Neur_chan_LBD domain-containing protein

Overview
NameNeur_chan_LBD domain-containing protein
Smed IDSMED30002607
Length (bp)517
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neur_chan_LBD domain-containing protein (SMED30002607) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neur_chan_LBD domain-containing protein (SMED30002607) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002607

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002607SMESG000064433.1 SMESG000041829.1 SmedASXL_013221SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30002607SMESG000064433.1 SmedASXL_013223SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002607SMESG000064433.1 DN290586ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30002607SMESG000064433.1 DN290586ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30002607SMESG000064433.1 Contig53760newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002607SMESG000064433.1 Contig53760uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4S2MHH5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001259 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.088e-38
Identity = 77/179 (43.02%), Postives = 110/179 (61.45%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDH-------KPNLKDVNLFS---------------------FWNPKLIIENIFTENKSSVSLEVTFTE-KYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V L  +FVKI +VDTVNE Y  +IFLQ++WREPLLD        + N +  N+                       FWNP+L+++N   E    VS EV F E  +EA+++EKRR+K  F ETLEL+HFPFDCQDLSV+V  + +++EV+LV +P +VS+++     +SQEW ++ HV+
Sbjct:  234 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFNMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGVFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVD 412          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A075A8W6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08254 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.869e-38
Identity = 77/179 (43.02%), Postives = 110/179 (61.45%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDH-------KPNLKDVNLFS---------------------FWNPKLIIENIFTENKSSVSLEVTFTE-KYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V L  +FVKI +VDTVNE Y  +IFLQ++WREPLLD        + N +  N+                       FWNP+L+++N   E    VS EV F E  +EA+++EKRR+K  F ETLEL+HFPFDCQDLSV+V  + +++EV+LV +P +VS+++     +SQEW ++ HV+
Sbjct:  239 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFNMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGIFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVD 417          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A3R7CFX9 (Neuronal acetylcholine receptor subunit alpha-7 OS=Clonorchis sinensis OX=79923 GN=CHRNA7 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.204e-38
Identity = 78/179 (43.58%), Postives = 110/179 (61.45%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDH--------------------------KPNLKDVNLFS--FWNPKLIIENIFTENKSSVSLEVTFTEK-YEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V L  +FVKI +VDTVNE Y  +IFLQ++WREPLLD                           K +L  + L    FWNP+L+++N   E    VS EV F E  +EA+++EKRR+K  F ETLEL+HFPFDCQDLSV+V  + +++EV+LV +P +VS+++     +SQEW ++ HV+
Sbjct:   39 VELMLIFVKIGQVDTVNERYQADIFLQARWREPLLDATWNTSRPRNNFRTFKMVENPVMELAPKRHLHTLKLQDDEFWNPRLLLDNAQGEPIEIVSHEVEFVEPDFEAYLVEKRRIKGVFHETLELKHFPFDCQDLSVTVTCDRTVEEVELVPSPTEVSQVDRRCAADSQEWKIFHHVD 217          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: A0A4Z2CPI1 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_008605 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.111e-37
Identity = 76/181 (41.99%), Postives = 108/181 (59.67%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNL-------------------------KDVNLFS-----FWNPKLIIENIFTENKSSVSLEVTFTEK-YEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V L  +FVK+ +VDTVNE Y  +IFLQ++WREPLLD   N                          + +N        FWNP+L+I+N   E    +S EV F E  +EA+++EKRR+K  F ETLEL+HFPFDCQDLSV++  + + DEV+LV +P +VS+++     +SQEW ++ HV+
Sbjct:   17 VELVLIFVKVGQVDTVNERYQADIFLQARWREPLLDAMWNKSSLKSKSSWQTNPSIENPFTDLTSKRQLNTLKLQDDEFWNPRLLIDNAEGEPIEIISHEVEFMEPDFEAYLVEKRRIKGIFHETLELRHFPFDCQDLSVTITCDRTTDEVELVASPTEVSQVDVRCAADSQEWKIFHHVD 197          
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Match: R7VF52 (Neur_chan_LBD domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228357 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.224e-37
Identity = 68/152 (44.74%), Postives = 100/152 (65.79%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPN--LKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V LR VF+KI ++DT+ E YS + F+Q+KWREP LD K    LK ++L  FWNP L IEN+ +E K +  L  +   + EAF++E+RRV+  F E LEL  FP D QDL+V++ +E    E+D++   N++S +N    ++ QEW L+EH+E
Sbjct:   34 VELRVVFLKIGEIDTLKEQYSADTFIQAKWREPALDGKTTEELKRIDLDRFWNPLLFIENVLSETKEATWLTASTNSRAEAFVLERRRVRGVFMENLELNDFPLDVQDLTVTITSERPDTEIDIIPDENEMSGINVQTFVDQQEWRLHEHIE 185          
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Match: EDO32790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU26])

