Cilia-and flagella-associated protein 74

Overview
NameCilia-and flagella-associated protein 74
Smed IDSMED30002606
Uniprot Best hitCilia- and flagella-associated protein 74 OS=Mus musculus OX=10090 GN=Cfap74 PE=2 SV=3 (E=0)
Length (bp)4841
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia-and flagella-associated protein 74 (SMED30002606) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 74 (SMED30002606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia-and flagella-associated protein 74 (SMED30002606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 74 (SMED30002606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002606SMESG000043377.1 SmedASXL_012641SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002606SMESG000043377.1 dd_Smed_v6_12145_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30002606SMESG000043377.1 dd_Smed_v4_18628_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_12145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_12145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002606SMESG000043377.1 dd_Smed_v4_12145_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Human
Match: CFAP74 (cilia and flagella associated protein 74 [Source:HGNC Symbol;Acc:HGNC:29368])

HSP 1 Score: 486.878 bits (1252), Expect = 2.487e-149
Identity = 294/916 (32.10%), Postives = 477/916 (52.07%), Query Frame = 2
Query: 2153 IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDS-YELVKPESIEI-------DSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDR--SSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL----SSHFYGQTNLT--------------TKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVT 4795
            I P+   ++ I ++P+  GD    F++ F++        RV G AIDVPV++   +V + ICM +RLYQD+++ ++R+  AL+L+F V  E++ +LE+LP TG+IQA  ++  Q+K L R S+  +   YFD ET +L+  +   +A+Q K V F+  AI+TT+DL++       + +DFG CTI E     I L N  +LPQEFGF   P+F+++QPN G+GTILP ETL+  V+F P KA+ + FQL C+S I+R F +SC  +GVHP L+LS   + F  TA+ D S   +++ N+HLS +  TH  P+IG     P+GP +F+F++P +SPI I P  G++ P ++  V V F P L    I+ EA  L+N+++E  + +K                                 N +   K+  G S   L A   D  +++  P  +E+        S+++   + +LL  F   F+   V C +A+G I DR  S  + ++ +N+L+LEL CP++ P +++ S+ GK I +FG+     R  K ISIQN+S E   +  ++LNPNG F + N    L       LV+SF   +  + Q    +    ++  L +T     + A +    ++    N G V+  E       + NNS L + + + L    S+   GQ  L               T+N N   +F++ P +GV+  GK+Q   V+FSPDH S  F + ++  +F++      +++G      M+++   P ++          P E++      D  + +E   L  PI++   Y     D     A     VGC+RT   S KK  E+SID++  L   GF+++PS+G +E    K+I+ISW+PP++++    L  S L+ L+G+   T
Sbjct:  170 IGPFSSIKVPIVFTPVVPGDVQARFKVTFKNPQCPTLHFRVVGVAIDVPVWVPKPSVDLKICMYDRLYQDSVLVHTRSKAALRLKFEVCKELRAHLELLPKTGYIQAQSSYSVQLKFLPRHSLPEDAGRYFDKETRVLEAPMTIWVADQNKPVGFTVHAIVTTSDLEL-----SPSEVDFGYCTIYEAIRTEISLHNHSLLPQEFGFVRLPKFVDVQPNDGFGTILPLETLQFCVIFQPTKAEEHRFQLTCKSEINRCFKLSCRAVGVHPPLELSHYQIKFAATALYDTSVATVYVINSHLSMSSPTHSKPRIGSEDASPMGPTSFEFLLPPDSPITISPSVGTVWPGKRCLVQVAFRPVLPEKLIRQEALPLLNKEMETKSFRK---------------------------------NMAPQRKDLHGLSFSVLRAQNRDKLFKVSVPHVLEMRKRELRPSSDEYQAARATLLRAFQAKFDTFVVPCVVASGDIKDRKGSEPLSFSPHNTLYLELWCPTVAPSVVVTSHKGKTIFNFGDVAVGHRSIKKISIQNVSPEDLALDFSLLNPNGPFVLLNHSSLLRAGGTQVLVLSFSPHESILAQETLDII--TKRGTLTLTLMGTGV-ASMITCSIEGSVLNMGYVIAGESVSSGFKLQNNSLLPIKFSMHLDSLSSTRGRGQQQLPQFLSSPSQRTEVVGTQNLNGQSVFSVAPVKGVMDPGKTQDFTVTFSPDHESLYFSDKLQVVLFEKKISHQILLKGAACQHMMFVEGGDPLDV----------PVESLTAIPVFDPRHREEAEELR-PILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKKTVEFSIDSVASLQHKGFSIEPSRGSVERGQTKTISISWVPPADFDPDHPLMVSALLQLRGDVKET 1033          

HSP 2 Score: 68.9366 bits (167), Expect = 8.168e-11
Identity = 30/75 (40.00%), Postives = 49/75 (65.33%), Query Frame = 2
Query: 1805 EPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSE 2029
            +P +N+DL G I F +Q+ +F++P+KC TKKC +S+D+++I F + V+GE+  + + L N G  GT       SE
Sbjct:    2 KPMINKDLEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTNVGGLGTTFKFLPASE 76          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Human
Match: CFAP74 (cilia and flagella associated protein 74 [Source:HGNC Symbol;Acc:HGNC:29368])

HSP 1 Score: 442.965 bits (1138), Expect = 3.746e-129
Identity = 270/851 (31.73%), Postives = 435/851 (51.12%), Query Frame = 2
Query: 2153 IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDS-YELVKPESIEI-------DSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDR--SSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL----SSHFYGQTNL--------------TTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKK 4600
            I P+   ++ I ++P+  GD    F++ F++        RV G AIDVPV++   +V + ICM +RLYQD+++ ++R+  AL+L+F V  E++ +LE+LP TG+IQA  ++  Q+K L R S+  +   YFD ET +L+  +   +A+Q K V F+  AI+TT+DL++       + +DFG CTI E     I L N  +LPQEFGF   P+F+++QPN G+GTILP ETL+  V+F P KA+ + FQL C+S I+R F +SC  +GVHP L+LS   + F  TA+ D S   +++ N+HLS +  TH  P+IG     P+GP +F+F++P +SPI I P  G++ P ++  V V F P L    I+ EA  L+N+++E  + +K                                 N +   K+  G S   L A   D  +++  P  +E+        S+++   + +LL  F   F+   V C +A+G I DR  S  + ++ +N+L+LEL CP++ P +++ S+ GK I +FG+     R  K ISIQN+S E   +  ++LNPNG F + N    L       LV+SF   +  + Q    +    ++  L +T     + A +    ++    N G V+  E       + NNS L + + + L    S+   GQ  L               T+N N   +F++ P +GV+  GK+Q   V+FSPDH S  F + ++  +F++      +++G      M+++   P ++          P E++      D  + +E   L  PI++   Y     D     A     VGC+RT   S KK
Sbjct:  753 IGPFSSIKVPIVFTPVVPGDVQARFKVTFKNPQCPTLHFRVVGVAIDVPVWVPKPSVDLKICMYDRLYQDSVLVHTRSKAALRLKFEVCKELRAHLELLPKTGYIQAQSSYSVQLKFLPRHSLPEDAGRYFDKETRVLEAPMTIWVADQNKPVGFTVHAIVTTSDLEL-----SPSEVDFGYCTIYEAIRTEISLHNHSLLPQEFGFVRLPKFVDVQPNDGFGTILPLETLQFCVIFQPTKAEEHRFQLTCKSEINRCFKLSCRAVGVHPPLELSHYQIKFAATALYDTSVATVYVINSHLSMSSPTHSKPRIGSEDASPMGPTSFEFLLPPDSPITISPSVGTVWPGKRCLVQVAFRPVLPEKLIRQEALPLLNKEMETKSFRK---------------------------------NMAPQRKDLHGLSFSVLRAQNRDKLFKVSVPHVLEMRKRELRPSSDEYQAARATLLRAFQAKFDTFVVPCVVASGDIKDRKGSEPLSFSPHNTLYLELWCPTVAPSVVVTSHKGKTIFNFGDVAVGHRSIKKISIQNVSPEDLALDFSLLNPNGPFVLLNHSSLLRAGGTQVLVLSFSPHESILAQETLDII--TKRGTLTLTLMGTGV-ASMITCSIEGSVLNMGYVIAGESVSSGFKLQNNSLLPIKFSMHLDSLSSTRGRGQQQLPQFLSSPSQRTEVVGTQNLNGQSVFSVAPVKGVMDPGKTQDFTVTFSPDHESLYFSDKLQVVLFEKKISHQILLKGAACQHMMFVEGGDPLDV----------PVESLTAIPVFDPRHREEAEELR-PILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK 1551          

HSP 2 Score: 206.453 bits (524), Expect = 9.973e-53
Identity = 155/592 (26.18%), Postives = 297/592 (50.17%), Query Frame = 2
Query:  269 QQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTAN-NLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSE 2029
            ++ + EL+ C      ++K+ +    EI T     N+AA+ RLQ+  +R+  E+E E+DL+      + ++E    H +++EG+L    E  +T ++        R + R  ++    + AL  +E ++    +  L TQ+   L + + +E A K H     FL+ ++ + R  + +   E  E   ++  +V  L   I   ++ L    +  ++   L  ++    +K+++ +G +    +  QR++ E+  QK       K +K +I  +I+ EE   +K+ K  P        P+     L + + + + + D  +  T+        +E     G S   E + ++              I+    ++ +++T +  PE  GLW+   DYK  +    ++  K    +KMD++I+ R + +L+  ++  Q+V  + F+G  F SKP ++ F++ ++ + Y++K+ L NT+Y+ N C+L  V E+L DF+ + F PPGPLS GM+CE  + F+P +N+DL G I F +Q+ +F++P+KC TKKC +S+D+++I F + V+GE+  + + L N G  GT       SE
Sbjct:   96 EKMRGELRACRQRRDLIDKQQEAVAAEIATEEEAGNMAAVGRLQAVSRRLFAELENERDLQSRTEAVLKESENTMWHIEIQEGRL----EAFRTADREEVEATGRRLQVRAAEQLCREQEALGKVERNRLLRIRKSLNTQKELGLRHQKLLEDARKNHKVAVRFLKASLGRIREQEKKEEMECHEYMRRRMDAVVALKGSISANRDTLRKFQAWDRAKAELAEQRVQAEKKAILAQGRDAFRHLVHQRRRQELEAQKRAFEEEQKLRKQEIISRILKEEAEEEKRKKQHP--------PTSARHRLTLRDKTWNYISDFCKKTTVPTNTYTLDYEAAAGPGPSRLLEVVSSEL-------------IQGDPGASSEEET-LAEPEISGLWNE--DYKPYQVPKEDVDRKPVGGTKMDKDILERTVERLRSRVVHKQVVWGREFQGRPFNSKPELLHFQDFDIGKVYKKKITLVNTTYTINYCKLVGVEEHLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKDLEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTNVGGLGTTFKFLPASE 659          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Zebrafish
Match: cacna1db (calcium channel, voltage-dependent, L type, alpha 1D subunit, b [Source:ZFIN;Acc:ZDB-GENE-040525-3])

