ATPase_AAA_core domain-containing protein

Overview
NameATPase_AAA_core domain-containing protein
Smed IDSMED30002600
Uniprot Best hitNACHT and WD repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NWD2 PE=2 SV=3 (E=5.42208e-15)
Length (bp)5501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase_AAA_core domain-containing protein (SMED30002600) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase_AAA_core domain-containing protein (SMED30002600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase_AAA_core domain-containing protein (SMED30002600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase_AAA_core domain-containing protein (SMED30002600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002600

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30002600SMESG000072345.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002600SMESG000072345.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002600SMESG000072345.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002600SMESG000072345.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30002600SMESG000072345.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30002600SMESG000072345.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002600SMESG000035457.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30002600SMESG000035457.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30002600SMESG000035457.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002600SMESG000035457.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30002600SMESG000035457.1 Contig4452newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30002600SMESG000035457.1 Contig4452uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30002600SMESG000072345.1 SmedASXL_017184SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_11466_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002600SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: NWD2 (NACHT and WD repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29229])

HSP 1 Score: 105.531 bits (262), Expect = 7.592e-22
Identity = 221/976 (22.64%), Postives = 400/976 (40.98%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHF---------SILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTL---GTMSTSYVIHRSIINSIQ--------TTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLF------AAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL---YLQI----FTENLMRIIQDSCKKIFLKREFSQSSSFYE--MSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVK--TPGLIFGPIGSGKSSLLFELSEKIKGF------PSTN--LIIRRCGNTINSSSLQLLLASITQQ--------VHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKK--HYDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSN-ILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEG--KYFYQNLFDFWTSKYENGKLRPLFEK---------LSEDDLPNESSHMY----LKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKL----LSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            +R+ + A   +   ER  + E V P L++ FC E + ++F +ID Y           + Q+  +  +E C   S G   + LLG +YG +  P  +  S+F+ +L+               K       E Y  D N+    ++         S  NA+  +   +NE        Q  +  ++K    A K L   G M  S    R + ++I+           P    K +    +  K  N+ R+VK   I E      I+ T         A E+ +K     + T+  S N + V + +   D+++  + ++   Y++     F E+++ IIQ + ++ F     +++ + Y+  +   +L K+  +  E+       +   + I +NY+  +      P +I+G   +GK+ LL E+++K  G+      P ++  +I+R  G T  SS L+ LL S+ +Q        V SY  K+        + +C   F   LN+S+  + L I+ D +++L  +     + WLP  LP+ V+I+LS+  +     Q  +   H + + I  IP  D +   + +K   L + + V     +  +N A   L + + P+F +L       W      D +SL+  +   I+     LE      L    + Y+ +++ GLS  EL D+L+LDN ++  +  +    N  + P   I  L    S  ++E    N  LL+     + +   I     LQ++   +  +  L D++   +  G+ +    +         L    L  E  H        R    QP+    N         N RK+ EL + L   GK ++L   +I NF +L++ +     + ++S++       ++  N+  E  L  L      + N        LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:   41 VRVFISANPEDTGAERQALRENVYPKLRE-FCRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD----------AAIEAKLETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAENEK-----TWQEISDEIKKIFKAAVKLLHEKGKMKHSQA-KRYLFSAIEDEFDFALGKQTPAFLKKCVC---YIRKIANIERFVK---IPEMGKYMDITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSN-LRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATIQQNF----DTETDTLYDEILQHSSLCKTYASFYEY-------KCESLNIVHNYILPSKAGHINPLIIYGGPCTGKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTTDMSSDLRTLLLSVCEQLAVNYRCLVQSYPKKI--------HDLCDL-FINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLIHEEDNYIELIPR-DRKMCSQVLKHQLLRVKRKVTSG-QQIYVNNA---LSKCTLPMFVNLTFREVRHWRSHKDVDESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPSNPLRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQL---IAQKLYLQDDNDLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDI-------ELAYNYSQEKELKFLANTLRSIKNKVTAFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 954          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 74.7146 bits (182), Expect = 1.925e-12
Identity = 75/272 (27.57%), Postives = 115/272 (42.28%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L       L     +   L+ + H   +  V E Y    E  K  +  L DF++  +  G  + +        LP     + L R +  QP +  +     ++N RKL ELP+ L+  G+  EL + V+ +  ++     + GI  L+ +   C    D      V   L   R           LL TEL  RL     S+P L+ QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKR-HGVLADFFSGTWSQGTKKLI-------TLPLVGKPLNLDRKVAPQPLWFSHT----VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 74.7146 bits (182), Expect = 1.925e-12
Identity = 75/272 (27.57%), Postives = 115/272 (42.28%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L       L     +   L+ + H   +  V E Y    E  K  +  L DF++  +  G  + +        LP     + L R +  QP +  +     ++N RKL ELP+ L+  G+  EL + V+ +  ++     + GI  L+ +   C    D      V   L   R           LL TEL  RL     S+P L+ QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKR-HGVLADFFSGTWSQGTKKLI-------TLPLVGKPLNLDRKVAPQPLWFSHT----VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 74.7146 bits (182), Expect = 1.925e-12
Identity = 75/272 (27.57%), Postives = 115/272 (42.28%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L       L     +   L+ + H   +  V E Y    E  K  +  L DF++  +  G  + +        LP     + L R +  QP +  +     ++N RKL ELP+ L+  G+  EL + V+ +  ++     + GI  L+ +   C    D      V   L   R           LL TEL  RL     S+P L+ QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKR-HGVLADFFSGTWSQGTKKLI-------TLPLVGKPLNLDRKVAPQPLWFSHT----VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Match: NWD1 (NACHT and WD repeat domain containing 1 [Source:HGNC Symbol;Acc:HGNC:27619])

HSP 1 Score: 74.3294 bits (181), Expect = 2.392e-12
Identity = 75/272 (27.57%), Postives = 115/272 (42.28%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L       L     +   L+ + H   +  V E Y    E  K  +  L DF++  +  G  + +        LP     + L R +  QP +  +     ++N RKL ELP+ L+  G+  EL + V+ +  ++     + GI  L+ +   C    D      V   L   R           LL TEL  RL     S+P L+ QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKR-HGVLADFFSGTWSQGTKKLI-------TLPLVGKPLNLDRKVAPQPLWFSHT----VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Match: T05C3.2 (pep chromosome:WBcel235:V:5493747:5503010:1 gene:WBGene00020254.1 transcript:T05C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05C3.2)

HSP 1 Score: 97.4413 bits (241), Expect = 8.569e-20
Identity = 147/677 (21.71%), Postives = 283/677 (41.80%), Query Frame = 2
Query: 1274 PGLIFGPIGSGKSSLLFELSEKIKGFPSTN----LIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKIL--LSSSSDSFYQGFKKHY-DLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHY----QLLQEEGKYFYQNLFDFWTSKYENGKLRPL-FEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQ-INDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDIGLKTQ---IVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYEDPNNQGFL--VVNVDFSNIESTIKLPKKSSIKLEYI-----------SKSHLFIF 3202
            P ++ G  G GK+SL+ +++ KI+ +   +    +++R  G + +SS++  LL S+  Q+ S   +    S  +E +     F    N +   K L I+ D +D L        + W P SLP  VK+   L+      Y   ++   D    + +P +      +++   +  +  +T+ E   N  S  L + + PLF  L+      W          L   ++  I +   + E     LL  H +SY++ +R G+S SE+ D++SLD++++  + F        + P  +   +       L     +  +++   H  +    IE Y      L+       +     W      G  +P  + ++ +       +     R +  QP    +       N RKL ELP+ L+  G+ +EL    +F++E+L + +S+F +  L+++     Q + DV+ + ++ L +  LRL  + +  N  +L+ EL GRL  LV +N  +S+L    D   P+ NS    +P +         +   L+     +    L+ D + + +  +Q       I +WD  +   ++++N     NI   F       ++     Y + NNQ  +  +V  +F+ I+     P  + ++L+ I           SKSH  I+
Sbjct:  459 PIILQGENGCGKTSLMAKIATKIREWYDNSCEPVVLLRFLGTSPDSSNIAPLLTSVCDQIASNYDESLKNSSPTELSKLFQHFKKITNLATREKPLVIIFDSLDLLSRIDGAHELLWFPPSLPPFVKLFASLTPGGSLIYSKMQRLIEDKRQYLMVPSLGKDLGFQVVREWL-SDKGRTLSERQWNTVSKALDKCTLPLFVKLIYATVARWKSYSRPQETILFSSLQESINVLFHRTESQHGKLLVSHALSYISAARSGISDSEVEDLISLDDKVLDDI-FQYHLPPVRRIPPLLWSRIRSDLPGYLSERAADGVIVLNWYHQQFRQVAIERYFKNVNHLETCHSAMAEYFLGVW-----GGVPKPYQYTEMQKQRFGVTENEGLADRKVPKQPNVFSSKDGNHRYNTRKLNELPYHLLRSGRVDELLTLCLFDYEFLHAKVSSFPLQSLIADYEDAIQNVRDVEISRQLSLAVDALRLSASILSRNPSMLAFELLGRLLPLVATNKYVSKLLIKCDKEGPQHNSF---VPAHHCFHAPGGPLKFSLEEHQFAVFGMQLTSDRKLLVSTSTQ-------IIVWDVSTGDIARVVN----PNIDGVFFGLAVSENDKFAAAYTN-NNQVIVASLVTGEFTAIDPE---PFVTQMELQAIRFVGNNNVLMWSKSHYMIY 1110          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Match: CG10185 (gene:FBgn0038397 transcript:FBtr0083235)

HSP 1 Score: 117.857 bits (294), Expect = 7.491e-26
Identity = 213/929 (22.93%), Postives = 377/929 (40.58%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEH----FSILNAIDSAL-KIKNEHFPS-NFIDQHF----TSNLEKCINCAAKTLGT---MSTS-------YVIHRSIINSIQTTEPKIPTKN----LLREKFNEKYENLFRYVKKKFIQENFISYSIS--NTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFT----ENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFE-----LSEKIKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSRE---AIKLMTLSIPQNVEKTIPEAI---LNQASFVLQEN-----STPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPL-FEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLIS---NERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQIND---VKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPK 2785
            +RI   +  ++  +ER+ +     P +K Y   +  ++F ++D       +        E  + E++ CQ LS G   ++ LG +YG    P  +  S+   +   L S                  +++ ILD    +D +     S+L  I S L    N+  P     DQ       + ++K +  AA +LG    MS          V  R +IN I   +    TKN     +R   N   +NL    KK  +  + I+ S+   +  L +  RDV+  A K++ V    N        + ++     T + YL  F     +N+++++  + +K         SS+  ++ T  L+     N      I   RE        Y+   + K P ++FG  G GK+SLL +      +E        N +IR  G T +SS+L   L SI QQ+ SY+  + + +   +       F   L  ++P + L I LD VD+L  +  ++ V W+P  LP + KI++S +++         Y     V   MID  E    +  +   +  NV K   +     LN   + L  N     S P+F  L+      W          L   +   I +  +++E     +L  H ++Y+  S+ GLS SEL D++SLD++++  V +        + P  +   +     N L   + +   ++   H  +  T  E Y        YF+  + D++   +  G  +P  F ++               R +  QP   + +SK  +S   N RK  ELPF  +   +  +L+++V+FN+++L + LS+  +  ++++        D    K    +    ++L      +  N  +L+ +L GRL   +G NP I  L +  D   PK
Sbjct:   25 VRIFTSSTFTDTTMERNTLMAKCYPRIKDYCREKHGLEFQVVDMRWGVRDEATDDHMTTELCMREIKNCQRLSMGPNFIVFLGQKYGYRPIPTYIVSSELALICEELTS----------------MGVDRAILDLWYKKDSNAVPPISVLQPISSILINFNNKRVPKLQAEDQAVWWDTLNKMQKLLRKAAASLGASNKMSKEDVHNYFMSVTEREVINGILNVK---NTKNHCLSYVRYINNINLQNL----KKASLFVDIINRSLDTESAKLLSDLRDVRLPA-KIEAV----NAQKYTVEWIGREGLDIETHEEYLNHFISHFYKNVVKLVDRAMRK-------EDSSAQGQIVTEILQHLHACNNSV--KIFYGREESCERIKRYMLGDSDK-PLVLFGDGGCGKTSLLSKSVSLVATEWFAHVRPIN-VIRFLGTTPDSSALTATLISICQQI-SYNYMLPFENIPDDLVPLTAHFKQLLTYASPTQPLTIYLDSVDQLTGTQDSNKVSWIPTRLPPHCKIIISCANEPANPTVSHEYH----VLCKMIDVEENFIEVTALGEDLAMNVIKMWMKTACRDLNNYQWRLVANAISKCSLPIFVKLVFAEICRWRSYTRPQETHLANTVMDSIMLLFERVEKQHGRILVFHALAYITASKSGLSESELEDLISLDDKVLDDV-YQYHLPPTRRIPPLLWTRIRNDLPNYLSEREADGVNVMNWYHRQFRDTAKERYFKNMNMAIYFHSMIADYYLGIWGGGVPKPFKFTEIQRHRFGLADKEGSADRKVPIQPL--VFSSKDGLSKRYNLRKFGELPFHFVRSRRFKDLFEHVLFNYDWLHAKLSSCPLQAVLADFEDASSNTDDKEAKRELMLVSDALRLGGAILAIYPN--MLAPQLVGRLLPEIGGNPNIKMLLRACDRSGPK 904          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 96.2857 bits (238), Expect = 3.620e-19
Identity = 129/610 (21.15%), Postives = 260/610 (42.62%), Query Frame = 2
Query:  923 AERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKI---FLKREFSQ-SSSFYEMSTHNLRKSKTTNAEFI------NVINRNR--EREMAIFNN------------YLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRR-----------CGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSL--NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMI---DSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDIL--SRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDV 2611
            ++RD K N  K      +   +  ++R L  DL+    +   LQ     L +   D  +K    +L +   Q +S   E+ + N  ++  T+ + +       + +  +  E + A+F              + ++     P L+ GP G GK++LL +L+++++       ++               + +    LQ+  A   Q  +S+   + Y  +       +  F+ S+  + S     L ++LD +++L  ++    + W+P  +P NV+I+ S+S++   +         NI  + ++     R+ I     +  + +     +AIL       +++  PL   L+L     WS         L+   + ++  F++ LE++    L  H +S++ LSR+GLS +EL D+LSLDN ++  +    L  S    +FP +    L    S  L        LL+   H  +   V   Y L ++     +  L ++++ ++  G+LRP+        LP+ S+ +   R +  QP +        ++N RK+ ELP+ L   GK +EL + V+ + ++L       G++ ++ +L  C  + D 
Sbjct:  255 SKRDCKKNFAKFLLDVTADGLLDTQARELLTDLKQRICNTGRLQPLCMELSKGAMDPSRKEHKEYLGKLCEQVTSQLKELISRNALQTSGTSVDPVWSWLKQEIFHHAKLSEEKCAVFKGRDDILGKISITLWESNDVSHGPLLVHGPPGVGKTALLCKLAKEMRAVVDNRGVVLLRLLGTSLLSSDVDSVLRGVCLQVCGALGLQSPYSH---IAYTHEG------LVRFFHSMLEDVSKQGDTLLLILDSLEQLLETNKLHKLDWIPKIIPPNVQIVFSTSNECLDKCKSLVSAEENIFKLELLTKDQGRDVIDAYMSAAERKLTAEQQDAILR----YFEQSGNPLHLKLMLDTAKLWSSYTPMSSVHLDKSAEEVMTQFVESLEVNHGKKLVSHALSFILLSRYGLSEAELQDVLSLDNDVLAEIYKCWLPPSHTLMRFPRFHWSRLRHDLSAHLTERWEAGVLLLGFTHRQFAELVRRRY-LSRDVKADMHTILAEYFSGQWSKGQLRPIL-------LPSLSAFLNADRKVSPQPLWFSEE----LANLRKIHELPYHLAHAGKWDELRQSVLGSLDWLCCKTLQCGVSCVIQDLTLCTDLTDC 839          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-161213-1])