HSP 1 Score: 57.3806 bits (137), Expect = 2.455e-10
Identity = 35/151 (23.18%), Postives = 74/151 (49.01%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEK-RRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            V +RC    +  +D + + ++ E+++ + WREP L  K N ++V   + W+PK+   N    ++      + + E     + ++  +++ +F+E   L+ FP D Q+LS+ +++++S   V   +       L        ++W LY HV 
Sbjct:   18 VLIRCGISFLGDIDVIRQQFTCELWMTASWREPKLAGKKN-EEVKWDNEWSPKISFSNSLLLDRVYKGRRLYYEENSTVPLAQEVYKIRGTFKEQFSLEQFPVDLQELSIIISSDWSDRTVTFEKDMAKPDYLRQQTFSSPRDWVLYPHVH 167          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064433.1 (SMESG000064433.1)

HSP 1 Score: 308.916 bits (790), Expect = 2.090e-106
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query:   22 MDXXXXXXXXXXXXXVYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            MDSHSKSSLKSSHKKVYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE
Sbjct:    1 MDSHSKSSLKSSHKKVYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 165          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041818.1 (SMESG000041818.1)

HSP 1 Score: 251.906 bits (642), Expect = 5.101e-84
Identity = 116/151 (76.82%), Postives = 139/151 (92.05%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEK-YEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            VYLRCVF+KIYKVDT+NEFYSG+IFLQ+KWREPLLD + ++KD+NL +FWNPKL+IEN+F E+KSSV  EV+F+EK +EA+I EKRR+KA FRETLELQHFPFDCQDLS+ VATEYSI+EV LVE P+D+SKLNT+DG+ESQEWNLYEHVE
Sbjct:   16 VYLRCVFIKIYKVDTINEFYSGDIFLQAKWREPLLDDRTDMKDINLSTFWNPKLVIENMFQESKSSVVHEVSFSEKRHEAYITEKRRIKACFRETLELQHFPFDCQDLSIPVATEYSINEVKLVELPHDLSKLNTIDGMESQEWNLYEHVE 166          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041796.1 (SMESG000041796.1)

HSP 1 Score: 246.128 bits (627), Expect = 4.159e-81
Identity = 115/152 (75.66%), Postives = 134/152 (88.16%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTE--KYEAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            VYLRCVF+KIYKVDTVNEFYSGEIFL +KWREPLLD+K +LKD++L +FWNPKL IENIF   KS+ SLEV+F E     AF++EK R+KA+FRETLELQHFPFDCQDLS+SV TEYSI+E+++ E PND+SKLNTLDGIESQEWNLYEHVE
Sbjct:   69 VYLRCVFIKIYKVDTVNEFYSGEIFLHAKWREPLLDNKSDLKDISLSTFWNPKLSIENIFQITKSTTSLEVSFDEGNNKRAFVVEKTRIKAAFRETLELQHFPFDCQDLSISVGTEYSIEELEMAENPNDISKLNTLDGIESQEWNLYEHVE 220          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000041829.1 (SMESG000041829.1)