HSP 1 Score: 563.533 bits (1451), Expect = 1.208e-172
Identity = 428/1578 (27.12%), Postives = 772/1578 (48.92%), Query Frame = 2
Query:  272 QFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKA---HKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKH-ISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLW-----------DTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEID---------------NE-------------------TRKVVS--REPNSAVNIDVQTDLLDTKPITTSLDHLKLWIE--------PYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANK-------KWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGE-TVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNW-SLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTT------KNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGE 4783
            Q K ELK    H+SEL ++     E++E  +   N   LFRL++QLKR+  E++ E+DL   +   + + E +    ++E G+ +   ++L+ +EK  + ++++ Q+ R ++EK++ +        D+    K++   Q+  +L  +  E+A   H K + +L++T+++ +  K+  A+E  ++ +KK   +V  L +     +E++ A   ++K+ + ++ ++E ++++ +  +G N    +   + Q   +K+ E+     + ++++I  K++ E +  ++K K  P     + +P K+   +         L   E  K  ++ E+ S     P+    SS  +  ++  F             ++       D ++  PEF GLW           D  I+ + S T     +   SASK ++                 + V  +  KG  F SKP +I+F++ EV   Y++KV LTN +Y TN C+L  VS+NL D V++ F PPGP+S GM CE +  F P ++ DL G I F S +  F++P+KC  KKC M +D+  + F T V+G+++ + + + N GA GT  ++  +S +                NE                   TR + S  R P+  +  D ++  ++TK + ++++  ++ I         P+    + I ++P   G+   +F+I F   + +  D+   G A  VPV++ +  + + IC  +RLYQD I   SRA+TAL+L F V  E+++++ I P TG IQA  +F AQ+K L R S+  +   +F+ +TG+L+V +   +A+QVK V F+  A++T++DL     D  E  +DFG C+I E     ++L N  +LPQEFGF G P+FI++QPN G+GT+LP +++++ ++FS  KA  +NF L C++ I+R F + C  +GV P+L LS  +L F +TA+ D+    +F+++   +    THEP +           + F F +P++S   I P  G L P +++ V V F P LS   IK EA   + R+ E  +++       K ES + ++KDQI                        AT  N+S             S+    P  I+IDS+++L  K SLL  F        V C  +    SD + +  ++ + +LH+EL   +++P L+++S SG   + F    V +K +KK+I IQNIS +   + S++L+ NG F + NA+R + P     L+++F    P + +    +L     +  L +T   +A+   +       G  +   V  NE   +   + N S ++V + + L S    +  L++      +N + L +F ++P  GVI+   +  + V+F PDH S  +R+ ++  I          +RG      M++    P ++     +    P         +  E  SL   + L+S Y +   I   +    +GCV +   S KK  E+  +NL+ +   GF V P++G ++A   + + ++W PP+     +++     +T+KGE
Sbjct:   93 QAKEELKAFHLHVSELEEQRDKIEEQMENEKQAGNSVPLFRLRAQLKRVCAELQAEEDLGDHLEMVLKEHELELCQVEVELGRFLDLRQELELEEKTIQSQDQKTQKLRFQREKRVIRGRRHKAHQDEIEREKLL---QEQMDLQKKQQEQALASHLKAAVYLKQTLQRIKQ-KDAEAEERKQELLKKRKTAVMALKASYAATQESINARKQRQKASEQIQREQEQQMKEWLEARGMNSTEHLHRLKLQERHSKRNEEFEEKRRARQMEIVAKLLLERN--EEKHKKAPAPIHGKKQPGKLLQDI---------LSSSEHTKREQRHEVLS-----PRASFVSSRSDSISEVSFSPEC---------VEMKDEDDGDMSLAQPEFTGLWEHKHTDYMASSDENIELETSHTTMKTKLNKSSASKAEK-----------------KTVKSRESKGPPFISKPEVILFKDWEVGRIYKKKVTLTNVTYGTNYCKLIGVSDNLRDHVSVSFEPPGPMSAGMACELEAIFRPSVDVDLDGVIHFQSAAGPFSVPIKCSRKKCEMVVDQCFVDFGTHVVGQTVSRMITMTNRGALGTRYTLTPVSSLQQTPVSGKTDVEMPSLNEEKAEITSGMKKTHKMSLTVTRALESPIRGPDEVLMADPES--VETKVMQSTIEPPEISIGQASEGEVGPFMSVRVPIIFTPTIPGEAKLDFQITFSQPECEPIDISAHGVAESVPVWVNNPNIDLKICTYDRLYQDGIQVQSRASTALRLTFKVCKEMRNHMSIQPKTGLIQAKSSFTAQLKFLPRPSLYADAKSFFNEDTGVLEVPLTVQVADQVKPVLFTAHAVVTSSDLRF---DRSE--VDFGHCSIYECVQTAVRLTNCSLLPQEFGFVGIPKFIDVQPNDGFGTLLPSQSMDIYLIFSALKAGEHNFTLTCKTSINRDFQLCCRAVGVQPSLKLSDTVLEFGDTALGDRRTAVLFVEDQRPT---QTHEPTE-----------RLFTFSVPEDSDFTIAPSSGRLLPGQRRLVQVTFSPALSDDMIKAEA---LRRRDESQSDRQQTDSKSKSESPLTVMKDQIS----------------------KATPANES-------------SFHSWSPADIQIDSSEYLSAKASLLRSFTERHVRHLVPCFTST---SDTTEEPRHSPHETLHVELRGLAVRPALLLISESGHNTLHFRTLAVGQKVVKKVI-IQNISSQTVTLSSSLLDVNGPFSVLNAMRSIAPEDKHTLLIAFT---PLLAKKYCETLEVSCSQMTLELTLLGEAVDPIITCS--HEGLLDFDWVPENESTSQVFRLQNVSSVDVQFSVLLESLCPSEQKLSSTAAVGVQNYSGLSVFGVSPAGGVISPAGAADITVTFHPDHRSLHYRDQLRVQISSMQTLCKLELRGSSCRHNMFVCGGDPVDV----SYESLIPSHIYTPGHTHHQESTSLL--LTLRSEYQEGKAIAATRK-LHIGCVYSCKTSTKKGVEFMWENLSAVEQQGFRVTPAQGSVDAGQRRPVTVTWTPPAGLAPNAVVQACAQLTVKGE 1549          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Xenopus
Match: cfap74 (cilia and flagella associated protein 74 [Source:NCBI gene;Acc:100158555])

HSP 1 Score: 546.199 bits (1406), Expect = 2.975e-165
Identity = 311/898 (34.63%), Postives = 504/898 (56.12%), Query Frame = 2
Query: 2153 IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHIS-DRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTN------------------LTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETS 4789
            I P G  +I + ++P+  G     F I F++   K   + V+G AIDVPVY+ +  + + IC  +RLYQD+I+ ++RA TAL+L+F V  E+K+++E+LP TGFIQA  +F  Q+K L R S+  +    FD +TG+L+  +  ++A+Q + V F+  AI+T++DL+I   +     +DFG CTI E    ++QL NK ILPQ+FGF G PE++EIQPN G+GT+LP ET++L V+F   KAK Y F+L C+S I+R F VSC  IGVHP L LS  ++ FP TA++D S   + + N+H S N +TH  P+IG G + PIGP +F+F +P++ PI I P  G++ P ++ K+ V F+P LS   I+ EA  +V R  E  A    E+E   + ++    R E +KV +  K+     +     K K      +LM   P   EL KPE I+++S+++   + S+  +F   FE   + C IA G  S  +     ++ YN+L+LELHCP+I P LII S +G+ +IDFGE    +R+ K +++QNIS E  ++  +ILNP G F + N +  +EP A   L+++F+  +  +F  N  +    R   L ++ K +A+T  +    L+    + G VL N+ +     + N S + V Y ++L S    + +                  + T+N N L +F++ P  G I  GK+Q L V+FSPDH S  + +++   +F ++   +  + G  +   MY++   P     +D   ++     M+ +D+++     +N+ ++       +  ++       VGC+RT  +  KK+ E+  +N+ VL   GFT++P+K  +E    KSI+I W PP+ Y+  +   T+  +TLKG+ +
Sbjct:  802 IGPLGTVKIPVIFTPMVPGKSFAQFEITFDNSSCKTIPVLVTGDAIDVPVYLPNSNIDLKICTYDRLYQDSIMVHNRARTALRLKFEVCKELKNHMELLPKTGFIQAQSSFSVQLKFLPRHSLPEDAGTCFDKDTGVLEAPMTITVADQTRPVPFTVHAIVTSSDLEISPTE-----VDFGYCTIVEAVQASLQLTNKSILPQDFGFVGIPEYVEIQPNDGFGTLLPLETVKLDVIFRAEKAKEYKFELTCKSAINRQFKVSCKAIGVHPPLALSHSLIQFPATALNDASIATLHVINSHTSRNEFTHPVPRIGKGDIAPIGPTSFEFHVPEDYPITISPAVGTVLPGQRCKIQVSFQPLLSQKEIREEAIHIVRRATE--AQATMETEATQMLEKEMQGRKE-KKVMSGKKEKKPLPSPKQHPKEKG----PQLMHSVPT--ELPKPEDIKVNSDEYAAAQESIYRRFMGKFERYVIPCFIAIGDTSKSKDENFKFSHYNTLYLELHCPAIAPPLIITSENGRHLIDFGEIAIGQRVVKRVALQNISLEPVELSVSILNPCGPFMLLNPLSVVEPGANCFLLIAFLPDENKVFFENMKV--SCRHATLTLSIKGRALTPSVSCS-LEGRILDMGYVLANDSSSTTFKLQNTSTVPVTYSVKLGSLSVSRYSELQKLPPFITSLKRPSALVGTQNFNGLSVFSVHPVEGTILPGKTQDLTVNFSPDHESFHYSDVLTVELFGKLSAHTIQMMGACRNHIMYVEGGDP-----LDVAVESLSVIPMEEEDSSD----LVNSLLLTLHCIQTETALKPGVRELHVGCIRTSLLPTKKSVEFFWENMQVLQQKGFTIEPAKAAVEPGQRKSISIQWTPPAGYDPMNPARTTAKLTLKGDIT 1673          

HSP 2 Score: 251.906 bits (642), Expect = 8.920e-67
Identity = 197/645 (30.54%), Postives = 342/645 (53.02%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSL-SKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTID-YKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSE----IDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLD-HLKLWIEPYGEQEI 2179
            +Q+ + EL  C   I  L +E      E    +   NIAA+ RLQ+  KR+  E++ E+ +   +   + + E D    ++E GK     E+L  DE+  ER+EKER  +R + EK L   A +  + ++    K + E +          +K H    +FL++T+ + R  +N+   ++ E+  ++  SV  L + I   +ENL  I ++ K++ +   K+E+   +SV+ +G +    +  Q++  E  K+K++     + +K +I  +++ EE   +K+ K +  L  +  K  K S +   T   + S +Y + +    EK +    W + P     SSDEE  +  +     + S +   +   +S  ++  ++  PEF GLW      YKV K   ++ ++    SKM+ EIM+  L +L+  I++ Q+VS   FKG  F SKPN++ F+NL+V + Y++++ LTN SY+ N C+L  VSE+L DF+TI+F PPG +S GM+CE  + F+P +NEDL GE+K  +Q+  F IPVKC+TKKC ++++++ I F T V+GE+++Q + L N GA GT  SI  ++      + ET  V S +  ++ N+  +T+     P+    D H+    E    +E+
Sbjct:  114 IQKIREELTACRERIQTLKQEKNNAERETVVEQETNNIAAVSRLQAVHKRLCTELDNEEAVASTLATMLKENEFDLWQIEVEHGKFDSLRERLVKDEEQLERQEKERASQRAQDEKTLLTLAERKKQKEQLRETKRLKEQEVQYRKVMEDAQKNHVTAVQFLKETMTRIRERENKKEMKSREEMERRMQSVLSLKNSISTNRENLRVIEARTKAEAMKAKKQEILENESVLARGEDVTKFIIHQKRLKEFEKRKQEFEEQQRIQKQEIISRLLKEESMQEKQRKQVSSL--DLSKGRKSSKLRAKTMQYIKSVVYPEPE----EKKDPQGNW-RSPSPLSFSSDEETSSSVE-----EKSPDVPPRFTYSSEEEEAESLAQPEFVGLWSQNYKPYKVPKEETDMNLQ--RGSKMEMEIMAERLQKLRSGIVEKQVVSGHEFKGCPFHSKPNLVHFKNLDVGKIYKKRITLTNASYTINFCKLVGVSEHLKDFITIQFDPPGAMSAGMSCEMVVIFKPMINEDLEGEVKLLAQTGPFCIPVKCMTKKCELALEKEHIDFGTHVVGETVIQTITLINHGALGTKFSIHTLTHDSGTCEAETAHVASMKKIASPNLHKETETSLVSPVQDHSDQHMSQQTETQSREEL 744          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Mouse
Match: Cfap74 (cilia and flagella associated protein 74 [Source:MGI Symbol;Acc:MGI:1917130])

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 463/1607 (28.81%), Postives = 801/1607 (49.84%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVT 4795
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE   +++        + R  P             LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++  E+S+D ++ L   GF+++PS+G +E    K+INISW+PP++++    L  S L+ L+G+   T
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQR--------KRRQHP-------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRRTVEFSLDGVSWLQHKGFSIEPSRGSVERGQTKTINISWVPPADFDPDHPLMVSTLLQLRGDVKET 1610          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Mouse
Match: Cfap74 (cilia and flagella associated protein 74 [Source:MGI Symbol;Acc:MGI:1917130])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 457/1588 (28.78%), Postives = 792/1588 (49.87%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEE-DNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYE 4735
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE +  ++K +  P                      LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++  E+S+D ++ L   GF+++PS+G +E    K+INISW+PP++++
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQRKRRQHP----------------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRRTVEFSLDGVSWLQHKGFSIEPSRGSVERGQTKTINISWVPPADFD 1590          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Mouse
Match: Cfap74 (cilia and flagella associated protein 74 [Source:MGI Symbol;Acc:MGI:1917130])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 439/1542 (28.47%), Postives = 759/1542 (49.22%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKK 4600
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE   +++        + R  P             LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQR--------KRRQHP-------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRR 1545          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Mouse
Match: Cfap74 (cilia and flagella associated protein 74 [Source:MGI Symbol;Acc:MGI:1917130])

HSP 1 Score: 59.6918 bits (143), Expect = 6.077e-9
Identity = 50/211 (23.70%), Postives = 88/211 (41.71%), Query Frame = 2
Query: 4043 FNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKK 4600
             N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++
Sbjct:   16 LNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRR 215          
BLAST of Cilia-and flagella-associated protein 74 vs. UniProt
Match: sp|Q3UY96|CFA74_MOUSE (Cilia- and flagella-associated protein 74 OS=Mus musculus OX=10090 GN=Cfap74 PE=2 SV=3)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 439/1542 (28.47%), Postives = 759/1542 (49.22%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKK 4600
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE   +++        + R  P             LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQR--------KRRQHP-------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRR 1545          
BLAST of Cilia-and flagella-associated protein 74 vs. UniProt
Match: sp|Q9C0B2|CFA74_HUMAN (Cilia- and flagella-associated protein 74 OS=Homo sapiens OX=9606 GN=CFAP74 PE=2 SV=3)