HSP 1 Score: 82.8037 bits (203), Expect = 4.355e-15
Identity = 145/648 (22.38%), Postives = 278/648 (42.90%), Query Frame = 2
Query: 1058 FTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVK--TPGLIFGPIGSGKSSLLFELSEKIKGF------PSTN--LIIRRCGNTINSSSLQLLLASITQQVH-SYSSKVKYCSQSSEYAVCVYEFWLSL-NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVI-EHYQLL--------QEEGKYFYQNLFDFWTSKYENGKLRPLF---------------------EKLSEDDLPNESSHMYLKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            F E+++ IIQ + ++ F     +++   Y+    +L   KT ++ ++      +   + I   YL  +     TP +++G   +GK+ LL E++++   +      P T+  +I+R  G+T  S+ L+ LL SI +Q+  +Y   + +     +    + E  ++L  +S+ ++ L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D +   + +K   L + + V     +  +N+A   + + + P+F +L+      W      D  SL   +   I+     +E           + Y+ ++R GL+  EL DILSLDN ++     DI+  +  K P+ I  + + +    LE       L+ R  H++ +      H  L+        +E+    +  L +++   +  G+ + +F                     + L   D  +   H Y  R    QP+    N         N RK+ EL + L   G+ ++L   VI NF +L++ +     +  +S++         K    ++ L   LR +  +V  N   LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:  348 FYEDMVDIIQATVQQNF----DTETDPLYDEIIQHLSLCKTFSSFYVY-----KSEALDIVQEYLYPSKGGRITPQVVYGGPCTGKTLLLAEVAKQAYSWIQKEMGPETDPVVIVRFIGSTDFSTDLRTLLQSICEQIAINYRCLIHFLPNKIQE---MRELLVNLLGESSFHRPLVIILDALEQLSDADEARKLWWLPVHLPRTVRIVVSTLPNKHGILQKLRCLIHDEEAYVELMQRDRKACSQTLKQQLLGVKRKVTSG-QQIYVNEA---MAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGSRFVFRALGYITMARAGLTELELEDILSLDNSVLG----DIMVSSNLKSPLRISYDFIARLKEELEGY-----LVERQVHNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGR-KKIFHCDNNHFASLNISQHRNPHNQQSLHGHDKASADKHSY-DRQTPEQPWVFQCNLLEPDIFFVNHRKMTELTYHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALSDIDLAYSYTQEKE---LKFLATTLRSIKLKVTKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 962          

HSP 2 Score: 53.5286 bits (127), Expect = 3.122e-6
Identity = 27/106 (25.47%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLN 487
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGIDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLIGEKYGSIRVPGEVESAEFEMILD 145          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: CU570791.3 (NACHT and WD repeat domain-containing protein 2-like [Source:NCBI gene;Acc:108179119])

HSP 1 Score: 66.2402 bits (160), Expect = 4.753e-10
Identity = 87/361 (24.10%), Postives = 161/361 (44.60%), Query Frame = 2
Query: 1526 KSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSD--SFYQGFKKHY-DLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLL-----LWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQ--LVDFDILSRNGFKFPVYIIEELLIKCSNIL--ESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLF-----EKLSEDDLPNESSHMYLKRN------IMSQPYYTINNSKTLI-SNERKLIELPFLLISYGKANELYKYVIFNFEYL 2536
            +S     L I++D +D+L  +     +  LP +L  NVK+L+S S++  +     K++Y D +    +  +D++   +L+T ++ Q   + I        +  L++ + PL+  LL      W  +      +L+ ++ + I +    +E      L    +SYL L+R+G++ +EL D+LS D+ +V+  L   + +     + P   +E LL      L   +I   + L    +H  +   V + Y   +E     +  L D+++  + NG  +        +  S  D+P    ++Y+ R       I SQP+Y     +T    N RKL  L F L+  G+  EL   +I   EYL
Sbjct:  425 RSTSKNPLVIIIDGLDQLPKTDGQPDLTCLPKALAPNVKLLISVSANRHALLAALKQYYPDSALFCELQQVDTKSCNQLLT-TLLQGSNRKITSGQQVYVNEALKKCTVPLYVELLYRQAVCWHSEFEITEETLDLEVHNSIVLIFDHMERKHGKSLVSKALSYLTLARYGMTTAELTDVLSCDDEVVESFLPQGEGVPAT-LRVPEVSVETLLSDLKGFLVQRNILGTQTLSWVNRH--FPLVVCKQYLCSEETCLKIHHVLSDYFSGSWANGTKKHFIINKDTQIQSSSDVPR---NIYIDRQVPSQPCIFSQPFYISTAMRTPTRPNLRKLHTLSFHLLKSGRIEELGSQMISQ-EYL 777          

HSP 2 Score: 55.0694 bits (131), Expect = 1.050e-6
Identity = 36/113 (31.86%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  164 MSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTS--LMLLGNEYGKLESPRSLTISQFDHVLNFLQ 496
            M+ +++ L +   +  VER +I + V P L++Y  + + +DF +ID Y+ T  KN P   +QE L + +E C   +N L S  + L+G +YG    P  +  S+F  +L   Q
Sbjct:    1 MACVQVYLCSNPEDSVVERTLIRQKVFPRLREYCRSTYGLDFRVIDPYEATKPKNWPT--QQERLRI-LEDC--WNNSLHSFFVGLVGEQYGDACLPEQVEASEFQLILQVCQ 108          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-212k18.6 (si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530-938])

HSP 1 Score: 53.5286 bits (127), Expect = 3.145e-6
Identity = 96/457 (21.01%), Postives = 197/457 (43.11%), Query Frame = 2
Query: 1280 LIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRRC--GNTINSSSLQLLLASITQQVHS-YSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQEN---STPLFFSLLL-----WS-------LDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRI-VQLVDFDILSRNGFKF---PVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSEL 2584
            LI G  GSGKS+ L +L++ I  +   ++ +  C  G T +S +++LLL ++  Q+ + YS + +     SE +  +      + +  P   L +LLD +D L      D+  WL   L  +V I++S+S+ S    F +     +++++P +   E    +T ++   +     +   NQ + + Q      +PL+ +L       WS       L++  DPN L  ++   ++       +    LL       ++LSR G++  EL+ +L  D  +  ++      +  G K+   P   +  LL    + +  ++++   ++R  H  +   V++ Y   ++  K  + +  D++     N ++   F+ L+           ++++             +  + N RKL  LP+  I  G+   L    +FN+E+L   L    I ++  +L
Sbjct:  671 LIVGEPGSGKSTTLAKLAQLIPTWIPGDVKVLACFVGLTSDSRNVRLLLQTLCLQLSNIYSLQTEISESLSELSSDLCSLLGLVTEERP---LTLLLDGLDNLSEEHEADL-SWLSDILLPHVFIVVSASTHSKCAHFLQSQVKVSVLSLPALHHEE----ITSALASRLSSDSRQLTENQWTLLSQSCLSCPSPLYLNLAYAESKQWSSFTPENNLNIPKDPNQLFINVLVSLEREYGSCLVRRLALL-------ISLSRSGIAEEELLVLLGCDGHVKREMASLHHQTLPGSKYSPVPYAFVAGLLYSLRDYMTEVESDDTWVLRWTHMEFCCVVLQRYAPTEDSVKAVHADFADYFNGSAPNSQV---FQPLA-----------WIRKE---------RGRRCYVFNLRKLHCLPYHYIHSGQIIPLLTECLFNYEFLLHKLWGLSIYHVQEDL 1089          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: ppp1r3c.1 (protein phosphatase 1, regulatory (inhibitor) subunit 3C, gene 1 [Source:Xenbase;Acc:XB-GENE-969181])

HSP 1 Score: 78.1814 bits (191), Expect = 1.640e-13
Identity = 88/361 (24.38%), Postives = 152/361 (42.11%), Query Frame = 2
Query: 1547 LFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKHY-DLSNIVNIPMIDSREA---IKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVD----FDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSEL 2584
            L +  D +D+L PS     + WLP   P NV I++S+        +  K    D    + +  + + +    I+++  S  + +     E +L   SF  ++   PL   L       WS         +    K  + +  + LE     LL  H + Y+  SR GLS +EL DILSLD+ +  L D    +   S +  +FP      L       L   Q +   ++ L H  +I    + Y L   E    +  L D++  K+  G  RP+        LP  +  +   R + SQP +  +N    + N RK+ ELP+ L++ G  +EL   ++ N +++ S + + GI  ++ + 
Sbjct:  424 LVLFFDSLDQLSPSEGAHRLHWLPKECPANVCIVVSTLPEEGGILKTLKDSVTDPECYIEVKPLSAEQGSQMIEMLMASAGRRLTNDQQEIVL--GSF--RKCGQPLLLKLAFDEAKRWSSYTPITELMIATSTKEAVSLLYQCLEQLHGKLLVSHALGYIVASRSGLSEAELKDILSLDDEV--LADIYQYWAPPSNDLIRFPTLPWTRLRNDLEGYLVERQADGSTVLGLYHRQFIEVARDTY-LTNTEKSNRHGTLADYFMGKWSMGTKRPIL-------LPLINKSLNADRKVASQPLWFSDN----MPNRRKMSELPYHLLNAGCIDELQGEILGNMDWISSKIVSCGIQSVIKDF 766          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000022477.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460486.1:142089:157740:1 gene:ENSXETG00000010819.1 transcript:ENSXETT00000022477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 2.815e-10
Identity = 86/365 (23.56%), Postives = 153/365 (41.92%), Query Frame = 2
Query: 1529 SNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSI-PQNVE--KTIPEAILN--------QASFV---LQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNES--------SHMYLKRNIMSQPYY---TINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEY 2533
            S+    L +++DDVD +        + WLP  +PK  KI++S           KH    N+++   + S+   + + L I PQ  E    +   +L         Q  +V   L+ N++PL   LL      W      D  +L  D     +    KLE+     +   T+SY+ LS+ G+ ++ELVD+L+ D+ +++       + N  + P +I+  +L+     L    +    L+   + +Y   ++  Y    E  +  +  ++ F++ ++  GK      +  +  LPN          +  YL     SQP++        + +  N RK +ELPF L   GK  +LY  V   F Y
Sbjct:  443 SSKQAPLILIIDDVDHV-------PIDWLPSPIPKFTKIIVSV----------KHQQ--NVIS-DQVKSQNKGQFLFLEIKPQRRECNDNLKHCLLGCYRKITSGQQMYVNRSLETNTSPLQVHLLFKLVAEWKSHQDVDNQTLGEDTYEAAERLFHKLEIKYGREIVSRTLSYITLSQSGIGVTELVDLLTADDLVLEKFHELFGTENIPRIPDWIVTGILLDLQGCLADRMSAGCKLVYWNNRMYQQVIMTRYLSSPETVQELHTAMYYFFSGRWTCGKFISKAVQKFKSLLPNRRLANNNHTPNRHYLDYQPPSQPWFYNVLPVCQRAVTGNVRKALELPFHLKECGKLEKLYNEVFMAFPY 787          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: hsp90ab1 (heat shock protein 90kDa alpha family class B member 1 [Source:Xenbase;Acc:XB-GENE-495311])

HSP 1 Score: 62.7734 bits (151), Expect = 6.363e-9
Identity = 96/383 (25.07%), Postives = 178/383 (46.48%), Query Frame = 2
Query: 1058 FTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKT--PGLIFGPIGSGKSSLLFELSEKIKGF------PSTN--LIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVC-VYEFWLSL-NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKK--HYDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEEL 2134
            F E+++ IIQ + ++ F     +++   Y+    +L   KT  + +       R   + + N YL         P +I+G   +GK+ LL E+++K   +      P ++  +I+R  G+T  SS+L  LL SI +Q+   +   +   QS    +  ++E +L+L N+S+ ++ L I+LD V++L  S     + WLP  LP+ V+I++S+  +     Q  +   H + S I  IP  D +   + +K   L + + V     +  +N+A     + + P+F +L       W      D ++L   +   I+     LE    P      + Y+ ++  GLS  EL DIL+LDN ++  V  ++      + P  +I +L
Sbjct:  345 FYEDMIDIIQATVQQNFE----TETDPLYDEILQHLSLCKTYASFY-----EYRCEALNLVNKYLRPCRSGHIYPLIIYGGPCTGKTLLLAEVAKKACSWLQEEMGPDSDPVVIVRFLGSTDMSSALNCLLQSICEQL---AVNYRCLLQSRPKKILNLHELFLNLLNESSFHRPLVIILDGVEQLSDSDDARKLWWLPVHLPRTVRIIISTLPNKHGILQKLRCLIHNEDSYIELIPR-DKKMCSQILKHQLLRVKRKVTSG-QQIYVNEA---FSKCTLPMFVNLTFREVRNWRSHKDVDGSTLCVTVHRNIEQLFWSLENKCGPRFVSRALGYITMATTGLSEVELEDILALDNTVMSEVLSNMKPYIPLRIPYIMIAQL 710          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000003639.1 (uncharacterized LOC101730828 [Source:NCBI gene;Acc:101730828])

