGTTGCATTTTGCAATTGGAACGGTCCTA
CAATTGTTGCTTGGTTAGAGCTGTGGGTTGGGATGCCAGCCTGGTATGTG
GCTGCCTGCAGGGCCAATGTGAAATCGGGCGCCATCATGGTTGCTCTCAG
TGAGACAGAAATCCAGCGGGAAATCGGAATCAGCAATCCTCTTCATCGAT
TGAAATTGAGATTAGCCATTCAAGAAATGGTTCAGTTGACATCTCCTGCT
CCTGGACCGAGACCCAATAAATCACTGGCATTCGGAGAACTGAATCATGA
ATGGGTGGGTAACTACTGGTTACCGAGTTTGGGATTGTCTCAATTCCGTC
CGGCATTTATGGAATGTTTGGTTGATGCTCGAATGCTGGATCACTTGACA
AAGAAGGATTTACGTGTTCATTTAAAAATGATTGAAAATTTCCATCGAAG
CAGTCTTCTGTACGGCGTGGCTTGTTTAAAAAGACTTAACTATGACCGCA
AACAACTGGAACACAGACAAGAACTAGCTAATGCTAAAGATAGCAATGAT
GTGTTAGTGTGGTCTTGTGAAAGAGTCATGTCGTGGATTGAACACATTGA
CCTTCGAGAATATGCTGGAAATCTCACCGATTCTGGAGTGCATGGAGCAC
TTTTATTATTGGATCAACATTTTGATGCAAACGATTTGATAATCCTACTC
CAAATACCCGCCAGTGCTGAACAAGCCCGGCAGACTTTGACAAGAGAACT
TCACGATCTCGTTAAACGTGGACGAGAAAATCTCCAAGCAAGTCAACCAC
CCAGTCAGGAAAATTCGTTGTCAACACTCACTCATCAAAGCTCCAATAAT
CCCAGTCCCGATCTGTCTCGTCACACTCCAGATTCTCCCTCGAAACAGCA
ACAGCAACAACCAATCAGACCAGATTCATCAGCGTCACCTACCTCACATC
TTTCCCAGACACAAACCGGCTCTTAATTTTCCTCCTTATTATCCATTCTA
ATCAATAGTGCTTATTCGATTATTTTTCTTTTGTCTGAGCGTTCTTATTG
TTTTATTATAAATAATAATAATTTTAATACAAAAATCGGTAATGCAATAG
TATGAAAAATCGATAGTAACGAAAATTAATAACAAAAATCGATAGTTAAT
AAATTCGATAATTAAAAATCAATAATTATGTCAGTCAACGTTTATGAAAA
TCAATAAAAGTCAATATTAGTAATGATTATAGCTAGTGCTGCATAGTTAT
AAATTTGAGTATTATTTTGAGTGATTGCGGTTGATATAGAGTTAAGGATT
CATGTTGTTGTTTATGTGGCTGGCTGGTGATGTTGGGTCGAGGATGTGAT
GATATGAGCCATTTGTCACTTGTACATAATATCATTTGGTGGCCAATGGC
ACTGATAATGACACATTTATGCCCTGATAGGACAATTATTGGACATGTAT
GTACAGTGATTACTTTATAACTGTTAAGACTTGATTTTGTACATTTCCAA
TGCCTCGCTATATATTGCAACCAACCGTTCTGGGTTCAGCTCGAGGCTGG
CACCGTTGATATTTTCTCGTTGATTTGTGCTCGATTCCAATAATTTCTTG
TCGGGTTTTGTATATCGTTTCTTTTTATATAAATTTTATCAAGCGTCATT
CTGATGCGATGGATTTTTGTCATTTGCATTACCTAGTGGAGCATGCTTGT
AACAGTCACCCATTGGGGATGGGGGGGTCTTGCTGGATTCTGGAGATTTG
ACTATTTCTTCA
back to top

protein sequence of SMED30002609-orf-1

>SMED30002609-orf-1 ID=SMED30002609-orf-1|Name=SMED30002609-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1559bp
MICDIMPTISENGSGYEDRDSQISSDGANVEDMLLNMLDERDNLMEKLRK
SHEALECTKEQLSELQKEKDILEDQINSSLPQDVVQLHKELYRLKEQVHE
REEENSELKAERNNTRLLLEHLELLVARHERALRLTVIKRQSTTPGGVSS
EVEVLKALKSLFEHHKALDEKVRERLRVSLDRIKELEDELRLNRNGTGST
KNFTGETVSVSEKNLENSHKDNLLVSSPSIRMMNGSCSNGTDIMTDINES
YKRLSNNILAKATIGKEMDRDDILDEAGDKEKNAVESNHEIVRQEALDNL
RSKQSELTARLQDLDNQLIVGQKELFRAHEQIERLKNELSESENHREIQG
ERLAAFEQRLIDMQKEGTAAHEALDLTKAELSSKNGEVKRCEEKIQNLLE
KLNETNYRCQTQQSKEASNQNRVESEPAMSTELVKELEQLREINKNLEAQ
LEEANLELMRLAQREKLNDEHTKRLSTTVDNLLTESNERLQAHLREKMAT
LAEKNQLNSELDNIRRILEDTQIDRDKLYAEVDRWKRQNYELATQLQAYM
DSKKVQVRPLRGRENVLPDQVNTIGEGEWDKLQQSRVVSNVHQAFNAGLS
DIRSSERMDWMVKESQSPMSTSLDQGDWNSTQQNNKANNTAQKLAYLIQE
QLEAINNEIQIIQEEKQNAEMRAEELESRVVSPRLDPAVMNYAYSPAMFE
STPMGPSGWSPPGSPSRPHSSGHSTPTLLGPSQQYQTRSAYCGGSMWSPQ
HPQDQKVNMRRPNFNMPPTDHGYSSMHNFQSNLSTSNQAPQKQNFNEPNL
TKYSSYSKSTPQLSSKLFPAPPPYLEHENHKLFAIEMSKLHNYSSGNLIN
HSKPKTNKDDLWLLNQAKLSRNSEGNLMCCVGRTGTNGADNSGNRPTNKL
QNSFLSKNGYSPTKLSEDMEYHNHPMSYNQIQQEASPQPSRKMHHIPNVA
GGATMFHSESANQFQTHQQFPQSRQPTSQGNLVLPYFQQQNTGQLTYAGL
STALAPSNTSPGSNPIPPCFGSLDRRLLTSRKLIRRNSFENNSMQSSPVS
SGSQESLQQRGMRFHPQMLQISYSPSPTPSGSNLQSNPNNVHAMNVSGDS