HSP 1 Score: 442.965 bits (1138), Expect = 1.799e-128
Identity = 270/851 (31.73%), Postives = 435/851 (51.12%), Query Frame = 2
Query: 2153 IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDS-YELVKPESIEI-------DSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDR--SSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL----SSHFYGQTNL--------------TTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKK 4600
            I P+   ++ I ++P+  GD    F++ F++        RV G AIDVPV++   +V + ICM +RLYQD+++ ++R+  AL+L+F V  E++ +LE+LP TG+IQA  ++  Q+K L R S+  +   YFD ET +L+  +   +A+Q K V F+  AI+TT+DL++       + +DFG CTI E     I L N  +LPQEFGF   P+F+++QPN G+GTILP ETL+  V+F P KA+ + FQL C+S I+R F +SC  +GVHP L+LS   + F  TA+ D S   +++ N+HLS +  TH  P+IG     P+GP +F+F++P +SPI I P  G++ P ++  V V F P L    I+ EA  L+N+++E  + +K                                 N +   K+  G S   L A   D  +++  P  +E+        S+++   + +LL  F   F+   V C +A+G I DR  S  + ++ +N+L+LEL CP++ P +++ S+ GK I +FG+     R  K ISIQN+S E   +  ++LNPNG F + N    L       LV+SF   +  + Q    +    ++  L +T     + A +    ++    N G V+  E       + NNS L + + + L    S+   GQ  L               T+N N   +F++ P +GV+  GK+Q   V+FSPDH S  F + ++  +F++      +++G      M+++   P ++          P E++      D  + +E   L  PI++   Y     D     A     VGC+RT   S KK
Sbjct:  753 IGPFSSIKVPIVFTPVVPGDVQARFKVTFKNPQCPTLHFRVVGVAIDVPVWVPKPSVDLKICMYDRLYQDSVLVHTRSKAALRLKFEVCKELRAHLELLPKTGYIQAQSSYSVQLKFLPRHSLPEDAGRYFDKETRVLEAPMTIWVADQNKPVGFTVHAIVTTSDLEL-----SPSEVDFGYCTIYEAIRTEISLHNHSLLPQEFGFVRLPKFVDVQPNDGFGTILPLETLQFCVIFQPTKAEEHRFQLTCKSEINRCFKLSCRAVGVHPPLELSHYQIKFAATALYDTSVATVYVINSHLSMSSPTHSKPRIGSEDASPMGPTSFEFLLPPDSPITISPSVGTVWPGKRCLVQVAFRPVLPEKLIRQEALPLLNKEMETKSFRK---------------------------------NMAPQRKDLHGLSFSVLRAQNRDKLFKVSVPHVLEMRKRELRPSSDEYQAARATLLRAFQAKFDTFVVPCVVASGDIKDRKGSEPLSFSPHNTLYLELWCPTVAPSVVVTSHKGKTIFNFGDVAVGHRSIKKISIQNVSPEDLALDFSLLNPNGPFVLLNHSSLLRAGGTQVLVLSFSPHESILAQETLDII--TKRGTLTLTLMGTGV-ASMITCSIEGSVLNMGYVIAGESVSSGFKLQNNSLLPIKFSMHLDSLSSTRGRGQQQLPQFLSSPSQRTEVVGTQNLNGQSVFSVAPVKGVMDPGKTQDFTVTFSPDHESLYFSDKLQVVLFEKKISHQILLKGAACQHMMFVEGGDPLDV----------PVESLTAIPVFDPRHREEAEELR-PILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKK 1551          

HSP 2 Score: 206.453 bits (524), Expect = 4.789e-52
Identity = 155/592 (26.18%), Postives = 297/592 (50.17%), Query Frame = 2
Query:  269 QQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTAN-NLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSE 2029
            ++ + EL+ C      ++K+ +    EI T     N+AA+ RLQ+  +R+  E+E E+DL+      + ++E    H +++EG+L    E  +T ++        R + R  ++    + AL  +E ++    +  L TQ+   L + + +E A K H     FL+ ++ + R  + +   E  E   ++  +V  L   I   ++ L    +  ++   L  ++    +K+++ +G +    +  QR++ E+  QK       K +K +I  +I+ EE   +K+ K  P        P+     L + + + + + D  +  T+        +E     G S   E + ++              I+    ++ +++T +  PE  GLW+   DYK  +    ++  K    +KMD++I+ R + +L+  ++  Q+V  + F+G  F SKP ++ F++ ++ + Y++K+ L NT+Y+ N C+L  V E+L DF+ + F PPGPLS GM+CE  + F+P +N+DL G I F +Q+ +F++P+KC TKKC +S+D+++I F + V+GE+  + + L N G  GT       SE
Sbjct:   96 EKMRGELRACRQRRDLIDKQQEAVAAEIATEEEAGNMAAVGRLQAVSRRLFAELENERDLQSRTEAVLKESENTMWHIEIQEGRL----EAFRTADREEVEATGRRLQVRAAEQLCREQEALGKVERNRLLRIRKSLNTQKELGLRHQKLLEDARKNHKVAVRFLKASLGRIREQEKKEEMECHEYMRRRMDAVVALKGSISANRDTLRKFQAWDRAKAELAEQRVQAEKKAILAQGRDAFRHLVHQRRRQELEAQKRAFEEEQKLRKQEIISRILKEEAEEEKRKKQHP--------PTSARHRLTLRDKTWNYISDFCKKTTVPTNTYTLDYEAAAGPGPSRLLEVVSSEL-------------IQGDPGASSEEET-LAEPEISGLWNE--DYKPYQVPKEDVDRKPVGGTKMDKDILERTVERLRSRVVHKQVVWGREFQGRPFNSKPELLHFQDFDIGKVYKKKITLVNTTYTINYCKLVGVEEHLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKDLEGNISFLAQTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTNVGGLGTTFKFLPASE 659          
BLAST of Cilia-and flagella-associated protein 74 vs. UniProt
Match: sp|D4P3R7|CFA74_CHLRE (Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 6.474e-57
Identity = 158/642 (24.61%), Postives = 271/642 (42.21%), Query Frame = 2
Query: 1475 IKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSV-IGESLVQNVKLKNSGA----------------KGTNCSIKNMSEIDNETRKVV----------SREPNSA---VNIDVQTDLL---DTKPITTSLDHLKL------------WIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDL-----RVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIET---GILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSI 3241
            +  ++ +K +Q +M     + K  I  PQ    + F G +F   P ++ F++ +V       V + N SY  N  R+  +     D +   +  PG L+PG++ E  I F PK   D+   ++  + +  F +P++C TK+  +S+    + F   V +GE   +   + N GA                +    S  NM+ +                   + P SA    N+ V        DT P+    +  +L             ++ Y +    + ++P+ A          ++    K   L      ++G   DVPVY+E   +    CML  LY+D +V  +   +A+K+      E++ + E  P  GF+QAG +F   I+     ++L   C    +E     IL++ ++ S+ +Q   V F+ +A +T TDL    P      LDFG C + E     + + N   LPQ FGF G P  +   PN G+G +LP E LE  V F PP A    F +  ++L  R+FT+ C   GV P + LS+  +  P T I D   + + + N        T +             PQ+++F +P +S + + P  G + P  + +V + + P   +
Sbjct:  568 LATRALTKHEQGLMEAAKTRHKGGIGAPQTQMGRTFGGDAFLPSPAVVEFKDFDVGRTVSASVQIINRSYKKNTFRVTGIPVEYCDVLDFAYKLPGYLAPGVSGEVVISFTPKAPVDIDTSLQLLADTGPFEVPIRCRTKRAALSVSPSAVDFGAGVTLGECATRTFTIANDGALEVEFRLDSPQLSEDERALLKSTANMAHLMTSATVAAAAAAAAATASGQGPRSARSFANMGVADGAAPETDTGPLVAPREERRLAHGGFTVFPCVGHLKGYSKVTFTVTFAPVVAAPAKLLLHASYKAPAMKRLALPHHEVTLTGTGRDVPVYVERPLIDFQCCMLGHLYRDVLVVRNGGKSAMKVMVVPRPELEGFFEFSPDFGFVQAGDSFPITIRFKPTPALL-HACRKHVVEPEEEQILEIGMRLSVPDQSLPVPFTLRAQITNTDLLFQPP-----ALDFGDCVMGERTAVKLLVRNPGRLPQTFGFVGLPSGLHFTPNDGFGYVLPGEALERLVSFQPPIAGPQTFSITAKTLAGRSFTLPCRANGVAPPVVLSSNRVRMPATPIGDTRTVSVVLINK-------TDQ-------------PQSYEFAVPADSDLTLSPHVGRVPPQSRLRVQIDYSPRPPV 1183          