HSP 1 Score: 55.8398 bits (133), Expect = 9.498e-7
Identity = 43/160 (26.88%), Postives = 82/160 (51.25%), Query Frame = 2
Query: 1280 LIFGPIGSGKSSLLFELSEKIKGFPSTNL--IIRRCGNTINSSSLQLLLASITQQVHS-YSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLS---NIVNIPMIDSRE 1741
            ++ G  GSGKSS++ +++     +   ++  + R  G T  S + ++LL S+  Q+   Y+  + +   S +    + EF   L  +N  + L + +D +D L  S H D + W+P  LP++V  ++ +S++S    F+    L+   N+  IP +DS E
Sbjct:   23 VVHGESGSGKSSIIAKIATLASQWIGRDIRVVTRFIGRTGESRNPRMLLYSLCFQIAEIYNITMDF---SEDLKGLINEFSTLLEFANKCRPLMVAVDGIDEL--SVHEDSLSWIPRVLPRHVYFIVCASTESACSSFRTLQKLTMQQNVHQIPPLDSEE 177          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 85.5001 bits (210), Expect = 6.457e-16
Identity = 124/520 (23.85%), Postives = 220/520 (42.31%), Query Frame = 2
Query: 1271 TPGLIFGPIGSGKSSLLFELSEKIKGFPS--TNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPS---SHTDMVKWLPHSLPKNVKILLSSSSDS-----FYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCR-QINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            TP ++FGP G GK+SL+ +L++++       T +++R  G +  S   + LL S++ QV          +Q  E    V  F+ +L  +   +    L+  +D +       H+  V WLP   P  V ++LS+ S         Q  K       +  +     +E I+L+ L+  + +       +L  +   L E   P    L       W+   +  P +   +  +       +       LL  H + Y+  SR+GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L     + L     +  +L+ + H   ++ VI+   L   E    +  L +F++  +  G      +KL    LP     + L R +  QP +      + ++N RKL ELPF L+  G+  EL + V+ N  ++     + GI  L+ +   C   +N  + +   E + +    +    +  + +L TEL  RL     S+P +I QL Q   S
Sbjct:  336 TPLVLFGPPGIGKTSLMCKLAQQVPELLGHKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLPPAQVLEAHSRVGHFFHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPSTYWEVKALSGSQGQEFIQLL-LAAEKRMLSPGQRDVLWAS---LPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGA--LLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHR-QLSQVIQVRYLSGPERAKRHGVLAEFFSGAWSQG-----IKKLI--TLPLVGKPLNLDRKVAPQPLWF----SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKS-VLYTELLARLLFFAASHPAMIGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 85.5001 bits (210), Expect = 6.908e-16
Identity = 124/520 (23.85%), Postives = 220/520 (42.31%), Query Frame = 2
Query: 1271 TPGLIFGPIGSGKSSLLFELSEKIKGFPS--TNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPS---SHTDMVKWLPHSLPKNVKILLSSSSDS-----FYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCR-QINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            TP ++FGP G GK+SL+ +L++++       T +++R  G +  S   + LL S++ QV          +Q  E    V  F+ +L  +   +    L+  +D +       H+  V WLP   P  V ++LS+ S         Q  K       +  +     +E I+L+ L+  + +       +L  +   L E   P    L       W+   +  P +   +  +       +       LL  H + Y+  SR+GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L     + L     +  +L+ + H   ++ VI+   L   E    +  L +F++  +  G      +KL    LP     + L R +  QP +      + ++N RKL ELPF L+  G+  EL + V+ N  ++     + GI  L+ +   C   +N  + +   E + +    +    +  + +L TEL  RL     S+P +I QL Q   S
Sbjct:  336 TPLVLFGPPGIGKTSLMCKLAQQVPELLGHKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLPPAQVLEAHSRVGHFFHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPSTYWEVKALSGSQGQEFIQLL-LAAEKRMLSPGQRDVLWAS---LPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGA--LLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHR-QLSQVIQVRYLSGPERAKRHGVLAEFFSGAWSQG-----IKKLI--TLPLVGKPLNLDRKVAPQPLWF----SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKS-VLYTELLARLLFFAASHPAMIGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 85.5001 bits (210), Expect = 7.388e-16
Identity = 124/520 (23.85%), Postives = 220/520 (42.31%), Query Frame = 2
Query: 1271 TPGLIFGPIGSGKSSLLFELSEKIKGFPS--TNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPS---SHTDMVKWLPHSLPKNVKILLSSSSDS-----FYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCR-QINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            TP ++FGP G GK+SL+ +L++++       T +++R  G +  S   + LL S++ QV          +Q  E    V  F+ +L  +   +    L+  +D +       H+  V WLP   P  V ++LS+ S         Q  K       +  +     +E I+L+ L+  + +       +L  +   L E   P    L       W+   +  P +   +  +       +       LL  H + Y+  SR+GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L     + L     +  +L+ + H   ++ VI+   L   E    +  L +F++  +  G      +KL    LP     + L R +  QP +      + ++N RKL ELPF L+  G+  EL + V+ N  ++     + GI  L+ +   C   +N  + +   E + +    +    +  + +L TEL  RL     S+P +I QL Q   S
Sbjct:  377 TPLVLFGPPGIGKTSLMCKLAQQVPELLGHKTVVVLRLLGTSKLSLDARSLLRSLSFQVCLAYGLPLPPAQVLEAHSRVGHFFHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLPLKCPPRVHLILSTCSGQQVLHNLQQTLKDPSTYWEVKALSGSQGQEFIQLL-LAAEKRMLSPGQRDVLWAS---LPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGA--LLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHR-QLSQVIQVRYLSGPERAKRHGVLAEFFSGAWSQG-----IKKLI--TLPLVGKPLNLDRKVAPQPLWF----SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKS-VLYTELLARLLFFAASHPAMIGQLCQQAQS 877          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Match: Nwd2 (NACHT and WD repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:1920464])

HSP 1 Score: 81.6481 bits (200), Expect = 9.792e-15
Identity = 161/722 (22.30%), Postives = 306/722 (42.38%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKI----------KNEHFPSNFID-----QHFTSNLEKCINCAAKTL---GTMSTSYVIHRSIINSIQ--------TTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLF------AAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL---YLQI----FTENLMRIIQDSCKKIFLKREFSQSSSFYE--MSTHNLRKSKTTNAEFINVINRNREREMAIFNNYL--TSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGF------PSTN--LIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYE----FWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKK--HYDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEEL 2134
            +R+ + A   +   ER  + E V P L++ FC E + ++F +ID Y           + Q+  +  +E+C   S G   + LLG +YG +  P  +  S+F+ +L+                     KLE  +L++    DE     N++ +A  +          KN   PS   +     Q  +  ++     A K L   G M  S    R + ++I+           P    K +    +  K  N+ R+VK   I E      I+ T         A E+ +K     + T+  S N + V + +   D+++  + ++   Y++     F E+++ IIQ + ++ F     +++ + Y+  +   +L K+  +  E+       +   + I + Y+  + T    P +++G   +GK+ LL E+++K  G+      P ++  +I+R  G T  S  L+ LL S+ +Q+      V Y      +   +++    F   LN+S+  + L I+LD +++L  +     + WLP  LP+ V+I+LS+  +     Q  +   H + + I  IP  D +   + +K   L + + V  T  + I    +F   + + P+F +L       W      D +SL   +   I+     LE      L    + Y+ +++ GLS  EL D+L+LDN ++  ++ +    N  + P   I  L
Sbjct:   41 VRVFISANPEDTGAERQALRETVYPKLRE-FCRENYGLEFQVIDLYWGIEEDEWDSPELQKMRMKLLEECLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD----------------AAVEAKLETKLLEDWYCRDE-----NSVPAAYYLRPRLEVPRSNKNSTQPSASSEQERPWQEISDEIKTIFKAAVKLLHEQGKMKQSQA-KRYLFSAIEDEFDFALGKQTPAFLKKCVC---YIRKIANIERFVK---IPEMGKYMDITGTDPRIVRDPEAQEKLIKLRDEFIPTIVASSN-LRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATVQQNF----DTETDTLYDEILQHSSLCKTYASFYEY-------KCESLNILHKYILPSKTGHINPLVVYGGPCTGKTLLLAEVAKKAYGWLHEDTGPDSDPVVIVRFLGTTDMSIDLRTLLLSVCEQL-----AVNYRCLVQSFPKKIHDLRDLFINLLNESSLQRPLVIILDALEQLSEADEARKLWWLPAHLPRFVRIILSTLPNKHGILQKLRCLIHEEDNYIELIPR-DRKMCSQVLKHQLLRVKRKV--TSGQQIYVNNAF--SKCTLPMFVNLTFREVRHWRSHKDVDESSLCVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMNELNENTRPSNPLRVPYLYIARL 711          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt
Match: sp|Q9ULI1|NWD2_HUMAN (NACHT and WD repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NWD2 PE=2 SV=3)