TPGTKKKSRLGSLSRIFKRGGSMKTSVISSPMQPNDITSNYNSDINNLRS
INQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQIDQPITANITNP
MVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVAFCNWNGP
TIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHR
LKLRLAIQEMVQLTSPAPGPRPNKSLAFGELNHEWVGNYWLPSLGLSQFR
PAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDR
KQLEHRQELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGA
LLLLDQHFDANDLIILLQIPASAEQARQTLTRELHDLVKRGRENLQASQP
PSQENSLSTLTHQSSNNPSPDLSRHTPDSPSKQQQQQPIRPDSSASPTSH
LSQTQTGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR029515Liprin
IPR030442Syd-2
IPR037621Liprin-alpha_SAM_rpt_2
IPR037620Liprin-alpha_SAM_rpt_1
IPR001660SAM
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0050808synapse organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 430..464
NoneNo IPR availableCOILSCoilCoilcoord: 374..408
NoneNo IPR availableCOILSCoilCoilcoord: 1393..1413
NoneNo IPR availableCOILSCoilCoilcoord: 325..352
NoneNo IPR availableCOILSCoilCoilcoord: 169..193
NoneNo IPR availableCOILSCoilCoilcoord: 84..125
NoneNo IPR availableCOILSCoilCoilcoord: 490..538
NoneNo IPR availableCOILSCoilCoilcoord: 297..317
NoneNo IPR availableCOILSCoilCoilcoord: 41..75
NoneNo IPR availableCOILSCoilCoilcoord: 645..679
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1035..1059
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..726
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1494..1558
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1495..1558
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 1329..1396
e-value: 8.0E-4
score: 28.7
coord: 1244..1313
e-value: 5.2E-10
score: 49.3
coord: 1418..1490
e-value: 1.8E-6
score: 37.5
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 1418..1487
e-value: 8.0E-11
score: 41.9
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 1337..1394
e-value: 3.9E-9
score: 36.8
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 1247..1313
score: 13.972
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 1421..1490
score: 10.303
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 1340..1396
score: 12.344
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 1213..1334
e-value: 4.3E-49
score: 168.0
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 1411..1504
e-value: 1.8E-29
score: 103.4
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 1335..1409
e-value: 5.2E-29
score: 102.4
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 1413..1487
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 1244..1315
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 1330..1399
IPR029515LAR-interacting protein, LiprinPANTHERPTHR12587LAR INTERACTING PROTEIN LIP -RELATED PROTEINcoord: 1020..1497
coord: 34..836
IPR030442Liprin-alphaPANTHERPTHR12587:SF20LIPRIN-ALPHA, ISOFORM Ecoord: 1020..1497
coord: 34..836
IPR037621Liprin-alpha, SAM domain repeat 2CDDcd09565SAM_liprin-alpha1,2,3,4_repeat2coord: 1331..1396
e-value: 4.31628E-38
score: 134.908
IPR037620Liprin-alpha, SAM domain repeat 1CDDcd09562SAM_liprin-alpha1,2,3,4_repeat1coord: 1244..1314
e-value: 7.14172E-43
score: 148.482