HSP 2 Score: 78.1814 bits (191), Expect = 6.124e-13
Identity = 59/259 (22.78%), Postives = 118/259 (45.56%), Query Frame = 2
Query: 3656 LHLELHCPSIKPDLIILSNSGKPII--------DFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEF--KELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLK-IDSPE 4399
            +HL++   ++ PDL++L+    P +        DFG     +R+ + + + N  +E   + +  ++   VF + NA+R + P A   ++VSF  +    +     L  ++ +  L +  K   I  +L+   + +     + G VL+ E   R LT+TN     + + + L+    G+ +    N      F+  P  G +A G+S  +AVSF+P      F ++++  + +Q +     +RG G    +++   D PE
Sbjct: 1422 IHLQVATCAVLPDLVLLAPPDLPYVPLHQCHCLDFGPVPVGQRVVRRLELANEGEEPLVLGAESMDSREVFGLVNALRPVRPGASFRVMVSFTPQARTEYLEVLVL--KSARTRLRLALKGAGIAPELQLGPEGVTATGLDMGDVLVGEAAARTLTVTNVCPFPLSFTMRLA----GKASAADPNPTMRQAFSCHPAEGTLAQGESCEVAVSFTPFSQRPYFEDVLQVVVPNQQDQLLVPLRGRGWREAVFVAGPDYPE 1674          
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Match: gnl|BL_ORD_ID|175003351 (tr|W5MG58|W5MG58_LEPOC Calcium channel, voltage-dependent, L type, alpha 1D subunit, b OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 498/1581 (31.50%), Postives = 827/1581 (52.31%), Query Frame = 2
Query:  278 KNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNR-AVEKA---HKKHSEFLRKTVEKERAVKNQIAQETAEKEM-------KKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTN--------VITPEFQGLWDTTI-DYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTN---------CSIKNMSE-IDNETRKV----------VSREPNSAVNID--------------VQTDLLDTKPITTSLDHLKLW------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSS--KIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIE---------------LSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETS 4789
            + ELK C   I+EL K+      +IE  + +EN AALFRL++  KR+  E++GE+DL   I   + + E +    ++E G+       L+ + +  E+  + +QE++  +  +  + A ++ E   R   K  + + +  E  +R AV +A   HKK   +L++T+       N+I Q+ AE+EM       ++  +V  L + I   +ENL A+ ++ K+    + +KE  +R+SV  +GG+    +  Q++  E+ ++K       K +K++I  KI+ EE   +K+ K   Q F                  +  K  DK    T  + ++    +         +DEE  +          S +T +     S  +DD+         +  PEF GLW+    +YKV    N   +K     KMDQEI++R L + +  I++ Q+V  + FKG  F SKP +I F++ +V + Y+++V LTN SYS N C+L  VSE+L DF+++ F PPG +S GM+C+  + F+P +N+DL G+++F SQ+  F++ +KC  KKC +++D  +I F T V+GE++ + + L N G  GT+           ++ +SE    E  K+          V R  ++   I+               +T   +  P+    D L ++      I P    ++ I ++P   GD    F I+F D   +   + V G AID+PV++    V + ICM +RLYQD+IV +SR++TAL+L F V  E++++LEILP TGFIQA   F  Q+K L R S+  +    FD ETG+L+V +   +A+Q + V F+  A++TT+DL+      KE  LDFG C+I E+   ++ L N  +LPQ+FGF G P+FI++QPN G+GT+LP ETLE+ ++FSP KA+ Y+F+L C+S I+R F +SC  +GVHP L+LS  ++ F  TA++D S   +++ N+H S+N +TH  P+IG G + P+GP +F+FI PDNS I I P+ G++ P ++  V V F P++S  +I+ EA           + K+ +SE+   K Q       P    AK+   +K S  S + K  S              +E   P  I  +S  F   K SLL  F   F+   V C +A+G  +D  +   + Y+ +N+L+LELHCP ++P L+++S++G+  ++F E    +++ + ++IQNIS++   + S++L+PNG F + NA+R LEP A+  L++SF       +     +  + +K  L +      +   +    ++ G  + G VL  E   +   + N S L V Y ++               L+S    Q  + T+N + L +F+++P  G I+ GKSQ + V+F PDH S  + + +K  + ++       ++G  +  TMY+    P ++          P E++     +E+    L T   LKS YS +  +  A     VGC+R+     KKN E+++DNL VL   GF+VDP KG +E   +K+I ++W P S   +   L  S+ +T+KG+ +
Sbjct:  104 REELKACRLRIAELGKQRDVVERDIEELKESENTAALFRLRALHKRLCSELQGEEDLESQIEMALTQNELELCQVEVELGRF----SHLRQEVQREEQALEVQQEQQAARRLRQEETAARAAELRHRLEKKRQMNSLKEREAQHRKAVVEAQQNHKKAVLYLKETM-------NRIRQKEAEEEMQSREQMERRVQAVLSLKTNIAATRENLHALQARDKARIARQKEKERLVRESVRAEGGDVTKYMHQQKQLRELERKKRAFEEQQKSRKIQIISKILQEEALLEKRKKYQAQHF-----------------PTYRKSLDKASYSTKTREKLLEYLD----LTYGEADEESYSPV--------SRKTYLMKCNGSPERDDSEEERTTEESLAVPEFTGLWEQKHKEYKVQAALN---VKMH---KMDQEILARTLEKQRSGIVRKQVVVGREFKGCPFYSKPEVIHFKDFDVGKTYKKRVTLTNVSYSINFCKLLGVSEHLKDFISVHFEPPGAMSAGMSCDMLVTFKPMINKDLDGKVQFLSQTGPFSVSLKCTIKKCELAVDNSLIDFGTHVVGETISRVITLTNRGTLGTHFILVPSSDSGPVQLVSEPFSMEPEKIRSLVTTTISPVHRWIHTVFRIEKKLVRKMSNLFLKITKTQGTEAFPVIFLCDVLSIFQVQEGEIGPLSCIKLQIIFTPTIPGDVQMAFDIRFSDPSAQPIPITVRGVAIDLPVWVAQPNVDLKICMYDRLYQDSIVVHSRSSTALRLTFVVCKELRNHLEILPKTGFIQAQSTFNVQLKFLPRHSLPDDTGACFDKETGVLEVPLMIQVADQARPVPFTVHAVVTTSDLEF---GRKE--LDFGHCSIYESVRTSVLLTNHSLLPQDFGFVGIPKFIDVQPNDGFGTLLPLETLEIDIIFSPTKAREYSFELTCKSGINRDFKLSCRAVGVHPPLELSHSLVQFGATAVNDMSTATLYVVNSHTSSNEFTHPVPRIGRGEIAPVGPTSFEFINPDNSDITITPEVGTVMPGKRCLVQVSFRPSISDEAIREEAVR---------SKKEAQSELKRGKKQ-------PNPASAKTAVKEKCSKVSVSPKICS-------------PFEPPNPRDIHPESETFAAAKASLLRSFADCFKSYTVPCFVASGETTDGKNPEHLQYSPHNTLYLELHCPIVRPPLVVVSDNGRTSVNFNEVATGQKVVRRVTIQNISQDSLDLSSSLLDPNGPFLLLNALRHLEPGAMHTLLISFSPAQGKKYYETLQI--QTKKMTLRLNLCGIGLQPTINCS-VEGGLISFGYVLEKESATQMFKLHNTSSLLVHYSLKLESLSNFTHEGLPPFLASGLQSQAPVGTQNYSGLSVFSVSPIEGAISPGKSQDITVTFQPDHESLYYSDRLKVELMNKQTVQEVQLKGAARRHTMYVSGGDPLDV----------PVESLAFLPPDEESTAVLLT---LKSVYS-ESTVPPAVRELEVGCIRSTQPMVKKNVEFALDNLPVLQQKGFSVDPVKGTVEPGQKKTITVTWAPHSGQNLTQPLCVSVPLTVKGDVT 1587          
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Match: gnl|BL_ORD_ID|167639560 (tr|A0A571BG73|A0A571BG73_MOUSE Cilia- and flagella-associated protein 74 OS=Mus musculus OX=10090 GN=Cfap74 PE=4 SV=1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 463/1607 (28.81%), Postives = 801/1607 (49.84%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVT 4795
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE   +++        + R  P             LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++  E+S+D ++ L   GF+++PS+G +E    K+INISW+PP++++    L  S L+ L+G+   T
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQR--------KRRQHP-------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRRTVEFSLDGVSWLQHKGFSIEPSRGSVERGQTKTINISWVPPADFDPDHPLMVSTLLQLRGDVKET 1610          
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Match: gnl|BL_ORD_ID|167644043 (tr|A0A571BED3|A0A571BED3_MOUSE Cilia- and flagella-associated protein 74 OS=Mus musculus OX=10090 GN=Cfap74 PE=4 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 457/1588 (28.78%), Postives = 792/1588 (49.87%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTN-RAVEKAHKKHS---EFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEE-DNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPK--TGKS--SSDEELENDFDFRNNVDNSIET----KIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT--------------------------NCSIKNMSEIDNETRKVVSREPNSAVNIDVQT------DLLDTKPITTSLDHLKLW-----------------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEF-------LANKK--WESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSK--IVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIEL------------------SSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKT----DDNNEDEKPSLNTPIILKSAY---SDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYE 4735
            +Q+ K EL +C   +  LNK+ ++   EI T +   N+AA+ RLQ+  +R+Q E+E EKDL+  I   +  +E    H ++++G+     E ++   +      +   E    ++ +  + A++  E ++   A+  L TQ+   L + + VE A + H    +FL+ ++ + R  + +   E+     ++  +V  L + I   +E L    +  ++   L  +K L  ++ ++ +GG+    +  QR+  E+  QK       K +K +I ++I+ EE +  ++K +  P                      LSK  ++  L+         TW+       GKS  +S +E E +          I+      +++   S   +D  +  P+  GLW+    Y+V K   ++  K    SKM+++I++R + QL+  ++Q Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L N +Y+ N C+L  V ENL DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+++I F T V+GE+  + + L N G  GT                           C  K + E    +      E N +  +D+Q+       L D +  T ++  + +                  I P+   ++ I ++P+  G+    F++ F++  +     R +G AIDVPV++   TV + ICM +RLYQD+I  ++R+  AL+L+F V  E++ ++E+LP TG+IQA   +  Q+K L R+S+  +   YFD  + +L+  +   +A+Q+K V F+ QAI+TT+DL+I       + ++FG CTI E     I L N  +LPQEFGF G P++++IQPN G+GTILP ETL L V+F P KAK Y F+L C+S I+R F VSC  +GVHP L+LS   + F  T++ D S   +++ N+HLS N   H  P+IG     P+GP +F+F++P NSPI I P  G++ P ++  + V F+P L    I  EA+ ++N+++E        +  +K  W+   ++++   +D    P +V                                P + EL +P  I   S +F   + +L + F   F    + C +A+G I DR +   + ++ +N+L+LEL CP++ P +++ S+ GK   +FG+     R  K I++QNI  E   +  ++LNPNG F   N   KL       LV+SF   +  + Q    +    ++  L++T     + A +    +     N G VL  E       + N S L + + + L                  +SH      + T+N N   +F+I P  G++  GK+Q   V+FSPDH S  F +++K  +F++      +++G  +   M+++   P ++          P E++      D  +++E   L  PI++   Y     D     A     VGC+RT   S ++  E+S+D ++ L   GF+++PS+G +E    K+INISW+PP++++
Sbjct:   92 IQKTKGELHICRQRMDLLNKQQESLAAEIATEKEANNMAAIGRLQAASRRLQTELENEKDLQSKITAMLKDSENAMWHIEIQKGQF----EDVRKHHEAEAEARQRGLEVHSARQLQREREAMEKSEKNRLLRARKSLHTQKELGLRHQKLVEDAQRNHRIAVKFLKASLGRVREREQKEEMESRTHMQRRMDAVLSLKNNITASRETLKKFQAWGQTRADLAKQKALTEKEVILSQGGDAFKYLFHQRRHQELEAQKRAFEEEQKLRKQEIVNRILKEEAEEEQRKRRQHP----------------------LSKPINRRTLRD-------KTWQYISDFCEGKSVLTSQQERERELLLYPKTVCVIKAISSESVQVDLGSISTEDEVLAEPDISGLWNKE-SYQVPK--EDMERKPVGGSKMEKDILARTMEQLRSGVVQKQVVSGREFKGRPFNSKPEVIHFKDFDIGKVYKKKITLINATYTINYCKLVGVEENLKDFIHIDFEPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGSFSVPLKCSTKKCSLSLDKELIDFGTYVVGETTSRIITLTNVGGLGTKFKFLPDSEFYEMDESQPAMKISSLFTCEEKIIYEKIMTSLSEQQLEVNDSSLVDLQSLKESEKQLDDPEVTTAAVSAMTMIPSEEQAEITLGEVTEGEIGPFSSVKVPITFTPVIPGEVQTKFKVMFKNPQSPPLYFRATGTAIDVPVWVPKATVDLKICMYDRLYQDSITVHTRSKAALRLKFEVCKELRGHIELLPETGYIQAQSTYSVQLKFLPRQSLPEDARKYFDPASRVLEAPMTIRVADQIKPVRFTVQAIVTTSDLEI-----NPSEINFGYCTIYEAIRTEICLSNLSLLPQEFGFVGLPKYVDIQPNDGFGTILPLETLHLDVIFQPIKAKEYKFELVCKSEINRCFKVSCQAVGVHPPLELSHYQIKFSATSLYDTSVSTLYVINSHLSMNKMIHSLPRIGSEEAAPVGPTSFEFLLPPNSPITISPSVGTVLPGKRCLIQVAFQPVLPKEIIYKEASQILNKEIETKPVSQKEIVQRKELWKQSFSVVRVHNRDR---PTRVST------------------------------PQATELQRP-VINSSSTEFQIAQATLSKAFQGKFNRFVIPCVVASGDIKDRKTAEPLSFSPHNTLYLELWCPAVAPFIVVTSHKGKTDFNFGDIAVGHRSVKKITLQNICNEDLTLEYSVLNPNGPFVRLNPFNKLRSGETQTLVLSFSPHENILAQETLDII--TKRGTLSLTLFGMGV-ASMITCSIDGNILNMGYVLARESVSTNFKLQNESSLPIKFWVRLESLSRKKAEAHQQLPKFITSHEQRAEIVGTQNYNGQSVFSIVPVEGLMFPGKAQEFTVTFSPDHESLFFSDLLKVVLFEKKVSHQILLKGAAREHMMFVEGGDPLDV----------PVESLAVVTAFDTEHKEEAEELK-PILVTLNYVQLDTDTTTSPATRELQVGCIRTTQPSPRRTVEFSLDGVSWLQHKGFSIEPSRGSVERGQTKTINISWVPPADFD 1590          
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Match: gnl|BL_ORD_ID|24141028 (tr|A0A3M6T4P1|A0A3M6T4P1_9CNID Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00005199 PE=4 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 451/1635 (27.58%), Postives = 817/1635 (49.97%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKER---AVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQE-------RIKPSKVSP-VLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQ--------NVKLKNSGAKGTNCSIKNMSEIDNETRKV----VSREPN----------------SAVNID--------------------VQTDLLDTKPITTS--------LDHLKLW------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCP-YFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGK--SLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSS-----HFYGQT-----------------NLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWP-FETMKTDDNNEDEKPSLNTP-----------------IILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFL 4822
            + QF++E K C  HI EL K+ +    EIE +    N+A+ +RLQS   ++  EI  EKD+   IL ++ +AE     + +E+GK +     L   E   E K  E+Q+      +   +N   ++   +R   +   E +    +   A ++  ++ S+FL++T+ + R   A + ++++   E  M+   ++  L   I   KENL A+ ++    +  + ++EL+ R+ +  +G NP+ E+  +RK++  A ++ Q     +E++++I + I+ EE   KK+ +  PQL+ E       RI   +  P     T  S S  Y  +   T          +  P    + S E+ E+DF           ++ + +   +  +   +  PEF+GLW+  +     K  +         SKM+QE+M R L + +  I+Q Q+ + + FKG +F SKP +I+F++ +V + Y++K++LTN SY+ N C+   +S  L DF+ + F PPG +S G+TC+F + F+P LNEDL+G I F +Q+  F++P++C+TKKC++S D   ++F + V+GE+  +        NV  ++S         + M+E   E +      +  EP                 SAV  +                    +  DL    P T S        L+ L++       I P+   ++ + ++P  +G+ +  F I F D  +    +R  G  IDVPV++E + V + +CM +RLYQD I+ N+RA +AL+L+F V  E++++LE+LP T +IQA   F AQ+K L R++ L ++CP YFD E+ +L+  +   +A+Q + V F+ +AI+T++D++  V       +DFG CT+ E+  +T+ L NK +LPQ+FGF G P+ +++QPN G+GT+LP E+ ++ ++F+  KAK Y F L C++ I R F + C  +GV P L+LS  ++    TA+ D     I + N+H S N +TH  P+IG GP+V +GP +F+F++P ++P+ + P  G+++  E+  V V F P +  + ++ EA  ++ R+         E+E   L+     E+ + +    K K    ++ +SA    K G   S   L A      +      +   SN++    L+LL  +   F    V C +A G  ++ +S +  +++N+++LE+HCP+++P L+++S+SG+ ++DF      +   K  +IQNIS E  ++ S++L+P+G F + NA+R L+P A   ++VSF    P  F     +     +  L +  K + +   +    +++G  + G  L+ +       I+N S+L++ Y ++L S     H   Q                   L   N N + +F+  P +GVI  G+S+ + +SF+PDH S  + + V                         ++I++ E   S+   G+ WP    ++  D       SL                    + +KS  + DG  +  +    +GC+++ ++  KK+ ++  DN      LGF+ +P K  ++   +K+I   W PP+ ++    ++TS ++T+K + +    + ++G +
Sbjct:   66 VSQFRDEHKKCQEHIDELQKDKELVSNEIEEAETQNNMASFYRLQSYHDKLCAEIGAEKDVEREILNRLEEAEFALAQATVEQGKFL-----LAGQELEKEEKLVEKQKAEWSAVRLRKENMSAAVAERRRRLREKERERKHRQAIA--AAKRNREQASKFLKETMSRVRQKEAEEEELSRRNMEDRMQ---AILCLKGNIEANKENLRALQARDAKLRQEKEEEELQERQEIFAEGLNPDEELT-RRKRIRQAYERRQ-----RERQVEIVENILKEEKQMKKRYQQQPQLWPEKQRERVKRISRRRPKPKFFKSTSGSSSVEYSADVEDT--------GGQHTPGKLGAVSSEDDEDDFSPYGET-----SRDEAKEGDSEAEGEELAQPEFRGLWEEGVHKASEKKEHRFKFATHIPSKMEQEMMERALMKQRAGIVQKQVAAGREFKGCAFYSKPEVIVFKDFDVGKSYKKKILLTNISYTQNYCKYVGMSHILKDFIEVFFDPPGVMSAGLTCDFAVTFKPMLNEDLVGHIDFLAQTGPFSVPIRCVTKKCQISEDVTEVEFGSQVLGETRKRIINTVTDVNVTQQDSNPTELQVPPEGMAEDAKEPQGAGVTEIPSEPGQQEGESPEKALEPRSGSAVKFEKGLATTEGEVHAPAEETGDQLDVDLTSAAPQTISSIPTETSILEGLRVGKVSSGEIAPFSLVQVEVVFNPTKSGNALAEFEISFSDPLSPPIVIRARGTGIDVPVWVEREVVDLKMCMYDRLYQDAILVNNRATSALRLKFEVCKELRNHLELLPKTAYIQAESQFSAQLKFLPRQT-LPDDCPTYFDGESRLLEAPMVVRVADQTRPVPFTVRAIVTSSDIEFNV-----QAIDFGFCTVLESVRRTVTLTNKSVLPQQFGFCGVPDTVDVQPNDGFGTLLPLESFDVDIMFNAKKAKEYEFDLTCKTGIGREFKLHCRAVGVLPPLELSHSVIKMKATAVSDTCAAHIEVINSHTSANEFTHPVPRIGSGPIVEVGPTSFEFMVPADAPLTVSPAVGTVNAGERCLVHVTFSPRMDPNMVRQEAVRMMEREA--------EAERKRLELASPPEKPQEQNTGQKKKGGKAQAGKSAKASPKRGNTPSNTNLAATTKTPTKTFTVADVIDGSNEYESAHLALLRTYQNAFSRYLVPCFVAPGRCTEPNS-LSCSVHNTIYLEVHCPAVRPHLVVVSDSGRSVVDFANVSLGRSEIKSFTIQNISDEPIKLSSSLLDPHGPFQMLNALRTLDPQATHTVIVSFGPNAPKEFHEVLEV--RCPRNTLYLRLKGRGVQPVISLS-VEDGLLDLGDALVGDTISSSFKISNTSELSITYSLKLDSLSPLRHSRAQVLPRFLPPFSEMSETQQHALGPSNYNGMAVFDCVPAQGVIGPGESKEITISFNPDHPSQLYADEVS------------------------VEINNGEQPYSVRLLGRAWPNIVYLRGWDELMPRAESLRAEVEEEEDEEGKAIQKTVLLTMKSVSTPDGY-EAVERAVEIGCIKS-SIQTKKSSDFYFDNPKEANELGFSFEPQKAGVDIGVKKNIVFRWQPPAGHDPNEPVNTSTMLTVKSDVTTQYKILLQGLI 1627          
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Match: gnl|BL_ORD_ID|27375231 (tr|A0A2Y9FZK7|A0A2Y9FZK7_TRIMA cilia- and flagella-associated protein 74 OS=Trichechus manatus latirostris OX=127582 GN=LOC101360605 PE=4 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 465/1605 (28.97%), Postives = 798/1605 (49.72%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTA-INSKRKSDKILENKKELELRKSVIEK------GGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEE-DNFKKKIKMMPQLFQERIKPSKVSPVL------GITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTAN-NLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT---------NCS---------------------------IKNMSEIDN----ETRKVVSREPNSAVNIDVQTDLLDT---KPITTSLDHLKLW------IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDR--SSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSS-------------HFY---GQTNLT-TKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLK----IDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQ--------EAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVT 4795
            +Q+ + EL+ C   I  + ++      EI   +   NIAA+ RLQ+   R+  E+E E+DL   I   + + E    H ++ EG++    + L+ +E    R+ + +  +RL KEK   + A ++     R S  +  E     +      +K HK   +FL+ ++        +I ++  ++EM+    +++    ++ +K N+TA   + RK     + + EL  +K+ +EK      GG+   ++  Q ++ E+  QK       K+++L+I  ++  EE +  K+K +++P     R+     +         G+  T+     D E          +S   K  +  ++ S E +++D     N                  ++  +  PE  GLW    DYK  +    ++  K    +KMD++I++  + +L+  ++  Q+VS + FKG  F SKP +I F++ ++ + Y++K+ L NT+Y+ N C+L  V E+L DF+ I F PPGP+S GM+CE  + F+P +N+DL G + F +Q+  F++P+KC TKKC +S+D+ +I F + V+GE+  + + L N G  GT         +C                             +N+ E +     ET K  S+EP    + + +   + T    P       ++L       I P+   ++ I ++PI  G+    F++ F++        RV G AIDVPV++    V + ICM +RLYQD+++ ++R+  AL+L+F V  E++ ++E+LP TG+IQA  ++  Q+K L R S+  +   YFD E+ +L+  +   +A+Q++ V+F+  AI+TT+DL+I       + +DFG CTI E    ++ L N  +LPQEFGF G P+F++IQPN G+GTILP E+L L V+F P KAK Y+F+L C+S I+R F +SC  +GVHP L+LS   + F  TA+ D S   +++ N+HLS N  TH  P+IG   V P+GP +F+F++P +SPI I P  G++ P ++  V V F+P L    ++ EA  +++++ E              K   KD   +   +  +S  S +  NR             +       + EL K E ++  S +F   + +L   F   F+   V C +A+G I DR  +  + ++  N+L+LEL CP++ P +++ S+ GK + +FG+     R  K ISIQNIS E   V  ++LNPNG F + N   KL       L +SF  ++  + Q    +     K+            A +    ++    N G V+  E       + N+S L + + + L S              F     +TN+  T+N N   +F++ P  GVI  G++Q   V+FSPDH S  F + ++  +FD+      +++G  +   M+++    +D P   L++       P   ++  +    E P  +    LKS       +Q         A     VGC+RT  +S KK+ E+S+D+++ L   GFTV+PS+G +E    K+I+ISW+P ++++    L  S L+ L+G+   T
Sbjct:  138 IQKTRGELRACRQRIELVTRQQAVVAAEIAQQKEANNIAAVGRLQATRSRLCTELEKERDLESNITSTLKENENAMWHIEILEGQMDAARKALREEEAAEGRRLQAQAAERLCKEKAAFRKAERNRLLRIRKSMHVQKEHGLRHQKLVEDAQKNHKIAVKFLKASL-------GRIREQEQKEEMESRKHLKRRMDAVLALKNNITANRETLRKFQAWGQARAELAEQKAQVEKEAILAQGGDAFKQLFHQHRRQELEAQKRAFEEEQKQRRLEIVSRLWKEEAEENKRKKQLLPAQTANRLTLRDKTWCYVADFCEGLATTAALYPLDTE----------YSVHPKASQLVEAISSESMQSDPGALTN-----------------PEEETLAVPEISGLWKE--DYKPYQVPKEDVDRKPVGGTKMDKDILAHTMERLRSGVVHKQVVSGREFKGCPFNSKPELIHFKDFDIGKVYKKKITLINTTYTINYCQLVGVEEHLRDFIRIDFNPPGPMSAGMSCEVLVTFKPMINKDLEGNVSFLAQTGGFSVPLKCSTKKCSLSLDKNLIDFGSYVVGETASRVITLTNIGGLGTWYKFQPTSESCEQATSLNTSSVFIYEDKNLYDKVIMPSVSENLFEANESPPMETGKTESKEPEEGCHAESEGVTMTTIMEMPQGEDEAEIQLGEVTEGEIGPFSSIKVPIIFTPIIPGEVQTKFKVVFKNPQYPTLYFRVIGIAIDVPVWVPKPNVDLKICMYDRLYQDSVLVHTRSKAALRLRFEVCKELRAHMELLPETGYIQALSSYSVQLKFLPRHSLSEDAGKYFDKESRVLEAPMTIWVADQIRPVEFTVHAIVTTSDLEI-----SPSEVDFGYCTIYEAIKTSVTLHNHALLPQEFGFVGLPKFVDIQPNDGFGTILPLESLHLDVIFQPTKAKEYSFELVCKSEINREFKLSCRAVGVHPPLELSHYQIKFAATALYDTSVTTLYVINSHLSMNSLTHSVPRIGSQDVAPVGPTSFEFLLPLDSPITISPSVGTVLPGKRCLVQVAFQPVLPEELVRQEALQVLSKEAE-------------AKPSCKDTVTQKRDLRRQSIPSMRLQNRE-----------RQFQVSTSPNPELQKQE-LKASSEEFQAAQAALARAFKGKFDKFVVPCVVASGDIKDRKETETMSFSPQNTLYLELWCPTVAPSIVVTSDKGKTVFNFGDVAVGHRSIKKISIQNISPEDLAVEFSVLNPNGPFVLLNPFNKLPMGETQVLGLSFSPRESILAQETLDII---TKRGTLTLTLLGTGVASVIVCSIEGDILNMGYVIARESVSSTFKLQNHSSLPIKFSMRLDSLSCTRREDRQQLPRFLVSDQRTNVVGTQNHNGQSVFSVVPVEGVIDPGRAQDFTVTFSPDHESLYFSDRLQVVLFDKRISHQILLKGAAREHMMFVEGGDPLDVPVESLTV------IPAFDLEHREGEPHEGPPSSEAEKLKSILVTLEYLQLDTNTPAPPATRELQVGCIRTSQLSPKKSVEFSLDSVSALQHKGFTVEPSRGFVERGQTKTISISWMPTADFDPDRPLMVSALLLLRGDVKET 1667          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Cavefish
Match: cacna1db (cilia and flagella associated protein 74 [Source:NCBI gene;Acc:103033679])