HSP 1 Score: 85.5001 bits (210), Expect = 5.422e-15
Identity = 208/922 (22.56%), Postives = 374/922 (40.56%), Query Frame = 2
Query:  332 PKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHF---------SILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTL---GTMSTSYVIHRSIINSIQ--------TTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLF------AAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL---YLQI----FTENLMRIIQDSCKKIFLKREFSQSSSFYE--MSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVK--TPGLIFGPIGSGKSSLLFELSEKIKGF------PSTN--LIIRRCGNTINSSSLQLLLASITQQ--------VHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKK--HYDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSN-ILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEG--KYFYQNLFDFWTSKYENGKLRPLFEK---------LSEDDLPNESSHMY----LKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKL----LSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            P+  K    L+E   C   S G   + LLG +YG +  P  +  S+F+ +L+               K       E Y  D N+    ++         S  NA+  +   +NE        Q  +  ++K    A K L   G M  S    R + ++I+           P    K +    +  K  N+ R+VK   I E      I+ T         A E+ +K     + T+  S N + V + +   D+++  + ++   Y++     F E+++ IIQ + ++ F     +++ + Y+  +   +L K+  +  E+       +   + I +NY+  +      P +I+G   +GK+ LL E+++K  G+      P ++  +I+R  G T  SS L+ LL S+ +Q        V SY  K+        + +C   F   LN+S+  + L I+ D +++L  +     + WLP  LP+ V+I+LS+  +     Q  +   H + + I  IP  D +   + +K   L + + V     +  +N A   L + + P+F +L       W      D +SL+  +   I+     LE      L    + Y+ +++ GLS  EL D+L+LDN ++  +  +    N  + P   I  L    S  ++E    N  LL+     + +   I     LQ++   +  +  L D++   +  G+ +    +         L    L  E  H        R    QP+    N         N RK+ EL + L   GK ++L   +I NF +L++ +     + ++S++       ++  N+  E  L  L      + N        LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:   96 PELQKTRMKLLE--NCLKTSAGPCFVGLLGEKYGNIRIPGEVEASEFEMILD----------AAIEAKLETKLLEEWYCRDENSVPAAYYLRPKSEMLRSNRNAMQPSTNAENEK-----TWQEISDEIKKIFKAAVKLLHEKGKMKHSQA-KRYLFSAIEDEFDFALGKQTPAFLKKCVC---YIRKIANIERFVK---IPEMGKYMDITGTEPRIIRDPEAQEKLIKLRDEFIPTIVASSN-LRVYTSVTHCDMKLGYSQEIENHYIEGLGKQFYEDMIDIIQATIQQNF----DTETDTLYDEILQHSSLCKTYASFYEY-------KCESLNIVHNYILPSKAGHINPLIIYGGPCTGKTLLLAEVAKKAYGWLHEDTGPESDPVVIVRFLGTTDMSSDLRTLLLSVCEQLAVNYRCLVQSYPKKI--------HDLCDL-FINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHLPRFVRIVLSTLPNKHGILQKLRCLIHEEDNYIELIPR-DRKMCSQVLKHQLLRVKRKVTSG-QQIYVNNA---LSKCTLPMFVNLTFREVRHWRSHKDVDESSLSVTVHESIEQLFWSLEKKCGQKLVSRALGYITMAKMGLSEMELEDVLALDNSVMSELKENTRPSNPLRVPYLYIARLKEGLSGYLIERHVKNVTLLVWANRHLQL---IAQKLYLQDDNDLREMHTILADYFLGVWSGGRRKAFCLEDPYLNGCLDLENRSLLEEEKHFMEQASFDRQAPDQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDI-------ELAYNYSQEKELKFLANTLRSIKNKVTAFPGSLSAELQQRLLPVVSSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 954          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt
Match: sp|A6H603|NWD1_MOUSE (NACHT domain- and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Nwd1 PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 3.942e-13
Identity = 74/273 (27.11%), Postives = 126/273 (46.15%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCR-QINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR+GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L     + L     +  +L+ + H   ++ VI+   L   E    +  L +F++  +  G      +KL    LP     + L R +  QP +      + ++N RKL ELPF L+  G+  EL + V+ N  ++     + GI  L+ +   C   +N  + +   E + +    +    +  + +L TEL  RL     S+P +I QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPPSKELLRFPPLLWVRLRRDLGHCLVRRPVDGCMLLAIAHR-QLSQVIQVRYLSGPERAKRHGVLAEFFSGAWSQG-----IKKLI--TLPLVGKPLNLDRKVAPQPLWF----SSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWISCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKS-VLYTELLARLLFFAASHPAMIGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt
Match: sp|Q149M9|NWD1_HUMAN (NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 1.149e-11
Identity = 75/272 (27.57%), Postives = 115/272 (42.28%), Query Frame = 2
Query: 1967 LLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNP-LISQLHQHVDS 2773
            LL  H + Y+  SR GLS +EL D+LSLD+ ++Q V  D+   S+   +FP  +   L       L     +   L+ + H   +  V E Y    E  K  +  L DF++  +  G  + +        LP     + L R +  QP +  +     ++N RKL ELP+ L+  G+  EL + V+ +  ++     + GI  L+ +   C    D      V   L   R           LL TEL  RL     S+P L+ QL Q   S
Sbjct:  577 LLVAHVLGYIVSSRHGLSEAELKDVLSLDDEVLQDVYRDWTPPSKELLRFPPLLWVRLRRDLGYYLARRPVDGFTLLAIAHRQLVEVVRERYLSGSERAKR-HGVLADFFSGTWSQGTKKLI-------TLPLVGKPLNLDRKVAPQPLWFSHT----VANLRKLKELPYHLLHSGRLEELKQEVLGSMSWISCRGISGGIEDLLDDFDLCAPHLDSPEVGLVREALQLCRPAVELRGMERSLLYTELLARLHFFATSHPALVGQLCQQAQS 836          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18218540 (tr|A0A267FTZ9|A0A267FTZ9_9PLAT AAA_16 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011309g4 PE=4 SV=1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 539/1789 (30.13%), Postives = 919/1789 (51.37%), Query Frame = 2
Query:  170 EIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLE---KCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKF-------NEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLII--RRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTI-SYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDI-GLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYE----DPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYV----KNEPLKVMNLSNGT-NYSIEMDEYPDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRN--DYRKPEIPGENYFFGD--------DKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEES---LVTGRAIL---------TSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIR---MTSKPMSEVPYKSNLDR 5392
            E+R+ L + E EF+VE+ I+  +VTP L+K+    F+ DF +ID  Q+++   LPK   ++  L + + C   S+G  +L+L+G ++G  + P  L+  +F   LN L+ +ND  W  F   + K   L   +        E         ++  + +     + +D  F   +E   K +    K +        + + +     T +P++  + L  + F       NEK + L     ++  +EN++ +SIS+  L   +   +  +N +  +         ++ L +KD++ ++    YL IF +     +++   K   + EF       E+ TH    S     + +     +R+RE+ I  NY+ S + + PGL++G  GSGK+ ++ +L +++      NL+I  R CG T  S +LQ ++AS+TQ+++ ++ +    + S EYA  VY+F  +L      KQL I+LDD+D LYP SHT++ +WLPH LP NVK+L+++ S+SF   FK+ +D S+ + +  +    AIK    SI     KTI +     A+ +LQ NS PL+  +L    DV+        D   LI +   +       L  + +I SY++ SRFGLSL EL D+LSLDN +     FD    N ++ P+ II   L      L  +Q + RL+    H +  + V ++YQL +E G    Q L ++W+ ++   K +PLFEK   D   +ES  + + R  + Q +       + +SN RKL EL + L+   K ++LY+  +FNF+YL++ L+ F +N L+SE YF RQ  +V+ N EVE+L+  LRLL   +  +  L+  EL+GRLCHL GS  LI+ L Q +DS   +VN +   +P++  ++++  +V + G  +  +  ALSPDNRF++T+    +  E  + +WD +SATKSQI+NLG     KF  + YMPQ DE +LL Y+    D +  G+L +N+  +  ++ ++       K+ Y++KS++ + V+ +++V                WP +++PNDKY+I PK   K D S+  +  NLR++N  +G+ VC L  +  S  LL N R E +F+  K+ G++ +Y+I Q  K+D+KKL  S +  +  Q  L    + L  KY  +     + LS+DEKYL+ +YN+ND   +  +WSL+ K+         + +  FS D   +Y +V     +  +++ N S+G     + +    + +Y+++     +V  N + +++LKS + +        E     +  +L  P   ++  +L+ N  N   F + +L + +  + D++H +E +  F   + ++PDGEKLLL+F  +  ++     D     F  + D  G  ++     + RKPE+P  NYF G              K      D Y QK++++ +  T Q + Q+S+TGE +  +T  +LLT KPD++S TR + EA DI+S Y +  G+F+   Y+E+ +I S L+ +    L+I CG+NG+ +K LGG+ F  V  E D+  LLK  DE+AR   +  + V  E+ N + +Q+         V  + EI YAK+D+ K  ++   ST   I D++ DG + ID  L +Y+ ++G  L++L  S   ++   L      FI D S +  LD  +  L I+ N+  +    V GR+IL          +    +  ++ F++ +G  G+  +V+ + EFKVF +R   +  K ++E  Y    DR
Sbjct:    9 EVRVFLFSNEGEFEVEKSILQNVVTPQLRKFCIETFSTDFLLIDPLQSSAGVKLPKRSSRD-CLRDSDDCFDTSDGPAALVLVGEKFGNSKLPPQLSEPEFAAFLNGLKKKNDPLWTSFQKLYAKQSDLSYKLQGAAPDLAESLRQRLPQVASEAVGDGTLTQDQVDALFVPPVEHYLKYLRTDKKPIDQCIAFARVLKDVREWGATEDPELKEQFLDLDAFGRFSQSSNEKVQQLREEFLQRLPKENYVRFSISSAMLSEYKLVQRNKSNVVSKL--------AETPLASKDMKATT----YLTIFAKQTFEKLKNHVMKFCGRHEFLALPLPMEIETH----SAVLAGQRVRPPVFSRDRELKILQNYVASKS-QLPGLLYGDHGSGKTVIIKQLIDQVT---DDNLVIIKRCCGRTTLSCTLQQIIASVTQEIYFHARR--QFAPSCEYAQVVYDFTRALQLPGFKKQLLIVLDDIDLLYPQSHTELFRWLPHRLPANVKVLVTAGSESFLTNFKRRFDDSSSLTLTGVVPSAAIKEFP-SILAAKGKTIGDKNRELANSLLQNNSYPLYTIILA---DVLPCREDKLPDRVKLIFMKRLEQLEQKHGLWVVRSILSYISCSRFGLSLPELQDVLSLDNSVAVDSGFDAKHSNFYRVPMGIITAFLDDVELYLIRVQLDDRLVYTWAHDVLRSAVTDYYQLNKEFGVQVSQQLAEYWSGRWAGAKAKPLFEKSQTDG--DESKSVNVDRVALYQSFMWSGRDLS-VSNNRKLSELTYSLLKGEKVSDLYRSCLFNFDYLYAKLNAFSVNDLISEFYFLRQNYEVRANQEVEVLISLLRLLAPIIEKDLSLMGIELSGRLCHLAGSQVLITGLLQQIDSQGSRVNCLCPVVPSFPPVEMDETKVPLPGPASAPIQCALSPDNRFLATL--LLINGELFLYVWDAKSATKSQILNLGEHDGSKFLSITYMPQTDEQMLLYYKKRVSDRDTCGYLFLNLSTATFDNKLEFRASEKPKIVYLTKSYVVLRVDGKVRVYQHSNASPALEFKNFHWPFLITPNDKYIIAPKA-WKTDSSK--VETNLRLLNTTTGDQVCVLSCHLYSTCLLSNARTEFVFVGCKNLGLVLRYDIAQAIKRDIKKLTPSMEFSLERQENLGPEFKSLFAKYKSHTSVTNMMLSIDEKYLIVEYNINDIRTVETIWSLSQKTVQAVLPQVPNAVTRFSVDGAHVYQFVLHSESDTTVRLFNCSSGELVQQVSIGSRIEDVYVVKERLTLLVTPNQVTLSSLKSPSDRPTQV----EAQVAYYGTALNSPYYHTDLNILYDNNPNLCDFTFLNLDNGSYLSYDMTHKSEVIGSFPVQRKITPDGEKLLLIFEAKKPKRASATED-----FSSQPDARGGAVARERGANLRKPELPNRNYFTGGLYIEATPTVGRPAKPRPSPGDPYGQKVIRVHDTDTGQLVSQISITGEAVSHVTSRLLLTLKPDHASRTRESPEANDILSAYDLQTGQFLQQTYLEHKIIASKLV-ESNSRLVICCGRNGRFVKTLGGKLFERVQHEVDVASLLKGIDEYARIPLIKGMLVPDESPNIVLLQF---------VIKENEIQYAKVDIQKACVISSFSTQDYIRDITRDGKVGIDKSLRLYDTTRGDALKQLSLSPDGADAQQLDTIPR-FIGDGSLIVVLDKAQNELTILRNDGSAGSGTVLGRSILHRLRKRQQGQTPSGEDDEEEDFQLVVGHAGKVALVFTETEFKVFVVRDDHLRGKRLAEQAYHGISDR 1742          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15802840 (tr|A0A267GWZ4|A0A267GWZ4_9PLAT AAA_16 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011309g1 PE=4 SV=1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 541/1791 (30.21%), Postives = 925/1791 (51.65%), Query Frame = 2
Query:  170 EIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAID--SALKIKNEHFPSNFIDQHFTSNLE---KCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKF-------NEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLII--RRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTI-SYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDI-GLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYE----DPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYV----KNEPLKVMNLSNGT-NYSIEMDEYPDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRN--DYRKPEIPGENYFFGD--------DKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEES---LVTGRAIL---------TSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIR---MTSKPMSEVPYKSNLDR 5392
            E+R+ L + E EF+VE+ I+  +VTP L+K+    F+ DF +ID  Q+++   LPK   ++  L + + C   S+G  +L+L+G ++G  + P  L+  +F   LN L+ +ND  W  F   + K   L  Y L    + D   S+   +   ++  + +     + +D  F   +E   K +    K +        + + +     T +P++  + L  + F       NEK + L     ++  +EN++ +SIS+  L   +   +  +N +  +         ++ L +KD++ ++    YL IF +     +++   K   + EF       E+ TH    S     + +     +R+RE+ I  NY+ S + + PGL++G  GSGK++++ +L +++      NL+I  R CG T  S +LQ ++AS+TQ+++ ++ +    + S EYA  VY+F  +L      KQL I+LDD+D LYP SHT++ +WLPH LP NVK+L+++ S+SF   FK+ +D S+ + +  +    AIK    SI     K I +     A+ +LQ NS PL+  +L    DV+        D   L+ +   +       L  + +I SY++ SRFGLSL EL D+LSLDN +     FD    N ++ P+ II   L      L  +Q + RL+    H +  + V ++YQL +E G    Q L ++W+ ++   K +PLFEK   D   +ES  + + R  + Q +       + +SN RKL EL + L+   K ++LY+  +FNF+YL++ L+ F +N L+SE YF RQ  +V+ N EVE+L+  LRLL   +  +  L+  EL+GRLCHL GS  LI+ L Q +DS   +VN +   +P++  ++++  +V + G  +  +  ALSPDNRF++T+    +  E  + +WD +SATKSQI+NLG     KF  + YMPQ DE +LL Y+    D +  G+L +N+  +  ++ ++       K+ Y++KS++ + V+ +++V                WP +++PNDKY+I PK   K D S+  +  NLR++N  +G+ VC L  +  S  LL N R E +F+  K+ G++ +Y+I Q  K+D+KKL  S +  +  Q  L    + L  KY  +     + LS+DEKYL+ +YN+ND   +  +WSL+ K+         + +  FS D   +Y +V     +  +++ N S+G     + +    + +Y+++     +V  N + +++LKS + +        E     +  +L  P   ++  +L+ N  N   F + +L + +  + D++H +E +  F   + ++PDGEKLLL+F  +  ++     D     F  + D  G  ++     + RKPE+P  NYF G              K      D Y QK++++ +  T Q + Q+S+TGE +  +T  +LLT KPD++S TR + EA DI+S Y +  G+F+   Y+E+ +I S L+ +    L+I CG+NG+ +K LGG+ F  V  E D+  LLK  DE+AR   +  + V  E+ N + +Q+         V  + EI YAK+D+ K  ++   ST   I D++ DG + ID  L +Y+ ++G  L++L  S   ++   L +    FI D S +  LD  +  L I+ N+  +    V GR+IL          +    +  +K F++ +G  G+  +V+ + EFKVF +R   +  K ++E  Y    DR
Sbjct:   41 EVRVFLFSNEGEFEVEKSILQNVVTPQLRKFCIETFSTDFLLIDPLQSSAGVKLPKRSSRD-CLRDSDDCFDTSDGPAALVLVGEKFGNSKLPPQLSEPEFAAFLNGLKKKNDPLWTSFQKLYAKQSDLS-YKL-QGAAPDLAESLRQRLPQVASEAVGDGTLTQDQVDALFVPPVEHYLKYLRTDKKPIDQCIAFARVLKDVREWGATEDPELKEQFLDLDAFGRFSQSSNEKVQQLREEFLQRLPKENYVRFSISSAMLSEYKLVQRNKSNVVSKL--------AETPLASKDMKATT----YLTIFAKQTFEKLKNHVMKFCGRHEFLALPLPMEIETH----SAVLAGQRVRPPVFSRDRELKILQNYVASKS-QLPGLLYGDHGSGKTAIIKQLIDQMT---DDNLVIIKRCCGRTTLSCTLQQIIASVTQEIYFHARR--QFAPSCEYAQVVYDFTRALQLPGFKKQLLIVLDDIDLLYPQSHTELFRWLPHRLPANVKVLVTAGSESFLTNFKRRFDDSSSLTLTGVVPSAAIKEFP-SILAAKGKAIGDKNRELANSLLQNNSYPLYTIILA---DVLPCREDKLPDRVKLVFMKRLEQLEQKHGLWVVKSILSYISCSRFGLSLPELQDVLSLDNSVAVDSGFDAKHSNFYRVPMGIITAFLDDVELYLIRVQLDDRLVYTWAHDVLRSAVTDYYQLNKEFGVQVSQQLAEYWSGRWAGAKAKPLFEKSQTDG--DESKSVNVDRVALYQSFMWSGRDLS-VSNNRKLSELTYSLLKGEKVSDLYRSCLFNFDYLYAKLNAFSVNDLISEFYFLRQNYEVRANQEVEVLISLLRLLAPIIEKDLSLMGIELSGRLCHLAGSQVLITGLLQQIDSQGSRVNCLCPVVPSFPPVEMDETKVPLPGPASVPIQCALSPDNRFLATL--LLINGELFLYVWDAKSATKSQILNLGEHDGSKFLSITYMPQTDEQMLLYYKKRVSDRDTCGYLFLNLSTATFDNKLEFRASEKPKIVYLTKSYVVLRVDGKVRVYQHSNASPALEFKNFHWPFLITPNDKYIIAPKA-WKTDSSK--VETNLRLLNTTTGDQVCVLSCHLYSTCLLSNARTEFVFVGCKNLGLVLRYDIAQAIKRDIKKLTPSMEFSLERQENLGPEFKSLFAKYKSHTSVTNMMLSIDEKYLIVEYNINDIRTVETIWSLSQKTVQAVLPQVPNAVTRFSVDGAHVYQFVLHSESDTTVRLFNCSSGELVQQVSIGSRIEDVYVVKERLTLLVTPNQVTLSSLKSPSDRPTQV----EAQVAYYGTALNSPYYHTDLNILYDNNPNLCDFTFLNLDNGSYLSYDMTHKSEVIGSFPVQRKITPDGEKLLLIFEAKKPKRASATED-----FSSQPDARGGAVARERGANLRKPELPNRNYFTGGLYIEATPTVGRPAKPRPSPGDPYGQKVIRVHDTDTGQLVSQISITGEAVSHVTSRLLLTLKPDHASRTRESPEANDILSAYDLQTGQFLQQTYLEHRIIASKLV-ESNSRLVICCGRNGRFVKTLGGKLFERVQHEVDVASLLKGIDEYARIPLIKGMLVPDESPNIVLLQF---------VIKENEIQYAKVDIQKACVISSFSTQDYIRDITRDGKVGIDKSLRLYDTTRGDALKQLSLSPDGADAQQL-DTIPRFIGDGSLIVVLDKAQNELTILRNDGSAGSGTVLGRSILHRLRKRQQGQTPSGEDDEEKDFQLVVGHAGKVALVFTETEFKVFVVRDDHLRGKRLAEQAYHGISDR 1774          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15781400 (tr|A0A1I8GF46|A0A1I8GF46_9PLAT AAA_16 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 541/1791 (30.21%), Postives = 925/1791 (51.65%), Query Frame = 2
Query:  170 EIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAID--SALKIKNEHFPSNFIDQHFTSNLE---KCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKF-------NEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLII--RRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTI-SYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDI-GLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYE----DPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYV----KNEPLKVMNLSNGT-NYSIEMDEYPDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRN--DYRKPEIPGENYFFGD--------DKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEES---LVTGRAIL---------TSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIR---MTSKPMSEVPYKSNLDR 5392
            E+R+ L + E EF+VE+ I+  +VTP L+K+    F+ DF +ID  Q+++   LPK   ++  L + + C   S+G  +L+L+G ++G  + P  L+  +F   LN L+ +ND  W  F   + K   L  Y L    + D   S+   +   ++  + +     + +D  F   +E   K +    K +        + + +     T +P++  + L  + F       NEK + L     ++  +EN++ +SIS+  L   +   +  +N +  +         ++ L +KD++ ++    YL IF +     +++   K   + EF       E+ TH    S     + +     +R+RE+ I  NY+ S + + PGL++G  GSGK++++ +L +++      NL+I  R CG T  S +LQ ++AS+TQ+++ ++ +    + S EYA  VY+F  +L      KQL I+LDD+D LYP SHT++ +WLPH LP NVK+L+++ S+SF   FK+ +D S+ + +  +    AIK    SI     K I +     A+ +LQ NS PL+  +L    DV+        D   L+ +   +       L  + +I SY++ SRFGLSL EL D+LSLDN +     FD    N ++ P+ II   L      L  +Q + RL+    H +  + V ++YQL +E G    Q L ++W+ ++   K +PLFEK   D   +ES  + + R  + Q +       + +SN RKL EL + L+   K ++LY+  +FNF+YL++ L+ F +N L+SE YF RQ  +V+ N EVE+L+  LRLL   +  +  L+  EL+GRLCHL GS  LI+ L Q +DS   +VN +   +P++  ++++  +V + G  +  +  ALSPDNRF++T+    +  E  + +WD +SATKSQI+NLG     KF  + YMPQ DE +LL Y+    D +  G+L +N+  +  ++ ++       K+ Y++KS++ + V+ +++V                WP +++PNDKY+I PK   K D S+  +  NLR++N  +G+ VC L  +  S  LL N R E +F+  K+ G++ +Y+I Q  K+D+KKL  S +  +  Q  L    + L  KY  +     + LS+DEKYL+ +YN+ND   +  +WSL+ K+         + +  FS D   +Y +V     +  +++ N S+G     + +    + +Y+++     +V  N + +++LKS + +        E     +  +L  P   ++  +L+ N  N   F + +L + +  + D++H +E +  F   + ++PDGEKLLL+F  +  ++     D     F  + D  G  ++     + RKPE+P  NYF G              K      D Y QK++++ +  T Q + Q+S+TGE +  +T  +LLT KPD++S TR + EA DI+S Y +  G+F+   Y+E+ +I S L+ +    L+I CG+NG+ +K LGG+ F  V  E D+  LLK  DE+AR   +  + V  E+ N + +Q+         V  + EI YAK+D+ K  ++   ST   I D++ DG + ID  L +Y+ ++G  L++L  S   ++   L +    FI D S +  LD  +  L I+ N+  +    V GR+IL          +    +  +K F++ +G  G+  +V+ + EFKVF +R   +  K ++E  Y    DR
Sbjct:   45 EVRVFLFSNEGEFEVEKSILQNVVTPQLRKFCIETFSTDFLLIDPLQSSAGVKLPKRSSRD-CLRDSDDCFDTSDGPAALVLVGEKFGNSKLPPQLSEPEFAAFLNGLKKKNDPLWTSFQKLYAKQSDLS-YKL-QGAAPDLAESLRQRLPQVASEAVGDGTLTQDQVDALFVPPVEHYLKYLRTDKKPIDQCIAFARVLKDVREWGATEDPELKEQFLDLDAFGRFSQSSNEKVQQLREEFLQRLPKENYVRFSISSAMLSEYKLVQRNKSNVVSKL--------AETPLASKDMKATT----YLTIFAKQTFEKLKNHVMKFCGRHEFLALPLPMEIETH----SAVLAGQRVRPPVFSRDRELKILQNYVASKS-QLPGLLYGDHGSGKTAIIKQLIDQMT---DDNLVIIKRCCGRTTLSCTLQQIIASVTQEIYFHARR--QFAPSCEYAQVVYDFTRALQLPGFKKQLLIVLDDIDLLYPQSHTELFRWLPHRLPANVKVLVTAGSESFLTNFKRRFDDSSSLTLTGVVPSAAIKEFP-SILAAKGKAIGDKNRELANSLLQNNSYPLYTIILA---DVLPCREDKLPDRVKLVFMKRLEQLEQKHGLWVVKSILSYISCSRFGLSLPELQDVLSLDNSVAVDSGFDAKHSNFYRVPMGIITAFLDDVELYLIRVQLDDRLVYTWAHDVLRSAVTDYYQLNKEFGVQVSQQLAEYWSGRWAGAKAKPLFEKSQTDG--DESKSVNVDRVALYQSFMWSGRDLS-VSNNRKLSELTYSLLKGEKVSDLYRSCLFNFDYLYAKLNAFSVNDLISEFYFLRQNYEVRANQEVEVLISLLRLLAPIIEKDLSLMGIELSGRLCHLAGSQVLITGLLQQIDSQGSRVNCLCPVVPSFPPVEMDETKVPLPGPASVPIQCALSPDNRFLATL--LLINGELFLYVWDAKSATKSQILNLGEHDGSKFLSITYMPQTDEQMLLYYKKRVSDRDTCGYLFLNLSTATFDNKLEFRASEKPKIVYLTKSYVVLRVDGKVRVYQHSNASPALEFKNFHWPFLITPNDKYIIAPKA-WKTDSSK--VETNLRLLNTTTGDQVCVLSCHLYSTCLLSNARTEFVFVGCKNLGLVLRYDIAQAIKRDIKKLTPSMEFSLERQENLGPEFKSLFAKYKSHTSVTNMMLSIDEKYLIVEYNINDIRTVETIWSLSQKTVQAVLPQVPNAVTRFSVDGAHVYQFVLHSESDTTVRLFNCSSGELVQQVSIGSRIEDVYVVKERLTLLVTPNQVTLSSLKSPSDRPTQV----EAQVAYYGTALNSPYYHTDLNILYDNNPNLCDFTFLNLDNGSYLSYDMTHKSEVIGSFPVQRKITPDGEKLLLIFEAKKPKRASATED-----FSSQPDARGGAVARERGANLRKPELPNRNYFTGGLYIEATPTVGRPAKPRPSPGDPYGQKVIRVHDTDTGQLVSQISITGEAVSHVTSRLLLTLKPDHASRTRESPEANDILSAYDLQTGQFLQQTYLEHRIIASKLV-ESNSRLVICCGRNGRFVKTLGGKLFERVQHEVDVASLLKGIDEYARIPLIKGMLVPDESPNIVLLQF---------VIKENEIQYAKVDIQKACVISSFSTQDYIRDITRDGKVGIDKSLRLYDTTRGDALKQLSLSPDGADAQQL-DTIPRFIGDGSLIVVLDKAQNELTILRNDGSAGSGTVLGRSILHRLRKRQQGQTPSGEDDEEKDFQLVVGHAGKVALVFTETEFKVFVVRDDHLRGKRLAEQAYHGISDR 1778          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18273215 (tr|A0A267G0C7|A0A267G0C7_9PLAT AAA_16 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011309g3 PE=4 SV=1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 425/1426 (29.80%), Postives = 734/1426 (51.47%), Query Frame = 2