HSP 1 Score: 237.269 bits (604), Expect = 3.327e-78
Identity = 109/151 (72.19%), Postives = 133/151 (88.08%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKY-EAFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            VYLRCVF+KI+KVDTVNEFYS EIFLQSKWREPLLD++ ++KD++L SFWNPK+ IENIF E KSS+S EV+++ K  EA+I EKRRV   FRE LELQHFPFDCQDLS++V+TEY I+EV ++E P+D+SKLNT+DG+ESQEWNLYEHVE
Sbjct:   16 VYLRCVFIKIFKVDTVNEFYSAEIFLQSKWREPLLDNRSDIKDISLSSFWNPKISIENIFMETKSSISHEVSYSGKAREAYITEKRRVSGGFREVLELQHFPFDCQDLSITVSTEYPINEVKMLECPHDLSKLNTIDGMESQEWNLYEHVE 166          
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Match: SMESG000064435.1 (SMESG000064435.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.917e-71
Identity = 107/151 (70.86%), Postives = 130/151 (86.09%), Query Frame = 1
Query:   67 VYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLLDHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYE-AFIIEKRRVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTLDGIESQEWNLYEHVE 516
            +YLRCVF+KI+KVDTVNE Y  EIFLQ+KWREPLLD++ + K+++L +FWNPKL IENIFTENK SVSLEV+++EK   A+++EKRRVKASF E LEL+HFPFDCQDLS+ V TEYS D VDL+E+P+D SKLN  DGIESQEW+LY HVE
Sbjct:   16 IYLRCVFIKIFKVDTVNENYYAEIFLQAKWREPLLDNECDYKNIDLKNFWNPKLRIENIFTENKVSVSLEVSYSEKEGVAYLMEKRRVKASFHEILELKHFPFDCQDLSIIVTTEYSSDYVDLMESPHDPSKLNVSDGIESQEWSLYSHVE 166          
The following BLAST results are available for this feature:
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MHH52.088e-3843.02Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A8W63.869e-3843.02Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3R7CFX98.204e-3843.58Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
A0A4Z2CPI14.111e-3741.99Uncharacterized protein OS=Schistosoma japonicum O... [more]
R7VF524.224e-3744.74Neur_chan_LBD domain-containing protein OS=Capitel... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327902.455e-1023.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neur_chan_LBD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064433.12.090e-106100.00SMESG000064433.1[more]
SMESG000041818.15.101e-8476.82SMESG000041818.1[more]
SMESG000041796.14.159e-8175.66SMESG000041796.1[more]
SMESG000041829.13.327e-7872.19SMESG000041829.1[more]
SMESG000064435.11.917e-7170.86SMESG000064435.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002607 ID=SMED30002607|Name=Neur_chan_LBD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=517bp
GAAATATAGAATTTTCCTCCGATGGATTCTCATTCTAAGTCTTCATTGAA
ATCCAGTCACAAGAAGGTGTATTTGCGATGTGTTTTCGTGAAAATATACA
AAGTTGATACGGTAAATGAGTTTTATTCCGGTGAGATATTTCTTCAGTCA
AAATGGAGAGAACCTTTACTGGATCACAAACCAAATTTAAAAGACGTCAA
TTTATTTTCATTCTGGAATCCGAAACTGATTATAGAAAATATTTTCACGG
AAAATAAAAGTTCGGTTTCATTAGAAGTTACCTTCACTGAAAAATATGAG
GCCTTTATTATCGAAAAGCGACGGGTTAAGGCCAGTTTTCGGGAAACTCT
GGAGCTTCAACATTTCCCATTTGATTGCCAGGATTTATCCGTATCTGTGG
CCACCGAATATTCCATTGATGAAGTGGATCTTGTAGAAACTCCTAATGAT
GTCAGTAAATTAAACACTTTAGATGGAATAGAGTCACAGGAATGGAATTT
ATATGAGCATGTTGAGG
back to top

protein sequence of SMED30002607-orf-1

>SMED30002607-orf-1 ID=SMED30002607-orf-1|Name=SMED30002607-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MDSHSKSSLKSSHKKVYLRCVFVKIYKVDTVNEFYSGEIFLQSKWREPLL
DHKPNLKDVNLFSFWNPKLIIENIFTENKSSVSLEVTFTEKYEAFIIEKR
RVKASFRETLELQHFPFDCQDLSVSVATEYSIDEVDLVETPNDVSKLNTL
DGIESQEWNLYEHVE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 6..165
e-value: 1.5E-16
score: 62.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 13..162
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 12..162
e-value: 2.1E-9
score: 37.1
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 6..137
NoneNo IPR availablePANTHERPTHR18945:SF768coord: 6..137
NoneNo IPR availableCDDcd18988LGIC_ECD_bactcoord: 22..160
e-value: 2.67554E-13
score: 62.3102