HSP 1 Score: 446.817 bits (1148), Expect = 3.033e-131
Identity = 249/749 (33.24%), Postives = 416/749 (55.54%), Query Frame = 2
Query: 2153 IEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGK-------SLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDR-SSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIE----------------LSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQV 4327
            + P+   ++ + ++P   G+   + +I F   + +   +   G A  VPV++   ++ + ICM +RLYQD+I   SRA TALK+ F V  E+K++++ILP TGFIQA  +F+AQ+K L R+S+  +    FD +TG+L+V +   +A+QV+ V F+  A++TT+DL+    D  E  +DFG C++ E+   +++L N+ +LPQ+FGF G P+FI++QPN G+GT+LP ++LE+ ++FS  KA+ YNFQL C+S I+R F +SC  IGV P L+LS  ++ F  TA+ D+S   +++ N++ S N +TH  P+IG  P+ P+GP+ F F  P+NS I + P  G + P ++  V V F P LS   I+ EAA L+ R  E    +  ES+ A      K E  +  K             R ++  + SGK       S   L        +   P  I+  S+++  GK SLL  F   F    + C ++ G I  + S + +Y+ +N+L+LELHCP+I+P L+++SN+G+  I+F + +  +++ K +++QNIS E  +++S+++  NG F + NA+R++ P     L+++F       +     +     K  L  T   + I   L     + G  N G VL  E   +  T+ N+S + V +R+                 LSSH    + L T+N +   +F++ P  G +  GK+Q + V+F PDH S  +R+ ++  + ++V
Sbjct:  786 VSPFSSVKLPVVFTPTIPGETKLDIQITFSQPECEAIMVSACGIAESVPVWVTKPSMDLRICMYDRLYQDSIEVQSRANTALKVTFEVCKEMKNHMDILPKTGFIQAKSSFRAQLKFLPRRSLPVDAKSLFDQDTGVLEVPLVIQVADQVRPVSFTVHAVVTTSDLEF---DRTE--VDFGHCSVFESVRTSVRLTNRSLLPQDFGFVGIPKFIDVQPNDGFGTLLPLQSLEIDLIFSASKAEEYNFQLTCKSGINRDFLLSCCAIGVRPLLELSDSLVEFCGTAVGDRSTAVLYVVNSYTSPNKFTHPAPRIGKNPIPPVGPRLFTFATPENSEITVSPASGRVLPGKRCLVQVSFSPLLSDEDIRAEAAQLLCRSEE---TRVLESQKANAPTANKTETQQETK-----------KGRKSSSNHGSGKQAVKERGSKTSLTPKNDSPLQPPNPAEIQNGSDEYAAGKASLLRSFKERFSRYVIPCFVSNGDIMQQESEEPIYSPHNTLYLELHCPAIRPLLVVISNNGETTINFNQVILGQKVLKRVTVQNISSETVKLKSSLMGLNGPFSVQNAMREVRPGDTHTLLLAFTPASAKKYCEKLEV--SCSKMALEFTLCGEGIKP-LVTCSPEGGVMNFGDVLEKETTTQTFTLQNSSSVPVQFRVLLDSLSNHSISRSLPAFLSSHSTPHSTLGTQNYSGQSVFSVAPAEGAVGPGKTQDITVTFQPDHKSRHYRDTLRVQLLNKV 1512          