Query:  170 EIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLE---KCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKF-------NEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLII--RRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTI-SYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDI-GLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYE----DPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYV----KNEPLKVMNLSNGT-NYSIEMDEYPDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRN--DYRKPEIPGENYFFG 4372
            E+R+ L + E EF+VE+ I+  +VTP L+K+    F+ DF +ID  Q+++   LPK   ++  L + + C   S+G  +L+L+G ++G  + P  L+  +F   LN L+ +ND  W  F   + K   L   +        E         ++  + +     + +D  F   +E   K +    K +        + + +     T +P++  + L  + F       NEK + L     ++  +EN++ +SIS+  L   +   +  +N +  +         ++ L +KD++ ++    YL IF +     +++   K   + EF       E+ TH    S     + +     +R+RE+ I  NY+ S + + PGL++G  GSGK++++ +L +++      NL+I  R CG T  S +LQ ++AS+TQ+++ ++ +    + S EYA  VY+F  +L      KQL I+LDD+D LYP SHT++ +WLPH LP NVK+L+++ S+SF   FK+ +D S+ + +  +    AIK    SI     K I +     A+ +LQ NS PL+  +L    DV+        D   L+ +   +       L  + +I SY++ SRFGLSL EL D+LSLDN +     FD    N ++ P+ II   L      L  +Q + RL+    H +  + V ++YQL +E G    Q L ++W+ ++   K +PLFEK   D   +ES  + + R  + Q +       + +SN RKL EL + L+   K ++LY+  +FNF+YL++ L+ F +N L+SE YF RQ  +V+ N EVE+L+  LRLL   +  +  L+  EL+GRLCHL GS  LI+ L Q +DS   +VN +   +P++  ++++  +V + G  +  +  ALSPDNRF++T+    +  E  + +WD +SATKSQI+NLG     KF  + YMPQ DE +LL Y+    D +  G+L +N+  +  ++ ++       K+ Y++KS++ + V+ +++V                WP +++PNDKY+I PK   K D S+  +  NLR++N  +G+ VC L  +  S  LL N R E +F+  K+ G++ +Y+I Q  K+D+KKL  S +  +  Q  L    + L  KY  +     + LS+DEKYL+ +YN+ND   +  +WSL+ K+         + +  FS D   +Y +V     +  +++ N S+G     + +    + +Y+++     +V  N + +++LKS + +        E     +  +L  P   ++  +L+ N  N   F + +L + +  + D++H +E +  F   + ++PDGEKLLL+F  +  ++     D     F  + D  G  ++     + RKPE+P  NYF G
Sbjct:   41 EVRVFLFSNEGEFEVEKSILQNVVTPQLRKFCIETFSTDFLLIDPLQSSAGVKLPKRSSRD-CLRDSDDCFDTSDGPAALVLVGEKFGNSKLPPQLSEPEFAAFLNGLKKKNDPLWTSFQKLYAKQSDLSYKLQGAAPDLAESLRQRLPQVASEAVGDGTLTQDQVDALFVPPVEHYLKYLRTDKKPIDQCIAFARVLKDVREWGATEDPELKEQFLDLDAFGRFSQSSNEKVQQLREEFLQRLPKENYVRFSISSAMLSEYKLVQRNKSNVVSKL--------AETPLASKDMKATT----YLTIFAKQTFEKLKNHVMKFCGRHEFLALPLPMEIETH----SAVLAGQRVRPPVFSRDRELKILQNYVASKS-QLPGLLYGDHGSGKTAIIKQLIDQMT---DDNLVIIKRCCGRTTLSCTLQQIIASVTQEIYFHARR--QFAPSCEYAQVVYDFTRALQLPGFKKQLLIVLDDIDLLYPQSHTELFRWLPHRLPANVKVLVTAGSESFLTNFKRRFDDSSSLTLTGVVPSAAIKEFP-SILAAKGKAIGDKNRELANSLLQNNSYPLYTIILA---DVLPCREDKLPDRVKLVFMKRLEQLEQKHGLWVVKSILSYISCSRFGLSLPELQDVLSLDNSVAVDSGFDAKHSNFYRVPMGIITAFLDDVELYLIRVQLDDRLVYTWAHDVLRSAVTDYYQLNKEFGVQVSQQLAEYWSGRWAGAKAKPLFEKSQTDG--DESKSVNVDRVALYQSFMWSGRDLS-VSNNRKLSELTYSLLKGEKVSDLYRSCLFNFDYLYAKLNAFSVNDLISEFYFLRQNYEVRANQEVEVLISLLRLLAPIIEKDLSLMGIELSGRLCHLAGSQVLITGLLQQIDSQGSRVNCLCPVVPSFPPVEMDETKVPLPGPASVPIQCALSPDNRFLATLLL--INGELFLYVWDAKSATKSQILNLGEHDGSKFLSITYMPQTDEQMLLYYKKRVSDRDTCGYLFLNLSTATFDNKLEFRASEKPKIVYLTKSYVVLRVDGKVRVYQHSNASPALEFKNFHWPFLITPNDKYIIAPKA-WKTDSSK--VETNLRLLNTTTGDQVCVLSCHLYSTCLLSNARTEFVFVGCKNLGLVLRYDIAQAIKRDIKKLTPSMEFSLERQENLGPEFKSLFAKYKSHTSVTNMMLSIDEKYLIVEYNINDIRTVETIWSLSQKTVQAVLPQVPNAVTRFSVDGAHVYQFVLHSESDTTVRLFNCSSGELVQQVSIGSRIEDVYVVKERLTLLVTPNQVTLSSLKSPSDRPTQV----EAQVAYYGTALNSPYYHTDLNILYDNNPNLCDFTFLNLDNGSYLSYDMTHKSEVIGSFPVQRKITPDGEKLLLIFEAKKPKRASATED-----FSSQPDARGGAVARERGANLRKPELPNRNYFTG 1422          
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17195583 (tr|A0A4Z2CY30|A0A4Z2CY30_SCHJA NACHT and WD repeat domain-containing 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_006483 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 4.688e-86
Identity = 448/1775 (25.24%), Postives = 774/1775 (43.61%), Query Frame = 2
Query: 1046 YLQIFTENLMRIIQDSCKKIF----LKREFSQSSSFYEMSTH-------------------NLRKSKTTNAEFIN---------VINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGF----------------PSTNL------------IIRRC-GNTINSSSLQLLLASITQQVHS-YSSKVKYCSQS-SEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKN-VKILLSSSSDSFYQGFKKHYD------LSNIVNIPMIDSREAIKLMTLSIPQ--------NVE-KTIPEAILNQASFVLQENSTPLFFSLLLWSLDV-------IDDPNSLNGDXXX--XXXXXXXXXXXSTTPLL---FIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIK----CSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKY--------------------------------FYQNLFDFW---TSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSK-------TLIS--------NERKLIELPFLLISYGK--ANELYKYVIFNFEYLFSSLSNFGI--NYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGS--NPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDIGLKT-----------------QIVLSALSPDNRFISTIHSQKVP----------NEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMP-QRDELLLLKYEDP--NNQ--GFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFI------------FVNEELQ-VLLVPTGQKDHN-LSKLPWPTILSPNDKYLIGP-KPPTK-----------------RDISEKNINFNLR-VMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQL---------QIMEQSTLS------------DGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTD--AQFLYYYVK---------------------------NEPLKVMNLSNGTNYSIEMDEY------PDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSE-NVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNES---LTEFANDKFLSP-------------DGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRN----DYRKPEIPGENYFFGDDKDSNKGNKETHDAYSQKIVKIVNL--KTSQTIF--QVSLTGEKILKL-TDNILLTFKPDYSS------------------------LTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKE----IVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSII---SSNE--TFLGEFTSLFINDASFVATLDPIKRNLWIISNNE---ESLVTGRAILT------SSLNSNRSD-KTFEMCLGLDGRFIIVYND--QEFKVFAIR 5341
            YL +F E ++++++     +F    L  +  Q S+ YE  TH                   ++ ++   NA  IN         +++  R RE+ I  +YL   + K PGLI+GP G GK+SLL       + F                PS NL            +I  C   T  S+SLQ +L  I +Q+ + +S + +   +S  EYA  V      LN +N  K + I++DD++ LYP  H  M  WL H LP + ++IL+++S++   +GF K +       LS   +I  + ++   KL+  ++ +        N++   I E ++N A   LQ+N TP +  LL   + V       I  P +L  D+ +  ++++      L  T L     +  I Y+A SR GL+  EL++IL  D+ ++Q         +   FP+  ++ L+       +  L    T+ RLLI      Y    +  +     +  Y                                F++ L D+W   TS  ++   +P     S +   N + H     +  +  YY +   K       T+I         N R+L ELP+ L+  G     +L K+VIF+F+++ + L   G+  N +++E Y+ RQ+N ++ N E+  LL  LR L  ++     LLS EL GR+ HLV S    +  QL   +D  + KVN +L  +    T  ++   +++  K                  Q V++ +S D+RF+ T+   ++           NE +I +W+  S TKS   +LG   N  F    YMP  +++L+LL Y     NN   G L VN++   +E  + +     +K+  I++  + I             VN+E   V  +P  +     LSK+P P  LSP D+   GP + P +                 ++I+  ++   L+  +N V   + C L           N+R E +F+  KS G IY++++  I+ K+++ +K + +L         QI   S LS              V ++L +    +   KL++S DEKYL A YN ND   +  +W + ++  +   Q  HS+ + F TD    FL ++VK                           N PL   + S  TN  +++          D+ Y +R GS  +V TN   I    ++      +Q    + P      L +    SE ++V  +  +N   F YY+LL+  + +++ +  ++    +  + ND  ++P             DG++L LV+  R+   + +N   ++     KV++     S RN    +YRKP++P  NYF    +   K N  +   Y Q ++++ +L  K S T    Q+S+ GE I  + T   + T KPD++S                        +T+ +++   ++S Y    G+F+ Y ++++PVI    I  +   L++ CG++G+ I++L    F+ +L E ++  LLK  D+F R+ SV +LF  +     + VQY WL+  ++T       +   +D+ KK+    I+ Q+S V +++DVS+DGT  ID+ L +     G+    L +  +   + NE      +FT   +   S + +L+     L II NN+      V GRA+LT       S ++  S+  + ++ LG +GR ++V  D  +EFK+F IR
Sbjct:  284 YLVLFVEQIIKLLKKCITHLFNDNKLFYQELQLSNEYESETHYNLLMYSTEKLNLQLHHYADITQNIDQNASSINNLHIDYNDKIMHETRNREINIIKSYLKGNS-KLPGLIYGPEGCGKTSLLRWTVNYFEKFCYKSESDNQLTVTTTQPSNNLTTSIQSTIVEPIVIVCCISRTCLSTSLQSVLVQIIEQLMTKFSIQPQQQIKSLCEYAEAVRLLNTMLNYANSMKPILIIIDDIEYLYPDEHVQMFHWLSHELPNHYIRILITTSAERIVKGFIKRFGEGCCISLSACFHIQYVMNKILPKLIQDNLKELTSQQDDINIQLNQIDEELINVA---LQKNITPNYIKLLAEIIAVKLNGKVNITLPENLPTDLSNLFVLRLQQIHSMLKQTGLFSAALLRFIPYIACSRIGLTFHELIEILQNDSDVIQARKRLNQVYSLQHFPIGCLKHLIYSPIYGLTKYLMFTITDNRLLITFTSESYRKGALLFWGFNANDSNYSRTGLGNENFSSDENKDNFNEKQIDIPLKEFPFHRYLSDYWLGNTSGQDDYDQQPKQTGQSYEIKVNNTEH---NEDAFNTVYYWLATDKLKKVNLDTVIGTYDKRYFCNARRLTELPYQLLQLGSDSVQDLLKHVIFSFDFMLAKLL-LGLRPNDVITEFYYLRQLNQLRTNDEITYLLNLLRSLSTKLSLVPTLLSVELAGRIGHLVNSEYTYIGRQLLTSIDCDSSKVNCLLPLLSICYTPPLQPELLNVKYKNNETKFFSSITEMQQQEMQEVIT-ISSDSRFLFTLTVSQMSKSNFDTCVNSNEVLINMWEVNSLTKSCSFSLGEWPNHIF-HQAYMPTHQNQLVLLTYSTKAMNNAKSGILAVNLELGCVEGNLSVKHPIQLKILCITRFSILITQYGLKENDENRIVNQEYATVYSIPNLKPISGILSKVPLPFYLSPTDRICFGPSRWPIQSKTSVEKKRKQNSTDGLKEINSNSVQVRLKNALNDVVAWIKCPLA----PATFQTNIRGETLFIGCKSLGQIYRFDLTMISNKEIRIIKPNMELNLYKNIKNVQIKSLSELSLEKQTTTSFLWDSDVMNILDQVRHQVSVKKLWMSPDEKYLAALYNANDYRLIIGIWQINSRLLIAGLQGYHSSEIRFGTDSTGSFLIHFVKSSNVQTWIELAELNVIQQTQLISNVNMNRPLTNTSKS-STNLLVKIHRILAFKTSIDEAYFIRGGSLIIV-TNGGIILTSVNVLILGSKNQGPMALTP--IGRKLSRVNYHSELDIVYSTEIDNQQLFSYYNLLTQKIISVECTKIDQQVGFMNNYENDFLITPILEDTPCERHISSDGKRLALVY--RVKSIVNDNKSDDLS----KVNY-----SERNNEAKEYRKPKLPNINYFTSLQE---KDNSSSGMGYDQTVIRLYDLDNKLSGTGLRCQISIIGEFIFHMSTKYGIYTLKPDHASNTKLSSFRDPLIINSTKDDQNKTSVTKFDDKPQALLSRYASTNGRFLGYSFLQHPVIKGTQIIFNDRYLVLCCGEHGQWIRILEAPDFNKLLYEVNLHKLLKEQDDFCRTPSVQRLFTCQAQPTKVIVQYVWLDQENST------FNVTVLDLKKKQNSELIISQMSIVDKLIDVSSDGTYGIDANLRLINFQNGNTSALLNSCNLIPGTQNEPTVLCAQFTPDKLYIVSVLYSLEYHNAWLVIIHNNKIHNNYPVIGRALLTPIDEIIPSCSTESSELPSIKIQLGYNGRLVVVKLDTAKEFKLFTIR 2020          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 108.227 bits (269), Expect = 5.951e-23
Identity = 120/477 (25.16%), Postives = 216/477 (45.28%), Query Frame = 2
Query: 1274 PGLIFGPIGSGKSSLLFELSEKIKGF--PSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSL--NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVL------------QENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNG--FKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSI---YITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGK-----LRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDV 2611
            P ++ GP GSGK+++L  L+++++    P   + +R  G +  SS +  +L S+  QV    +    C+Q++     +  F+ S+    S     L ++LD +D L  ++    ++WLP  +P N+ +++S+ +D +    +    L+N       D +   ++  L++ +   + I +A +++A   L            Q+  +PL   LLL     W+         L   ++ +I +FL  LE     L   H + Y+ LSRFGLS +EL DILSLDN ++  V  + L  N    +FP  +           L        L+ R ++ I   +I  V E Y  ++   K  +  L +++  ++  G+     L PL  +L+ D            R + +QP +        I N RKL ELPF L+  GK  EL + ++ N E+L+    + G+  ++ +  FC  + D 
Sbjct:  341 PLVVSGPPGSGKTAVLCRLAQEMRAVLGPQAVVTLRLLGTSPLSSDVDSVLKSVCVQVCGAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGDTLLLILDSLDHLPHANGGHKLRWLPKEIPPNIHLVVSTLAD-WSPCLESLKALNN-------DDKYFFQVEPLTLEEG--QLITKAYMDKAGRRLTSEQVDAVLQSFQKTGSPLHLKLLLDMAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNRLPPNHTLLRFPPLLWA---------LFRQDLGDHLVERWENGIAVQFIEIVKERYLSVELRVK-MHTVLSEYFLGQWSQGQQKPILLHPLMTQLNAD------------RKVPAQPLWFAEG----IPNFRKLHELPFHLLHAGKWEELRQLLLGNLEWLYCKTLSCGVASVIQDFTFCTDVMDC 781          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 106.301 bits (264), Expect = 2.206e-22
Identity = 117/474 (24.68%), Postives = 213/474 (44.94%), Query Frame = 2
Query: 1274 PGLIFGPIGSGKSSLLFELSEKIKGF--PSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSL--NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVL------------QENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNG--FKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGK-----LRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDV 2611
            P ++ GP GSGK+++L  L+++++    P   + +R  G +  SS +  +L S+  QV    +    C+Q++     +  F+ S+    S     L ++LD +D L  ++    ++WLP  +P N+ +++S+ +D +    +    L+N       D +   ++  L++ +   + I +A +++A   L            Q+  +PL   LLL     W+         L   ++ +I +FL  LE     L   H + Y+ LSRFGLS +EL DILSLDN ++  V  + L  N    +FP  +         + L     N   +       +I  V E Y  ++   K  +  L +++  ++  G+     L PL  +L+ D            R + +QP +        I N RKL ELPF L+  GK  EL + ++ + E+L+    + G+  ++ +  FC  + D 
Sbjct:   11 PLVVSGPPGSGKTAVLCRLAQEMRAVLGPQAVVTLRLLGTSPLSSDVDSVLKSVCVQVCGAFNLAPPCTQTANSHDMLVRFFQSMLHKVSEQGDTLLLILDSLDHLPHANGGHKLRWLPKEIPPNIHLVVSTLAD-WSPCLESLKALNN-------DDKYFFQVEPLTLEEG--QLITKAYMDKAGRRLTSEQVDAVLQSFQKTGSPLHLKLLLDMAKQWTSYTTLSDIRLGSSVQEVISLFLDSLEGKHGKLFVRHALGYITLSRFGLSEAELQDILSLDNDVLAEVYQNRLPPNHTLLRFPPLLWALFRQDLGDHLVERWENGIAVCGFSLRQFIEIVKERYLSVELRVK-MHTVLSEYFLGQWSQGQQKPILLHPLMTQLNAD------------RKVPAQPLWFAEG----IPNFRKLHELPFHLLHAGKWEELRQLLLGSLEWLYCKTLSCGVASVIQDFTFCTDVMDC 457          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 103.99 bits (258), Expect = 1.445e-21
Identity = 205/988 (20.75%), Postives = 404/988 (40.89%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYV------IHRSIINSIQ--TTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISY--SISNTTLFAA------------------------ERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL-------YLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKI------KGFPSTN--LIIRRCGNTINSSSLQLLLASITQQVH-SYSSKVKYCSQSSEYAVCVYEFWLSL-NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLL--------QEEGKYFYQNLFDFWTSKYENGKLRPLF---------------------EKLSEDDLPNESSHMYLKRNIMSQPY-YTIN--NSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXX-----XXXXXXXXXXVN-NAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+                      L+  IL+     DE     N++  A  +K    P   + +++ +++E   N AAK+    +   V      I R+ +  +Q   T   +  K  L     ++ +         F+++  + Y   ISN   FA                         ER +K     + TV  + N + V S +   D+++  + ++         + F E+++ IIQ + ++ F     +++   Y+ +  +L   KT ++ ++    ++   +M +   Y +      P +++G   +GK+ LL E++++       +  P T+  +I+R  G++  S+ L+ LL SI +Q+  +Y   + +     +    + E  ++L  +S+  + L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D +   + +K   LS+ + V     +  +N+A   L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ ++R GL+  EL DILSLDN ++     DI+  +  K P+ I  +L+ +    LE     +++    ++   +     H  L+        +E+    +  L +++   +  G+ + +F                     + L   D  +   H Y  R    QP+ +  N  +      N RK+ EL F L   G+ ++L   VI NF +L++         ++    F + + D+   +                     VN N   LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:  118 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILDAAVEAG----------------LDTRILEEWYCRDE-----NSVPPAYYLK----PKAQMLKNYQNSMES--NSAAKSKNDKAWRAVSEEIKKIFRTAVLQLQEKGTMKSVQAKKFLCSALEDELDFALGKQTPAFLKK-CVCYIRKISNFDRFAKLPEMARYMDIITSGDRIMRNQEAYERLLKVRDEFIPTVVAASN-LRVYSSVTHCDMKLGYSQEVESHYVEGLCKQFYEDMVDIIQATVQQNF----DTETDPLYDETIQHLSLCKTYSSFYVY---KSEALDMVLEYLYPSQGGRIMPLVVYGGPCTGKTLLLAEVAKQAYSCLQKEMGPETDPVVIVRFIGSSDLSTDLRNLLQSICEQIAINYRCLIHFLPNKIQE---MRELLVNLLGESSFQRPLVIILDALEQLSDADDARKLWWLPIHLPRTVRIVVSTLPNKHGILQKLRCLIHDDDCYVELMQRDRKACSQTLKQQLLSVKRKVTSG-QQIYVNEA---LAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFFSIENKLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLG----DIMVSSNLKSPLRISYDLIAQLKEELEGYLVERQV----RNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGR-KKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSY-DRQTPEQPWVFQCNLLDQDIFFVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYT---------MIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 1039          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 103.605 bits (257), Expect = 1.616e-21
Identity = 206/988 (20.85%), Postives = 406/988 (41.09%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYV------IHRSIINSIQ--TTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISY--SISNTTLFAA------------------------ERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL-------YLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKI------KGFPSTN--LIIRRCGNTINSSSLQLLLASITQQVH-SYSSKVKYCSQSSEYAVCVYEFWLSL-NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLL--------QEEGKYFYQNLFDFWTSKYENGKLRPLF---------------------EKLSEDDLPNESSHMYLKRNIMSQPY-YTIN--NSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXX-----XXXXXXXXXXVN-NAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L       D++             L+  IL+     DE     N++  A  +K    P   + +++ +++E   N AAK+    +   V      I R+ +  +Q   T   +  K  L     ++ +         F+++  + Y   ISN   FA                         ER +K     + TV  + N + V S +   D+++  + ++         + F E+++ IIQ + ++ F     +++   Y+ +  +L   KT ++ ++    ++   +M +   Y +      P +++G   +GK+ LL E++++       +  P T+  +I+R  G++  S+ L+ LL SI +Q+  +Y   + +     +    + E  ++L  +S+  + L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D +   + +K   LS+ + V     +  +N+A   L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ ++R GL+  EL DILSLDN ++     DI+  +  K P+ I  +L+ +    LE     +++    ++   +     H  L+        +E+    +  L +++   +  G+ + +F                     + L   D  +   H Y  R    QP+ +  N  +      N RK+ EL F L   G+ ++L   VI NF +L++         ++    F + + D+   +                     VN N   LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMIL-------DAA---------VEAGLDTRILEEWYCRDE-----NSVPPAYYLK----PKAQMLKNYQNSMES--NSAAKSKNDKAWRAVSEEIKKIFRTAVLQLQEKGTMKSVQAKKFLCSALEDELDFALGKQTPAFLKK-CVCYIRKISNFDRFAKLPEMARYMDIITSGDRIMRNQEAYERLLKVRDEFIPTVVAASN-LRVYSSVTHCDMKLGYSQEVESHYVEGLCKQFYEDMVDIIQATVQQNF----DTETDPLYDETIQHLSLCKTYSSFYVY---KSEALDMVLEYLYPSQGGRIMPLVVYGGPCTGKTLLLAEVAKQAYSCLQKEMGPETDPVVIVRFIGSSDLSTDLRNLLQSICEQIAINYRCLIHFLPNKIQE---MRELLVNLLGESSFQRPLVIILDALEQLSDADDARKLWWLPIHLPRTVRIVVSTLPNKHGILQKLRCLIHDDDCYVELMQRDRKACSQTLKQQLLSVKRKVTSG-QQIYVNEA---LAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFFSIENKLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLG----DIMVSSNLKSPLRISYDLIAQLKEELEGYLVERQV----RNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGR-KKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSY-DRQTPEQPWVFQCNLLDQDIFFVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYT---------MIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 962          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:103039682])