HSP 2 Score: 182.956 bits (463), Expect = 6.717e-46
Identity = 166/617 (26.90%), Postives = 319/617 (51.70%), Query Frame = 2
Query:  278 KNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKA---HKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSK------RKSDKILENKKELELRKSVIEKGGNPNLE-VKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWE----KRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNI 2086
            + ELK C  H++EL +       EIE     EN  A+FRL+++ K + ++++ E++L   +   + + E +    ++E G+ +   ++++ DEK +  +++E+  +R+++EK + K A   +   K    K + E    +EL  R  ++A    KK + FL++T+       N++ Q+ +E+E K+   ++K       +K N+ A   K      ++  ++ E K+    +K  ++  G  ++  + LQ+ Q ++ +++E      K ++++I  K++ E D  K+K + +  L+Q    P  V      T++S  K  ++  L++I  P   +  E    +RP + + SS  ++ +  DF   + +   +K         ++   +  PEF GLW          T  ++P+K  +   M   +   +  +  +     +    K FK  +F SKP +++F++ +V + Y++K+ LTN S+STN CRL  VS+NL+DF+++ F PPGPLS GM CE +  ++P LNE+L GEI+  S +  F++P+KC  K+C M +D ++I F T V+G+++ + + L N GA GT  ++   S   N     +S+ P+    +
Sbjct:  110 REELKACRLHLAELGEVRDDLETEIEKEIQAENSVAVFRLRARHKCLCVQLQEEEELEAHLGMVLQEHELELCEVEVELGRFLSLRQQVEQDEKNFNAQKQEKHNQRVQREKNIAKGARLRVLRAKNEQEKALRE---QAELDQRRRDQALLSQKKAAVFLKQTL-------NRMRQKESEREGKRKEQMKKRMEAAASLKANIAATQEKLCVRQVKEKARLQEQKEHENHQKETLQAAGVNSIRLMHLQKAQEDLHRKQEAFQERQKARRIEIVSKLLLE-DEMKEKRQAL--LYQP--TPPHV------TQSSALKQREQRLLQSILPPSTPAEREAGLTQRPASSRVSSRSDVSSSVDF---IKDERSSKGSEAAEREGEEREYLFEPEFTGLWSRMHQDFTRTTDEHIPVKESNPWSMKTTLERSLASKAAK-----KTAGGKEFK-KAFVSKPEMVLFKDFDVGKTYKKKIKLTNVSHSTNYCRLLGVSQNLVDFISVSFEPPGPLSAGMACELEAVYKPLLNENLDGEIQLQSATGPFSVPIKCTVKRCEMVVDSRLIDFGTHVVGQTISRVITLTNRGALGTRFALAPHS--TNRLPPQLSKHPSPTTQV 694          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006006.1 (pep scaffold:Pmarinus_7.0:GL478690:18571:32696:-1 gene:ENSPMAG00000005425.1 transcript:ENSPMAT00000006006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 314.309 bits (804), Expect = 1.015e-90
Identity = 141/358 (39.39%), Postives = 224/358 (62.57%), Query Frame = 2
Query: 2165 GEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLS 3238
            G  ++ + ++P   GD    F + F D  +   ++R S  A+DVPV+++   V + IC  +RLYQD+++ ++RA TAL+L+F V  ++++YLE+LP  G+IQA   F AQ+K L R+S+  +   YFD +T +L+  +   + +Q K V F+  AI+T++DL          ++DFG CTI E+   T++L N  IL Q+FGF   PE++++QPN+G+GT+LP +T+ + ++FS  KAK Y F L C+S  +R F + C   GVHP L+LS  +L F  TA+ D S   + + N+H S N Y+H  P++G G V P+GP +FQF++P + P+ + P  G++ P +KQ V + F P LS
Sbjct:  501 GYVKLEVVFTPTVPGDTRATFHVYFTDPGSPRLEVRASALAVDVPVWVQRPNVDLKICTFDRLYQDSVLVHNRATTALRLKFEVCRQLQNYLEVLPKNGYIQAQSTFSAQLKFLPRQSMAVDAPGYFDKDTCVLEAPVLIRVGDQTKPVPFTVHAIITSSDLHF-----DREVIDFGCCTIFESVKATVKLTNDSILAQDFGFVTIPEYVDVQPNHGFGTVLPLDTVLIDIIFSATKAKEYKFDLTCKSGTNRDFQLRCVATGVHPPLELSDSLLRFRATAVGDTSVASLHVVNSHTSANQYSHPVPRVGRGDVAPVGPTSFQFVVPPDCPLSVSPAVGTVAPGQKQLVRLLFRPVLS 853          

HSP 2 Score: 181.03 bits (458), Expect = 1.111e-46
Identity = 122/395 (30.89%), Postives = 208/395 (52.66%), Query Frame = 2
Query:  833 SVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLE-IAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNS--NRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRK--VFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT 2002
            S+  L   I   KENL A+ +++ +++    ++E   R +++  GGNP  EV L+RK+LE   + K +    +K +++ I + I+ EE     ++K   +  Q R  P+  +        + ++L D   ++ +E        E   +TG        + D D  +   + +   + + T S    +++ ++I  E+ GLW+   +    KT  +  +K +     + +    VL +      +P+   R     +G SF SKPN+I F+N +V + Y+ KVVLTN SY++N CR + +SE+L D V+++F PPG +S GM+ E  + FE   NEDL GE++F +QS  F +PV+C TKKC +++DR  I F T V+GE++ +   L N GA GT
Sbjct:    3 SIMTLKQSIANNKENLRALRARQVAEQAARMQEEERERAAILASGGNPT-EVLLKRKRLEEFERTKREFEEQVKARQVDIIEHILKEE----AEMKRRSKQQQRRQHPAAATASRDAEGAAGTRLADPRVIRLLE--------EALGETGNRCRSPSPDLDGDGEHVGLSGLGETVAMATRSPGYEEEEDDLIQSEYPGLWEPEDE---QKTKRDSEVKTRPFGPSEADGGGPVLEE------KPKGQRRLGLTVQGRSFSSKPNVIAFKNFDVGKIYKLKVVLTNVSYTSNFCRYKGMSEHLEDSVSVRFKPPGQMSAGMSFELMVTFEATKNEDLNGELQFAAQSGPFTVPVQCTTKKCDVTVDRSKIDFGTHVVGETIRRTFTLVNRGALGT 375          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006010.1 (pep scaffold:Pmarinus_7.0:GL478690:25063:35984:-1 gene:ENSPMAG00000005425.1 transcript:ENSPMAT00000006010.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.037 bits (471), Expect = 6.450e-49
Identity = 160/582 (27.49%), Postives = 292/582 (50.17%), Query Frame = 2
Query:  266 LQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLE-IAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRK--VFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGT 2002
            +QQ   EL+       EL +E Q T +++  + ++ N  A+  LQ Q  R + E++ E+ L+  + + I++ +       +E G+    ++ ++  E+    ++ ER E R+  E     +A +S+E  +R  ++ M+   +        + +  ++   FLR T+ K R  + +  ++  +   ++  S+  L   I   KENL A+ +++ +++    ++E   R +++  GGNP  EV L+RK+LE   + K +    +K +++ I + I+ EE     ++K   +  Q R  P+  +        + ++L D   ++ +E        E   +TG S +   +       +  +      IK+QT         ++  E+ GLW+   +    KT  +  +K +     + +    VL +      +P+   R     +G SF SKPN+I F+N +V + Y+ KVVLTN SY++N CR + +SE+L D V+++F PPG +S GM+ E  + FE   NEDL GE++F +QS  F +PV+C TKKC +++DR  I F T V+GE++ +   L N GA GT
Sbjct:   29 IQQTGEELRGSRLREQELRREQQITQQQMRQAADSTNTVAMTLLQRQETRTKEEVDTEQALQDTLSQTISQHQLALCALDVELGRFSQVQQHVQEAERAIATQQHERAEGRIALEMAKATSAQRSVEAWERQRSQEMMALDERRRQAAEEIARNQQRARHFLRDTMAKVRQREAEEEEKVRQDNDRRLKSIMTLKQSIANNKENLRALRARQVAEQAARMQEEERERAAILASGGNPT-EVLLKRKRLEEFERTKREFEEQVKARQVDIIEHILKEE----AEMKRRSKQQQRRQHPAAATASRDAEGAAGTRLADPRVIRLLE--------EALGETGNSQAPVCVPMTHSGHSPGNAQRVLSIKVQT-------ICMLESEYPGLWEPEDE---QKTKRDSEVKTRPFGPSEADGGGPVLEE------KPKGQRRLGLTVQGRSFSSKPNVIAFKNFDVGKIYKLKVVLTNVSYTSNFCRYKGMSEHLEDSVSVRFKPPGQMSAGMSFELMVTFEATKNEDLNGELQFAAQSGPFTVPVQCTTKKCDVTVDRSKIDFGTHVVGETIRRTFTLVNRGALGT 581          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005986.1 (pep scaffold:Pmarinus_7.0:GL478690:7340:16256:-1 gene:ENSPMAG00000005408.1 transcript:ENSPMAT00000005986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 3.740e-36
Identity = 104/393 (26.46%), Postives = 190/393 (48.35%), Query Frame = 2
Query: 3689 PDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQA--ITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYG---------------QTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLK-GETSVTQSLEIR 4813
            P LI +S+SG+  +DFG+    + + K I+++NIS +  +V  ++ +P G F + NA+R + P     LV++F +     F     +        L +  +AQ   +T  +E   L     + G VL          + N+S + V + + L S   G                +++ T+N + L +F++ P +G+I  G    L V+FSPDH S R+ + ++  +F ++E+    ++G    R +YL+   P ++ +++       +E   + D     KP L T   ++S  +DDG     +  F VGCVR +  S +K GE+  D        GFTV+P +G +EA  +KS+ ++W P    +  +  S S+ ++L+ G+ +   S+ +R
Sbjct:    1 PPLICVSDSGRTTLDFGQVCIGQTVTKRITVENISHQHLKV--SLKDPLGPFTLLNALRPISPGCTHTLVLAFAALQQRQFHERLEVQAGGAVLTLTLVGRAQLPLVTCSVEEPCL-----SLGPVLSCSTASAGFKLHNDSSVPVSFLLTLDSESPGLHSSLPILPPSGGSSSSSVGTQNHSGLSVFSVQPVQGIIPVGGDTELLVTFSPDHASARYSDRLRLLLFGKIEFRVIELKGCAVKRMLYLEGGDPLDV-AVESLAPLPVWEDDGSSDVVAAVKPFLLT---MRSTQTDDGFSPVTRELF-VGCVRPVQPSSRKGGEFIFDIAEARAK-GFTVEPVRGTVEAGHKKSVRVTWSPVDGQDPWAPASASVSLSLRSGDATEAVSVLLR 380          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005992.1 (pep scaffold:Pmarinus_7.0:GL478690:7673:13929:-1 gene:ENSPMAG00000005408.1 transcript:ENSPMAT00000005992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 3.899e-21
Identity = 63/219 (28.77%), Postives = 110/219 (50.23%), Query Frame = 2
Query: 4172 TKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENM----LSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLK-GETSVTQSLEIR 4813
            T+N + L +F++ P +G+I  G    L V+FSPDH S R+ + ++  +F + E+    ++G    R +YL+   P ++    L+       +        D     KP L T   ++S  +DDG     +  F VGCVR +  S +K GE+  D        GFTV+P +G +EA  +KS+ ++W P    +  +  S S+ ++L+ G+ +   S+ +R
Sbjct:   76 TQNHSGLSVFSVQPVQGIIPVGGDTELLVTFSPDHASARYSDRLRLLLFGKKEFRVIELKGCAVKRMLYLEGGDPLDVAVESLAPLPVCTHYHHVGAARVDVVAAVKPFLLT---MRSTQTDDGFSPVTRELF-VGCVRPVQPSSRKGGEFIFDIAEARA-KGFTVEPVRGTVEAGHKKSVRVTWSPVDGQDPWAPASASVSLSLRSGDATEAVSVLLR 289          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001803.1 (pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1 gene:ENSPMAG00000001615.1 transcript:ENSPMAT00000001803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.847e-6
Identity = 58/276 (21.01%), Postives = 111/276 (40.22%), Query Frame = 2
Query: 1595 FQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPG----PLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQF 2410
            FQ  P+ I F+N E  E Y+  + L N        RL  VS+   D    K + P      ++PGM   F I F P+  +D   ++   ++ +KF +PV+ +  +  +     V+ F    +     + + ++N G +  N S+        +T +  S EP     +           I  S+             ++ + ++P   GD      I ++  ++   DL   G A+DV V ++  +V M+   +    Q +++ ++R       Q+
Sbjct:   98 FQPFPSEITFQNFEPCETYEVPLNLRNNDRVP---RLVKVSQE--DSPYFKIISPNDVGTKVAPGMASTFRIVFTPEQKKDYTHQVVCVTEREKFMVPVRAIGSRAILDFP-DVVAFSQRPVKLRSERTLLVRNVGNRHANFSL--------QTERPFSVEPVYGALV-----------IGESM-------------QVTVAFTPQTTGDHSAELWIHYDTGEDICVDLH--GAAVDVNVRLDKNSVVMERTFISMASQRSVLLSNRMDAIAHFQW 333          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Nematostella
Match: EDO49993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY5])