HSP 1 Score: 79.7221 bits (195), Expect = 2.672e-14
Identity = 151/704 (21.45%), Postives = 298/704 (42.33%), Query Frame = 2
Query:  920 AAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDL-------YLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKI------KGFPSTN--LIIRRCGNTINSSSLQLLLASITQQVH-SYSSKVKYCSQSSEYAVCVYEFWLSL-NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSR---EAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLL--------QEEGKYFYQNLFDFWTSKYENGKLRPLF---------------------EKLSEDDLPNESSHMYLKRNIMSQPY-YTIN--NSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXX-----XXXXXXXXXXVN-NAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            A ER +K     + TV  + N + V S +   D+++  + ++         + F E+++ IIQ + ++ F     +++   Y+ +  +L   KT ++ ++    ++   +M +   Y +      P +++G   +GK+ LL E++++       +  P T+  +I+R  G++  S+ L+ LL SI +Q+  +Y   + +     +    + E  ++L  +S+  + L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D +   + +K   LS+ + V     +  +N+A   L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ ++R GL+  EL DILSLDN ++     DI+  +  K P+ I  +L+ +    LE     +++    ++   +     H  L+        +E+    +  L +++   +  G+ + +F                     + L   D  +   H Y  R    QP+ +  N  +      N RK+ EL F L   G+ ++L   VI NF +L++         ++    F + + D+   +                     VN N   LS EL  RL  +V S P +  L    D   PK  SI   +P +S++DV
Sbjct:  286 AYERLLKVRDEFIPTVVAASN-LRVYSSVTHCDMKLGYSQEVESHYVEGLCKQFYEDMVDIIQATVQQNF----DTETDPLYDETIQHLSLCKTYSSFYVY---KSEALDMVLEYLYPSQGGRIMPLVVYGGPCTGKTLLLAEVAKQAYSCLQKEMGPETDPVVIVRFIGSSDLSTDLRNLLQSICEQIAINYRCLIHFLPNKIQE---MRELLVNLLGESSFQRPLVIILDALEQLSDADDARKLWWLPIHLPRTVRIVVSTLPNKHGILQKLRCLIHDDDCYVELMQRDRKACSQTLKQQLLSVKRKVTSG-QQIYVNEA---LAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFFSIENKLGSRFVFRALGYVTMARAGLTEVELEDILSLDNSVLG----DIMVSSNLKSPLRISYDLIAQLKEELEGYLVERQV----RNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGR-KKIFHCDNNHFASLNISQHRNPHHQQSLHGHDKASADKHSY-DRQTPEQPWVFQCNLLDQDIFFVNHRKMTELLFHLTRSGRTDDLMYGVIMNFSWLYT---------MIKIGQFDKALTDIDTAYTYTQEKELKFLASTLRSIKIKVNKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSI---VPLHSSMDV 952          

HSP 2 Score: 53.5286 bits (127), Expect = 2.558e-6
Identity = 27/106 (25.47%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLN 487
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDSPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILD 145          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO40517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z9])

HSP 1 Score: 101.293 bits (251), Expect = 1.230e-21
Identity = 149/652 (22.85%), Postives = 271/652 (41.56%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRN---REREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTN--LIIRRCGNTINSSSLQLLLASITQQV-HSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSD---SFYQGFKKHYDLSNI-VNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQE-NSTPLFFSLLL-------WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV 2074
            +RI   +  ++ + ER+ + E V P LK+ FC E   +F ++D        +       E  L E++ CQ LS G   +   G +YG    P  +  +++D + + + +  D   +    K +++    +Y+L   +S+   F     +D   K         + D +   NL+  +  AAK + +   ++    S+       E   P + LL+        NL   ++    + N  SY I  T+         T+   L              +L T+              F + + + I D+  K        +   F E++ H         A F N+   N   RE  +     Y++ +  K P +++G  G GK+SL+   ++ +  +      +++R  G T +SS+++L+L S   Q+  ++ +  K   Q  +Y   + EF   L  +  N+ + ++LD  D+L  +     + WLP  LPK+V +L+S+  D   + Y   KK    SN  V +  + S  A  ++T S   N  + + ++   Q   VL   N  PL   L L       W      + + L  +++ +IK   K+LE     +L  H ++Y+  ++ GLS  EL DILS D  ++  V
Sbjct:   15 VRIFTSSTFTDTQAERNTLMERVYPKLKE-FCQEHGYEFQVVDMRWGVRDASTDDHATTELCLCELKACQKLSTGPNFVTFFGQKYGFGPFPPKILSTEYDKLYSAVDNTEDKKLLDVWFKLDENAVPPEYVLQPISSQFPAF-----VDPPNKEARRTAQREWWDVYL--NLQNTLRAAAKKVLSKEEAHKYFMSV------REVDKPAQYLLK--------NLQSEIRSTLDKSNIFSYDIKWTSEGVTPEGNLTHGQYL-------------GKLCTE--------------FYDVMKKKITDAITKRAAGEVRDKEHLFQEVAQH---------ATFCNLKCENFHGREDILEKIRTYISGSGQK-PLVLYGDSGCGKTSLVAMTAKLVPSWTEYEPVVVLRFLGTTPDSSNIRLVLRSACLQLCKAFGTSTKVVPQ--DYQDLLREFQDRLKMAKSNRPIVVILDSADQLTTTDDAHQMVWLPRKLPKHVYVLVSTLKDPKYACYPALKKLLLDSNCFVEVSSLPSEVACNILT-SWLSNDNRRLTDS---QRKIVLNAFNRCPLPLYLRLAYDHAVTWKSYTPLEKSVLEKNVQGMIKALFKRLERRHGTVLVRHALAYITAAKHGLSEPELEDILSCDEEVLDEV 601          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO31117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYV4])

HSP 1 Score: 99.3673 bits (246), Expect = 1.158e-20
Identity = 112/485 (23.09%), Postives = 216/485 (44.54%), Query Frame = 2
Query: 1211 RNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTN--LIIRRCGNTINSSSLQLLLASITQQVHSY----SSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGF----KKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEA-ILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTV----------IEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSE 2581
            R R+  ++   +YL       P +++G  GSGK+S++  ++ ++K +   N   I R  G +  +S+  L + S+ +Q+H      S K       +E     +E  LS    +  + L ++LD VD+L PS +  ++ WLP SL  ++KI++S     +Y+      +   D +  + +P +      +++   +        PE  +L  A+F   +   PLF  L+      W+        SL  ++   I    ++LE     +LF   + Y+  +R GL+ +EL DILSLD+ ++  V   +D       + P  +   +       L   Q + + ++   H  +              ++ + L+ E   +F   L +FWT  +  G+ + +     +  LP+        R + +QP   +  SK +  N RKL ELP+ L+   + N L + V+FNFE++ + +    +N ++++
Sbjct:  346 RGRQEILSRARDYLCRYDSARPLVVYGASGSGKTSIMAVIAFRVKEWLGDNAVCIFRFLGTSPGTSNTLLTIKSVCEQIHQVFGLESLKEDVAEDYTELVRHFHEL-LSTLSVSAERPLVLVLDSVDQLSPSYNAHLMNWLPKSLSDHIKIVISVLP-GYYEILPTLQRSLTDTNCYIEVPTLSRDTGHEILDAWLDSKHRTLTPEQRVLVMAAF--DKCPQPLFLKLIFAEASEWASYTDVSGVSLGANVPEAIGFLFERLERKHGKMLFSRALQYVTAARSGLTENELEDILSLDDDVIDDVYQYWDPPVEGVVRLPNLLWARVRSDIDEFLVERQADGKTVVAWYHRQFWEACERMYLKDGVKVDAHALMAE---FF---LGEFWT--WGGGRKKHIVLTRRQKALPDAD------RQVSAQP---LMFSKEIF-NLRKLSELPYHLVHSKQFNALSQEVLFNFEWIMAKVKAQSLNSVLAD 808          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO47107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNA8])

HSP 1 Score: 75.8702 bits (185), Expect = 9.356e-14
Identity = 51/200 (25.50%), Postives = 100/200 (50.00%), Query Frame = 2
Query: 1280 LIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRRC---GNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQ---GFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSL 1861
            +++G  G GK+SL+ +++ ++K +P  + +I  C   G + +SSS++ L+ SI  Q+   + +V            V  F   L K++ N+++ ++LD +D+L        ++WLP SLP NV +++S+     YQ     +  Y+   ++ +P I   EA  L+  +  +   + +  A  N+     +E   PL+  L
Sbjct:  310 VLYGESGCGKTSLMAKIATQVKDWPEEDGVITVCRFIGTSPDSSSIRPLIRSICLQLCKATGQVTADIPEVRMKALVEYFPECLEKASENQKVVLVLDSLDQLSVDDSGRQMEWLPRSLPYNVYVIMSTLPGEQYQVLPNLRVRYNPQTLMEVPQIPMSEA-GLILDNWLKAANRALQPAQRNEVMISFKECPLPLYLKL 508          

HSP 2 Score: 52.373 bits (124), Expect = 1.722e-6
Identity = 28/112 (25.00%), Postives = 54/112 (48.21%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRND 508
            +RI   +  ++  VER+ + E + P +K+ FC +   +F ++D       ++       E  + E+  CQ LS G   +  LG +YG    P  +  S+F+ + + + S+ D
Sbjct:    3 VRIFTSSTFTDTSVERNTLMERIYPRIKQ-FCQQQGYEFQVVDMRWGVRDESTDDHLTSELCMRELRACQELSTGPNFITFLGQKYGYRPFPPKIPASEFEKLASAVGSKED 113          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO37261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG70])

HSP 1 Score: 73.1738 bits (178), Expect = 6.508e-13
Identity = 71/299 (23.75%), Postives = 138/299 (46.15%), Query Frame = 2
Query: 1214 NREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGF--PSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQ-LFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSN----IVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSL-----LLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV 2074
             R+  +    +YL    +  P ++ G  G GK+S++   ++  + +  P   +++R  G T  SS+++ L+ SI +Q+           Q  +  V   E + SL  S   K+ L +LLD +D+L P     ++ WLP  LP + K+++S+   + Y+ F K   +       +++P +   +   ++++ + Q+  +T+  A  +       +   PLF  +       W          L G ++  I   L+++E     +L  H + YL  +R GL+ +EL DILS D+ ++  V
Sbjct:  293 GRQAVLNSIGDYLREG-LGQPLVLHGCSGCGKTSIMAMAAKCARDWIHPEACVVLRFLGTTPKSSTIRRLMKSICEQIKCVYRLTTSIPQGLKDMV---ELFPSLLASATAKRPLLVLLDSLDQLSPEDGARLLDWLPKHLPGHCKMIVSTLPGAQYRCFPKLKAMFKNDKLFISVPSLPHSDVSDILSMWLQQS-GRTLQPAQRDLVMSAFSQCPLPLFLKISFDEACRWHSYTDPGQTRLYGSVRDAINGLLERIEAKHGRILVQHALGYLTAARSGLTETELDDILSSDDEVLDDV 586          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Match: EDO34994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT6])