HSP 1 Score: 433.335 bits (1113), Expect = 4.019e-135
Identity = 227/649 (34.98%), Postives = 369/649 (56.86%), Query Frame = 2
Query: 1508 EIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKV---------------------VSREPNSAVNIDVQTDLLDT--------------------KPITT-------------SLDHL-KLWIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLE 3289
            EIM + L + +  I+Q Q+ + + FKG +F SKP +I+F++ +V + Y++KV+LTN SY+ N C+   +S  L DF+ + F PPG +S G+TC+F + F P LNE+L G+I F +Q+  F++P+KC+TKKC++S+D   + F + V+GE+  + V L NSGA GT      ++   N++  V                     V   P + V  D      DT                     P+ T             SLD +    I P+   ++ + ++P+ +G  + +F I F D  +    LR  G  IDVPV++E + V + ICM +RLYQD I+ ++RA +AL+L+F V  E++++LE+LP   +IQAG  F AQ+K L R S+L +   YFD ETG+L+  +   +A+Q + V F+ ++++T++D++  V +     LDFG CT+ E+   T+ L NK +LPQ +GF G P+ +++QPN G+GT+LP E+L++ ++F+  KAK Y F+L C+S I R F + C  +GV P L+ S  ++    TA+ D     + + N+H S N +TH  P+IG GP+V +GP +F+F++PD +P+ + P         +  + V F P L    ++ EA  ++ R+ E
Sbjct:    1 EIMEQSLMKQRAGIVQKQVAAGREFKGCAFYSKPEVIVFKDFDVGKSYRKKVLLTNISYTQNFCKYLGMSHVLKDFIEVAFDPPGVMSAGLTCDFSVTFNPMLNENLEGQIDFLAQTGPFSVPIKCMTKKCQLSVDAVEVDFGSQVVGETRKKVVVLTNSGALGTEFGFLKIT--GNQSSSVYHYYITCFECLLEGLRGDTPAVEAAPGTMVTFDEPPGSNDTPDQQEEAEAQPDESGPVAMGSPVPTEVTVMEGLRVGKVSLDSVVSGSIAPFSTVQLEVVFAPVKSGSTMADFEISFSDPLSPPIMLRGRGNGIDVPVWVERELVDLKICMYDRLYQDAILVHNRATSALRLKFEVCKELRNHLELLPKMAYIQAGSQFSAQLKFLPRLSLLEDCKEYFDPETGVLEAPMVIRVADQTRPVPFTVRSVVTSSDIEFSVKE-----LDFGFCTVYESVRHTVTLTNKSVLPQPYGFCGVPDTVDVQPNDGFGTLLPLESLDVDIIFNAKKAKEYTFELTCKSGIGREFKLPCRAVGVLPPLEFSHSVVEMKATAVGDTCSTHLEVMNSHTSANEFTHPVPRIGTGPIVDVGPTSFEFVVPDGAPLTVSPA--------RCIIHVTFTPVLDPDEVRKEAVKILEREAE 634          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Nematostella
Match: EDO49992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REY3])

HSP 1 Score: 97.0561 bits (240), Expect = 2.526e-21
Identity = 79/364 (21.70%), Postives = 155/364 (42.58%), Query Frame = 2
Query: 3848 ICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSS-----HFYGQ--------------TN---LTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPF--------------ETMKTDDN---NEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFL 4822
            + NA+R LEP A   +V+SF    P  +     +     K  L I  K + +T  +    ++ G  + G  L+N+       ++N S+L++ Y ++L S     H   Q              TN   +   N N L + +  P +G I AG+++ + V+F+PDH S+ + +                         M ++I++ E   ++   G+ WP               E++  D +   +ED+K    T ++   +YS       A+    +G +R+ +   KK+ ++  DN       GFT DP K  ++   ++ +   W+PP  ++    ++TS ++T+K + +    + ++G +
Sbjct:    1 MLNALRVLEPQATHTVVMSFGPCAPSEYHEVLEI--RCPKNTLYIRLKGKGVTPVISLS-VEGGVLDLGDALVNDTVTTTFKMSNTSELSISYNLKLDSLSPLRHSRAQVLPRFLQPYNDLAETNQHVVGPSNFNGLAVIDCVPAQGTIGAGETKEITVTFTPDHPSELYAD------------------------EMAVEINNGERAHTVKLIGRAWPHIVYVRGWDELTPCVESLVPDGDEQEDEDQKAEQKTVLLTFKSYSTPEGFLAAERILEIGSIRS-STQTKKSSDFFFDNPKEANEKGFTFDPMKAGVDIGVKRDVVCKWLPPPGHDPNEPVNTSTMLTVKADVTTQYKILLKGLI 336          
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Nematostella
Match: EDO28663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5U7])

HSP 1 Score: 83.5741 bits (205), Expect = 4.972e-17
Identity = 66/325 (20.31%), Postives = 136/325 (41.85%), Query Frame = 2
Query: 3965 KKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSS-----HFYGQT---------NLTTKNK--------NSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPF--------------ETMKTDDN---NEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFL 4822
            K  L I  K + +T  +    ++ G  + G  L+N+       ++N S+L++ Y ++L S     H   Q          +L   N+        N L + +  P +G I AG+++ + V+F+PDH S+ + +                         M + I++ E   ++   G+ WP               E++  D +   +ED+K    T ++   +YS       A+    +G +R+     KK+ ++  DN       GF+ DP K  ++   ++ +   W+PP  ++    ++TS ++T+K + +    + ++G +
Sbjct:   11 KNTLYIRLKGKGVTPVISLS-VEGGVLDLGDALVNDTVTTTFKMSNTSELSISYNLKLDSLSPLRHSRAQVLPRFLQPYNDLAETNQHVVGPSNFNGLAVIDCVPAQGTIGAGETKEITVTFTPDHPSEHYAD------------------------EMAVDINNGERAHTVKLIGRAWPHIVYVRGWDELTPCVESLVPDGDEQEDEDQKAEQKTVLLTFKSYSTPEGFLAAERILEIGSIRS-NTQTKKSSDFFFDNPKEANEKGFSFDPMKAGVDIGVKRDVVCKWLPPPGHDPNEPVNTSTMLTVKADVTTQYKILLKGLI 309          
BLAST of Cilia-and flagella-associated protein 74 vs. Planmine SMEST
Match: SMESG000043377.1 (SMESG000043377.1)

HSP 1 Score: 3110.86 bits (8064), Expect = 0.000e+0
Identity = 1592/1595 (99.81%), Postives = 1594/1595 (99.94%), Query Frame = 2
Query:   41 MTDNYESTMNNEEEYIYDNSIKXXXXXXXXXXXXXXXXTQDKETKDFDMKLRQSMINMRSILXXXXXXXXXXYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL 4825
            MTDNYESTMNNEEEYIYDNSIKDDLGLSLSESDESMELTQDKETKDFDMKLRQSMINMRSILNNIKVNVKNKYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDEKLYERKEKERQEKRLRKEKKLTKNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKF+TSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAG+CVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVH ALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAKSKKSDKKSNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL
Sbjct:    1 MTDNYESTMNNEEEYIYDNSIKDDLGLSLSESDESMELTQDKETKDFDMKLRQSMINMRSILNNIKVNVKNKYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDEKLYERKEKERQEKRLRKEKKLTKNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFDTSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAGECVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHAALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAKSKKSDKKSNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL 1595          
BLAST of Cilia-and flagella-associated protein 74 vs. Planmine SMEST
Match: SMESG000043377.1 (SMESG000043377.1)

HSP 1 Score: 3095.06 bits (8023), Expect = 0.000e+0
Identity = 1584/1587 (99.81%), Postives = 1586/1587 (99.94%), Query Frame = 2
Query:   65 MNNEEEYIYDNSIKXXXXXXXXXXXXXXXXTQDKETKDFDMKLRQSMINMRSILXXXXXXXXXXYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDXXXXXXXXXXXXXXXXXXXXXXXXNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAXXXXXXXXXNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL 4825
            MNNEEEYIYDNSIKDDLGLSLSESDESMELTQDKETKDFDMKLRQSMINMRSILNNIKVNVKNKYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDEKLYERKEKERQEKRLRKEKKLTKNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKF+TSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAG+CVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVH ALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAKSKKSDKKSNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL
Sbjct:    1 MNNEEEYIYDNSIKDDLGLSLSESDESMELTQDKETKDFDMKLRQSMINMRSILNNIKVNVKNKYEKLQQFKNELKLCDNHISELNKEGQTTLEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQDYIHSQLEEGKLVFEEEKLKTDEKLYERKEKERQEKRLRKEKKLTKNALQSLEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQIAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELELRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAEEDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKPEIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDDTNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLKENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYSTNQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEIKFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFDTSVIGESLVQNVKLKNSGAKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDHLKLWIEPYGEQEILIKWSPIFAGECVENFRIQFEDEDNKDFDLRVSGRAIDVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYLEILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSIANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLVNKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYNFQLKCQSLIDRAFTVSCTGIGVHAALDLSTCILSFPETAIDDQSKLDIFIQNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLDPNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQIKDERVEPEKVDAKSKKSDKKSNRSATDKNKSGKSLEELMAGGPDSYELVKPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVYNLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNISKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSNWSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPLTITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGKSQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKIDSPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQEAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADTEKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL 1587          
The following BLAST results are available for this feature:
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP742.487e-14932.10cilia and flagella associated protein 74 [Source:H... [more]
CFAP743.746e-12931.73cilia and flagella associated protein 74 [Source:H... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cacna1db1.208e-17227.12calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap742.975e-16534.63cilia and flagella associated protein 74 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cfap740.000e+028.81cilia and flagella associated protein 74 [Source:M... [more]
Cfap740.000e+028.78cilia and flagella associated protein 74 [Source:M... [more]
Cfap740.000e+028.47cilia and flagella associated protein 74 [Source:M... [more]
Cfap746.077e-923.70cilia and flagella associated protein 74 [Source:M... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q3UY96|CFA74_MOUSE0.000e+028.47Cilia- and flagella-associated protein 74 OS=Mus m... [more]
sp|Q9C0B2|CFA74_HUMAN1.799e-12831.73Cilia- and flagella-associated protein 74 OS=Homo ... [more]
sp|D4P3R7|CFA74_CHLRE6.474e-5724.61Cilia- and flagella-associated protein 74 OS=Chlam... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1750033510.000e+031.50tr|W5MG58|W5MG58_LEPOC Calcium channel, voltage-de... [more]
gnl|BL_ORD_ID|1676395600.000e+028.81tr|A0A571BG73|A0A571BG73_MOUSE Cilia- and flagella... [more]
gnl|BL_ORD_ID|1676440430.000e+028.78tr|A0A571BED3|A0A571BED3_MOUSE Cilia- and flagella... [more]
gnl|BL_ORD_ID|241410280.000e+027.58tr|A0A3M6T4P1|A0A3M6T4P1_9CNID Uncharacterized pro... [more]
gnl|BL_ORD_ID|273752310.000e+028.97tr|A0A2Y9FZK7|A0A2Y9FZK7_TRIMA cilia- and flagella... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cacna1db3.033e-13133.24cilia and flagella associated protein 74 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006006.11.015e-9039.39pep scaffold:Pmarinus_7.0:GL478690:18571:32696:-1 ... [more]
ENSPMAT00000006010.16.450e-4927.49pep scaffold:Pmarinus_7.0:GL478690:25063:35984:-1 ... [more]
ENSPMAT00000005986.13.740e-3626.46pep scaffold:Pmarinus_7.0:GL478690:7340:16256:-1 g... [more]
ENSPMAT00000005992.13.899e-2128.77pep scaffold:Pmarinus_7.0:GL478690:7673:13929:-1 g... [more]
ENSPMAT00000001803.11.847e-621.01pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO499934.019e-13534.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499922.526e-2121.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286634.972e-1720.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 74 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000043377.10.000e+099.81SMESG000043377.1[more]
SMESG000043377.10.000e+099.81SMESG000043377.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002606 ID=SMED30002606|Name=Cilia-and flagella-associated protein 74|organism=Schmidtea mediterranea sexual|type=transcript|length=4841bp
TAATTTTTGAAAATAATTATTTTAATTTGTTAATTAAATAATGACTGATA
ATTATGAATCTACAATGAATAACGAAGAAGAATATATATATGATAATTCT
ATAAAAGATGATTTAGGTTTATCCTTATCAGAATCAGATGAATCTATGGA
ATTAACTCAAGATAAAGAAACAAAAGATTTTGATATGAAATTAAGACAAT
CTATGATTAATATGAGAAGTATTCTCAATAATATTAAAGTGAACGTTAAA
AATAAATATGAAAAATTACAACAATTCAAAAACGAATTGAAACTCTGTGA
CAATCACATATCCGAACTGAACAAAGAAGGACAAACGACATTAGAAGAAA
TTGAAACCAGCCGAAACAATGAAAACATTGCAGCACTATTTCGGCTGCAA
AGCCAATTGAAACGAATTCAAATTGAAATTGAAGGAGAAAAAGATTTACG
AATTTTAATCCTGGAAAAAATCAACAAAGCTGAACAAGACTATATCCACA
GTCAATTGGAAGAAGGGAAATTGGTTTTCGAAGAAGAAAAACTGAAAACC
GATGAAAAACTTTACGAGAGAAAAGAAAAGGAAAGACAAGAAAAACGATT
GAGAAAAGAAAAGAAATTGACTAAAAATGCCTTGCAATCATTGGAATTTG
ATAAAAGGAATTCGGCTAAAATCATGCTAGAAACCCAACAGAATTCAGAA
CTGACAAATAGAGCCGTTGAAAAAGCTCACAAAAAACATTCAGAATTTCT
TAGAAAAACTGTCGAAAAAGAACGAGCAGTTAAAAATCAAATAGCACAAG
AAACGGCTGAAAAAGAGATGAAAAAACATATTTCAGTGCAAAAATTGAAT
TCAGAAATAGTTCAAATCAAAGAAAATCTCACAGCAATAAATTCCAAACG
AAAATCCGACAAAATATTAGAAAACAAAAAAGAACTTGAATTGAGAAAAT
CAGTCATTGAAAAAGGCGGAAATCCAAATTTGGAAGTTAAACTCCAAAGA
AAGCAATTGGAAATCGCTAAGCAAAAAGAACAACTGATGAATGCAATTAA
GGAGAAAAAATTAAAAATTGCAGACAAAATAGTAGCGGAAGAAGACAATT
TCAAGAAGAAAATAAAAATGATGCCTCAATTATTTCAAGAGAGAATAAAA
CCTTCAAAAGTTTCACCGGTGCTCGGAATAACTGAAACGTCTCTCTCTAA
ATTATATGATAAAGAACAGTTAAAAACTATTGAAAAACCAGAAATCTGGT
CAACATGGGAAAAGCGACCAAAAACTGGAAAATCAAGTTCAGATGAAGAA
TTAGAAAATGATTTCGACTTTAGGAATAATGTTGACAACTCAATAGAAAC
AAAAATAAAATTACAAACGAATTCAAACCGGAAGGATGATACGAACGTGA
TCACTCCTGAATTCCAAGGCCTATGGGACACCACAATTGACTATAAGGTG
TCAAAAACTGCCAATAATTTACCAATTAAAGCCAAAAGTGCTTCAAAAAT
GGACCAGGAAATAATGAGTAGAGTTCTTCATCAATTGAAAGAGAACATTA
TTCAGCCGCAAATTGTTAGCAGGAAAGTTTTCAAGGGTCATTCATTTCAA
AGCAAGCCTAACATAATAATGTTTGAAAATTTGGAAGTAAACGAGAAATA
TCAACAAAAAGTTGTTTTAACGAATACATCTTATTCGACGAACCAGTGCA
GATTGGAAAGTGTATCAGAAAATCTTTTAGATTTTGTAACGATCAAATTT
ATGCCTCCCGGACCTTTGTCTCCCGGAATGACCTGCGAATTTGACATTTA
TTTTGAACCCAAACTGAACGAAGACCTACTCGGTGAAATCAAATTCACCA
GTCAATCTGACAAGTTTGCAATTCCAGTGAAATGCTTAACAAAAAAGTGC
AGAATGTCAATTGATAGACAGGTGATAAAATTTGAAACTTCCGTTATTGG
GGAAAGCTTGGTGCAAAATGTGAAGTTAAAAAACTCAGGAGCAAAAGGAA
CAAACTGTTCAATCAAAAACATGTCAGAAATTGACAATGAAACTCGAAAA
GTTGTATCCCGAGAACCGAATTCGGCAGTTAATATTGACGTTCAAACAGA
CTTACTTGACACAAAACCGATAACAACTTCCTTGGACCATTTAAAACTGT
GGATCGAACCTTATGGAGAACAAGAAATCTTGATAAAGTGGTCTCCAATT
TTCGCTGGAGATTGTGTAGAAAATTTTAGAATACAATTTGAAGATGAAGA
TAACAAAGATTTCGATTTAAGAGTCTCGGGAAGAGCAATTGATGTACCGG
TGTATATAGAAGATCAAACAGTTTCTATGGATATTTGTATGCTTGAGAGA
CTCTATCAAGATACAATCGTCTTCAATAGCAGAGCGGCTACCGCTTTAAA
GCTGCAATTTCATGTTCCTTCTGAAATTAAAGATTATTTGGAGATTCTTC
CAAGCACTGGGTTCATTCAGGCTGGTCAAGCATTTAAAGCACAAATTAAA
CTTCTTGCACGAAAATCAATTCTAACAGAAAATTGTCCTTATTTTGACAT
TGAAACGGGAATTCTAGATGTTTTAATTAAAACATCTATTGCCAATCAAG
TTAAAACGGTAGATTTCAGCTTCCAGGCTATTTTAACAACGACAGACCTT
GATATAATTGTTCCTGATTCAAAAGAAAACCTCTTAGACTTTGGTCCGTG
CACAATTAAAGAGACAAAGATTCAAACTATTCAGTTGGTTAATAAATGCA
TTTTGCCTCAAGAATTTGGTTTTACCGGTTGTCCGGAATTTATCGAGATT
CAACCTAATTACGGATATGGAACGATTTTACCGCACGAAACTTTAGAACT
TAAAGTACTATTTAGTCCTCCGAAAGCGAAAAATTATAATTTCCAACTTA
AATGCCAAAGCTTAATTGATAGAGCATTTACAGTTTCGTGTACTGGTATT
GGAGTGCACCCAGCCTTAGATTTGTCGACTTGCATTCTCAGTTTCCCGGA
AACTGCAATTGATGATCAATCTAAACTTGATATTTTCATTCAAAACAATC
ACCTAAGCACCAACATATACACCCACGAGCCTCCTCAAATCGGAGACGGC
CCTGTTGTTCCAATAGGACCCCAAACGTTTCAATTTATCATTCCGGACAA
TTCACCGATTTTTATTCATCCTAAATTTGGTTCTCTTGATCCAAATGAAA
AACAAAAGGTTTCAGTGTTTTTCGAACCAAACCTTTCAATTCATTCAATA
AAAACCGAAGCCGCCACTTTGGTAAATCGAAAGCTTGAATTTTTGGCTAA
TAAAAAATGGGAAAGTGAAATCGCTATTTTAAAAGACCAAATCAAAGATG
AACGTGTAGAACCGGAGAAAGTTGATGCAAAATCGAAAAAATCGGATAAA
AAGTCCAATCGGTCGGCTACAGATAAAAATAAATCTGGTAAATCATTGGA
AGAATTAATGGCTGGAGGCCCGGATTCATATGAGTTAGTGAAACCGGAAA
GCATAGAAATCGACTCAAATGATTTTTTGAAAGGAAAACTCTCCCTGCTC
GAGAAATTTGATTTCAATTTTGAAATAGTCAATGTAAAATGTGCTATTGC
GGCCGGTCATATTTCTGACAGGAGCAGTAAAATTGTATACAATTTGTATA
ATTCCCTACATTTGGAACTCCACTGCCCATCAATCAAACCAGATTTGATA
ATTTTATCAAATTCTGGGAAACCAATTATAGATTTCGGAGAAACGGTTTG
CGAAAAAAGACTTAAAAAAATAATTTCTATTCAAAATATATCTAAAGAAT
GCTTTCAAGTAAGATCAACTATATTAAATCCAAATGGAGTTTTTCACATA
TGTAATGCTGTAAGAAAGTTAGAACCAAATGCTGTGGCAAATTTAGTCGT
TTCATTCATTTCAAAGGACCCAGGTATCTTTCAAAGTAATTGGTCGCTTT
TTGGAGAAAATCGAAAGAAAATTCTCAATATCACTTTCAAGGCTCAAGCC
ATTACTGCCGACTTAGAATTCAAAGAACTACAAAATGGTGAATTTAATTG
TGGATCAGTTTTGATCAATGAATTTAACGAAAGGCCTCTGACAATCACAA
ACAATAGTAAACTAAATGTGGATTATAGGATAGAATTGTCTTCACACTTT
TACGGTCAAACGAATTTGACAACGAAAAACAAAAATTCCCTTTGCATTTT
TAACATCACTCCAGAGAGAGGTGTGATAGCTGCAGGAAAATCTCAAACCT
TAGCAGTCAGTTTCTCACCGGATCATGTCAGTGATAGATTTCGTGAAATT
GTGAAATTTTTCATTTTTGATCAAGTTGAATATTCTAGTTTTGTAATTCG
TGGAGAGGGCAAGATCCGTACCATGTACTTAAAAATCGATAGTCCTGAAA
ACATGTTGTCTATGGACTATTTTGGTCAAACTTGGCCATTTGAAACTATG
AAAACCGACGACAACAACGAAGACGAGAAACCGTCTTTAAATACACCAAT
AATACTGAAATCGGCATATTCTGACGATGGTTTGATACAGGAAGCGAAAT
TCTGTTTTACTGTCGGATGTGTTCGAACTTTAGCTGTGAGTCAAAAAAAG
AATGGTGAATATAGCATAGATAATTTAAATGTTTTAACTCCTCTTGGTTT
CACGGTCGATCCATCGAAGGGCCAAATCGAAGCAGATACGGAAAAGTCAA
TCAATATTTCTTGGATTCCGCCTTCGAATTACGAGATCGGATCGATCCTA
TCGACTTCTATGCTGGTGACGTTGAAGGGGGAGACCTCGGTTACGCAGTC
CCTGGAGATCAGAGGATTTCTTTTATAAACGGATGTGTTTC
back to top

protein sequence of SMED30002606-orf-1

>SMED30002606-orf-1 ID=SMED30002606-orf-1|Name=SMED30002606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1596bp
MTDNYESTMNNEEEYIYDNSIKDDLGLSLSESDESMELTQDKETKDFDMK
LRQSMINMRSILNNIKVNVKNKYEKLQQFKNELKLCDNHISELNKEGQTT
LEEIETSRNNENIAALFRLQSQLKRIQIEIEGEKDLRILILEKINKAEQD
YIHSQLEEGKLVFEEEKLKTDEKLYERKEKERQEKRLRKEKKLTKNALQS
LEFDKRNSAKIMLETQQNSELTNRAVEKAHKKHSEFLRKTVEKERAVKNQ
IAQETAEKEMKKHISVQKLNSEIVQIKENLTAINSKRKSDKILENKKELE
LRKSVIEKGGNPNLEVKLQRKQLEIAKQKEQLMNAIKEKKLKIADKIVAE
EDNFKKKIKMMPQLFQERIKPSKVSPVLGITETSLSKLYDKEQLKTIEKP
EIWSTWEKRPKTGKSSSDEELENDFDFRNNVDNSIETKIKLQTNSNRKDD
TNVITPEFQGLWDTTIDYKVSKTANNLPIKAKSASKMDQEIMSRVLHQLK
ENIIQPQIVSRKVFKGHSFQSKPNIIMFENLEVNEKYQQKVVLTNTSYST
NQCRLESVSENLLDFVTIKFMPPGPLSPGMTCEFDIYFEPKLNEDLLGEI
KFTSQSDKFAIPVKCLTKKCRMSIDRQVIKFETSVIGESLVQNVKLKNSG
AKGTNCSIKNMSEIDNETRKVVSREPNSAVNIDVQTDLLDTKPITTSLDH
LKLWIEPYGEQEILIKWSPIFAGDCVENFRIQFEDEDNKDFDLRVSGRAI
DVPVYIEDQTVSMDICMLERLYQDTIVFNSRAATALKLQFHVPSEIKDYL
EILPSTGFIQAGQAFKAQIKLLARKSILTENCPYFDIETGILDVLIKTSI
ANQVKTVDFSFQAILTTTDLDIIVPDSKENLLDFGPCTIKETKIQTIQLV
NKCILPQEFGFTGCPEFIEIQPNYGYGTILPHETLELKVLFSPPKAKNYN
FQLKCQSLIDRAFTVSCTGIGVHPALDLSTCILSFPETAIDDQSKLDIFI
QNNHLSTNIYTHEPPQIGDGPVVPIGPQTFQFIIPDNSPIFIHPKFGSLD
PNEKQKVSVFFEPNLSIHSIKTEAATLVNRKLEFLANKKWESEIAILKDQ
IKDERVEPEKVDAKSKKSDKKSNRSATDKNKSGKSLEELMAGGPDSYELV
KPESIEIDSNDFLKGKLSLLEKFDFNFEIVNVKCAIAAGHISDRSSKIVY
NLYNSLHLELHCPSIKPDLIILSNSGKPIIDFGETVCEKRLKKIISIQNI
SKECFQVRSTILNPNGVFHICNAVRKLEPNAVANLVVSFISKDPGIFQSN
WSLFGENRKKILNITFKAQAITADLEFKELQNGEFNCGSVLINEFNERPL
TITNNSKLNVDYRIELSSHFYGQTNLTTKNKNSLCIFNITPERGVIAAGK
SQTLAVSFSPDHVSDRFREIVKFFIFDQVEYSSFVIRGEGKIRTMYLKID
SPENMLSMDYFGQTWPFETMKTDDNNEDEKPSLNTPIILKSAYSDDGLIQ
EAKFCFTVGCVRTLAVSQKKNGEYSIDNLNVLTPLGFTVDPSKGQIEADT
EKSINISWIPPSNYEIGSILSTSMLVTLKGETSVTQSLEIRGFLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 62..96
NoneNo IPR availableCOILSCoilCoilcoord: 266..286
NoneNo IPR availableCOILSCoilCoilcoord: 1087..1107
NoneNo IPR availableCOILSCoilCoilcoord: 311..338
NoneNo IPR availableCOILSCoilCoilcoord: 161..197
NoneNo IPR availablePFAMPF14874PapD-likecoord: 519..589
e-value: 0.0052
score: 16.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1107..1135
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1107..1137
NoneNo IPR availablePANTHERPTHR22538UNCHARACTERIZEDcoord: 30..1582
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 876..975
e-value: 3.4E-12
score: 48.5
coord: 518..616
e-value: 4.7E-6
score: 28.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 617..753
e-value: 2.9E-6
score: 29.3
coord: 1224..1322
e-value: 1.6E-5
score: 27.0
coord: 1328..1441
e-value: 3.4E-13
score: 51.6