HSP 1 Score: 68.9366 bits (167), Expect = 1.410e-11
Identity = 68/276 (24.64%), Postives = 133/276 (48.19%), Query Frame = 2
Query: 1274 PGLIFGPIGSGKSSLLFELS----EKIKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHS-YSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGF---KKHYDLSNIVNIPMIDSREAIKLMT--LSIPQNVEKTIPEAILNQASFVLQENSTPLFFSL-----LLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDN 2056
            P +I+G  G GK+S++  ++    E ++G   T +++R  G T +SS ++LL+ S+ QQ+ + Y     +    ++      +F   L  +   + L I+LD +D+L        + WLP +LP +V +++S+  +  Y+ F   K      + V +P +  ++A +++   L +      T  + I+ QA   LQE S P+F  +     + W      D   L   ++  I    +++E     +L    + Y+  ++ GL+ +EL D+LS D+
Sbjct:  321 PLVIYGESGCGKTSVVSMVAMRSREWLRG--DTCVVVRYIGTTPDSSLVRLLVRSVCQQICAVYEKDPSFIR--NDIKELKEDFIRCLRMATVERPLLIVLDSLDQLSAEDGARQLSWLPMTLPDHVHLVVSTIPEVKYECFPVLKAFLPPESFVLVPKLPQKDAAEILVSYLRMEHRTLSTDQQDIVQQA---LQECSLPIFVRVAFDEAIRWKSYSPLDETVLQHTVRGAINSLFERVERQHGHVLVSRALGYVTAAKSGLTETELEDLLSCDD 589          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: nwd1 (NACHT and WD repeat domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-071116-8])

HSP 1 Score: 71.633 bits (174), Expect = 7.625e-12
Identity = 100/417 (23.98%), Postives = 180/417 (43.17%), Query Frame = 2
Query: 1403 SLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSL--NKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLS--SSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQE---NSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLV--DFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDV 2611
            +L  +L SI  QV S    V     ++     + +F+ ++    S     L I+LD +++L    H+  + W+P +LP  V +L+S  + S++F     K   L N   +  +   E  ++M   + +  ++T+      Q    LQ       PL   L+L     W+         L  + + ++   L +LE      L    + Y+AL+R GL  +EL D++SLD+ ++  V       + +  + P  +   L     + LE   TN   +I   H      V+ HY   + +G+  ++ L +++  ++ +GKL+P+        LP  S  +   R +  QP +        ++N RKL  LP  L+  G   EL + VI +  YL    S  G++ ++ +L  C Q  D 
Sbjct:  388 ALDQVLHSICLQVSSACGLVPPTPMTAGSPTELQKFFRNILEEASQQGYTLLIVLDALEQLAEQHHSHKLHWIPTNLPPKVHLLVSMDTCSEAFVNMRLKTDSLENFFEVERLSRDEGERIMESHL-RASQRTL---TAEQKDVALQSFTLTGCPLHLKLILSAVQNWTSFTPLTEQLLGNNTEEVMSQLLHRLEHKHRKELVGGALGYIALARDGLLEAELYDVMSLDDDVISEVYRYTHPPTPSLIRLPPLLWARLKRDLKDHLEERWTNGVAVIAFNHRCLSEVVLGHYLTSERQGR-CHKILGEYFLGRW-SGKLKPV-------ALPGLSL-LLSDRKVPPQPLWFAPG----LANIRKLQALPHHLLHAGLWEELRQEVI-SMSYLCYGTSVCGVSSVIHDLDQCSQYMDC 785          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 65.0846 bits (157), Expect = 9.683e-10
Identity = 114/479 (23.80%), Postives = 197/479 (41.13%), Query Frame = 2
Query: 1520 LNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILES-------------IQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSK------YENGKLRPLFEKLSEDDLPNE-------SSHMY-LKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSEL---YFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            L +S+ ++ L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D R+A   M       V++ +        +  L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ +++ GL+  EL DILSLDN    +V  D++     K P+ I  +L+ K    LE              +  N+ L + +   +Y++   + +Q+     +YF       W         Y+N     L   +S    P+        SS  Y   R    QP+    N         N RK+ EL + L   G+ ++L   VI NF +L++ +        ++++   Y C Q  ++K       L   LR +  +V+ N   LS EL  RL  +V S P +  L    D   PK  SI+   P +S++DV
Sbjct:  502 LGESSFHRPLVIVLDSLEQLSDADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELIQRD-RKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDN----IVLGDVIVATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHL-IAQKLYLSNEEDVHQMHSLLAEYF----LGAWAGGRKKIFTYDNNHFTSL--NISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELK------FLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIM---PLHSSMDV 959          

HSP 2 Score: 53.9138 bits (128), Expect = 2.203e-6
Identity = 27/106 (25.47%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLN 487
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILD 145          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 65.0846 bits (157), Expect = 9.683e-10
Identity = 114/479 (23.80%), Postives = 197/479 (41.13%), Query Frame = 2
Query: 1520 LNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILES-------------IQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSK------YENGKLRPLFEKLSEDDLPNE-------SSHMY-LKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSEL---YFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            L +S+ ++ L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D R+A   M       V++ +        +  L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ +++ GL+  EL DILSLDN    +V  D++     K P+ I  +L+ K    LE              +  N+ L + +   +Y++   + +Q+     +YF       W         Y+N     L   +S    P+        SS  Y   R    QP+    N         N RK+ EL + L   G+ ++L   VI NF +L++ +        ++++   Y C Q  ++K       L   LR +  +V+ N   LS EL  RL  +V S P +  L    D   PK  SI+   P +S++DV
Sbjct:  502 LGESSFHRPLVIVLDSLEQLSDADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELIQRD-RKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDN----IVLGDVIVATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHL-IAQKLYLSNEEDVHQMHSLLAEYF----LGAWAGGRKKIFTYDNNHFTSL--NISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELK------FLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIM---PLHSSMDV 959          

HSP 2 Score: 53.9138 bits (128), Expect = 2.203e-6
Identity = 27/106 (25.47%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLN 487
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILD 145          
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Match: nwd2 (NACHT and WD repeat domain containing 2 [Source:NCBI gene;Acc:101165765])

HSP 1 Score: 64.6994 bits (156), Expect = 1.089e-9
Identity = 114/479 (23.80%), Postives = 197/479 (41.13%), Query Frame = 2
Query: 1520 LNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSS--SSDSFYQGFKKH-YDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLL-----WSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILES-------------IQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSK------YENGKLRPLFEKLSEDDLPNE-------SSHMY-LKRNIMSQPYYTINN---SKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSEL---YFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDV 2833
            L +S+ ++ L I+LD +++L  +     + WLP  LP+ V+I++S+  +     Q  +   +D    V +   D R+A   M       V++ +        +  L + + P+F +L+      W      D  SL   +   I+     +E           + Y+ +++ GL+  EL DILSLDN    +V  D++     K P+ I  +L+ K    LE              +  N+ L + +   +Y++   + +Q+     +YF       W         Y+N     L   +S    P+        SS  Y   R    QP+    N         N RK+ EL + L   G+ ++L   VI NF +L++ +        ++++   Y C Q  ++K       L   LR +  +V+ N   LS EL  RL  +V S P +  L    D   PK  SI+   P +S++DV
Sbjct:  492 LGESSFHRPLVIVLDSLEQLSDADEARKLWWLPIQLPRTVRIVVSTLPNKHGILQKLRHLIHDDGYYVELIQRD-RKACSQMLKQQLLGVKRKVTSGQQIYVNEALAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGQRFVFRALGYITMAKAGLTEVELEDILSLDN----IVLGDVIVATYLKNPLRISYDLVAKLREELEGYLIERQVRNIALLVWANRHLHL-IAQKLYLSNEEDVHQMHSLLAEYF----LGAWAGGRKKIFTYDNNHFTSL--NISHHKNPHHQQSHEKASSDKYSYDRQTPEQPWVFQCNLLEPDIFFVNHRKMTELVYHLTRSGRTDDLMFGVIMNFSWLYTMIKIGQFEKALTDIDLAYSCSQEKELK------FLATTLRGVKVKVLKNPASLSAELQQRLLPVVASLPKLRHLLLECDKDGPKYCSIM---PLHSSMDV 949          

HSP 2 Score: 53.9138 bits (128), Expect = 2.259e-6
Identity = 27/106 (25.47%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  173 IRILLIAEESEFKVERDIINELVTPNLKKYFCNE-FNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLN 487
            +R+ + A   + + ER+ + E V P L+  FC E + I+F ++D Y     +     + Q   +  +E+C   S G   + L+G +YG +  P  +  ++F+ +L+
Sbjct:   41 VRVFICANPDDTEAERNALKEHVYPKLRD-FCRENYGIEFQVVDLYWGVDPEEWDNPELQRLRMKLLEECLKTSAGPCFVGLVGEKYGSIRVPGEVESAEFEMILD 145          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000072345.1 (SMESG000072345.1)

HSP 1 Score: 3425.18 bits (8880), Expect = 0.000e+0
Identity = 1744/1744 (100.00%), Postives = 1744/1744 (100.00%), Query Frame = 2
Query:  164 MSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDXXXXXXXXXXXXXXSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFXXXXXXXXXXXXXXXXVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDIGLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYEDPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYVKNEPLKVMNLSNGTNYSIEMDEYPDQIYMLRTGSFFMVFTNSXXXXXXXXXXXXXXXXXXXSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRNDYRKPEIPGENYFFGDDKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEESLVTGRAILTSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIRMTSKPMSEVPYKSNLDRI 5395
            MSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDIKSLIKIFLKKLELSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFEVELLLVQLRLLPAEVVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDIGLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYEDPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYVKNEPLKVMNLSNGTNYSIEMDEYPDQIYMLRTGSFFMVFTNSIKIAALKSLNKKNKNSQKNSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRNDYRKPEIPGENYFFGDDKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEESLVTGRAILTSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIRMTSKPMSEVPYKSNLDRI
Sbjct:    1 MSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSEDEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMSTSYVIHRSIINSIQTTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFISYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTSDLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNAEFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEKIKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEYAVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNVKILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKTIPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDIKSLIKIFLKKLELSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDILSRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQLLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRNIMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLFSSLSNFGINYLVSELYFCRQINDVKNNFEVELLLVQLRLLPAEVVNNAKLLSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVENLRVDIGLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQIINLGTIQNIKFTFMFYMPQRDELLLLKYEDPNNQGFLVVNVDFSNIESTIKLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILSPNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALLINVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSDGVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSCVFCHQVSHSTIVSFSTDAQFLYYYVKNEPLKVMNLSNGTNYSIEMDEYPDQIYMLRTGSFFMVFTNSIKIAALKSLNKKNKNSQKNSEILPETFHISLPKPKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKFLSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRNDYRKPEIPGENYFFGDDKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTGEKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEYPVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYFDEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMYKKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISSNETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEESLVTGRAILTSSLNSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIRMTSKPMSEVPYKSNLDRI 1744          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.171e-7
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  146 EIDSSQMSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFL 493
            +I  S   E+RI L +  S+FKVER++  + V P+L    CN++ +   + D     +   + +   +   L E++ CQ  S G   ++L+GN YG    P  L  S+F+ +   +
Sbjct:   47 DIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHS-ICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKII 161          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.354e-7
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  146 EIDSSQMSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFL 493
            +I  S   E+RI L +  S+FKVER++  + V P+L    CN++ +   + D     +   + +   +   L E++ CQ  S G   ++L+GN YG    P  L  S+F+ +   +
Sbjct:   47 DIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHS-ICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKII 161          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.358e-7
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  146 EIDSSQMSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFL 493
            +I  S   E+RI L +  S+FKVER++  + V P+L    CN++ +   + D     +   + +   +   L E++ CQ  S G   ++L+GN YG    P  L  S+F+ +   +
Sbjct:   47 DIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHS-ICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKII 161          
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.410e-7
Identity = 33/116 (28.45%), Postives = 58/116 (50.00%), Query Frame = 2
Query:  146 EIDSSQMSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDFNIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKLESPRSLTISQFDHVLNFL 493
            +I  S   E+RI L +  S+FKVER++  + V P+L    CN++ +   + D     +   + +   +   L E++ CQ  S G   ++L+GN YG    P  L  S+F+ +   +
Sbjct:   47 DIGVSPPREVRIFLSSTFSDFKVERNLFIKQVIPSLHS-ICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEIKMCQKTSIGPFFVLLIGNRYGYQPLPSELPSSEFEMIFKII 161          
The following BLAST results are available for this feature:
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NWD27.592e-2222.64NACHT and WD repeat domain containing 2 [Source:HG... [more]
NWD11.925e-1227.57NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD11.925e-1227.57NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD11.925e-1227.57NACHT and WD repeat domain containing 1 [Source:HG... [more]
NWD12.392e-1227.57NACHT and WD repeat domain containing 1 [Source:HG... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T05C3.28.569e-2021.71pep chromosome:WBcel235:V:5493747:5503010:1 gene:W... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG101857.491e-2622.93gene:FBgn0038397 transcript:FBtr0083235[more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nwd13.620e-1921.15NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd24.355e-1522.38NACHT and WD repeat domain containing 2 [Source:ZF... [more]
CU570791.34.753e-1024.10NACHT and WD repeat domain-containing protein 2-li... [more]
si:ch211-212k18.63.145e-621.01si:ch211-212k18.6 [Source:ZFIN;Acc:ZDB-GENE-130530... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ppp1r3c.11.640e-1324.38protein phosphatase 1, regulatory (inhibitor) subu... [more]
ENSXETT00000022477.12.815e-1023.56pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
hsp90ab16.363e-925.07heat shock protein 90kDa alpha family class B memb... [more]
ENSXETT00000003639.19.498e-726.88uncharacterized LOC101730828 [Source:NCBI gene;Acc... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nwd16.457e-1623.85NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd16.908e-1623.85NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd17.388e-1623.85NACHT and WD repeat domain containing 1 [Source:MG... [more]
Nwd29.792e-1522.30NACHT and WD repeat domain containing 2 [Source:MG... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9ULI1|NWD2_HUMAN5.422e-1522.56NACHT and WD repeat domain-containing protein 2 OS... [more]
sp|A6H603|NWD1_MOUSE3.942e-1327.11NACHT domain- and WD repeat-containing protein 1 O... [more]
sp|Q149M9|NWD1_HUMAN1.149e-1127.57NACHT domain- and WD repeat-containing protein 1 O... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182185400.000e+030.13tr|A0A267FTZ9|A0A267FTZ9_9PLAT AAA_16 domain-conta... [more]
gnl|BL_ORD_ID|158028400.000e+030.21tr|A0A267GWZ4|A0A267GWZ4_9PLAT AAA_16 domain-conta... [more]
gnl|BL_ORD_ID|157814000.000e+030.21tr|A0A1I8GF46|A0A1I8GF46_9PLAT AAA_16 domain-conta... [more]
gnl|BL_ORD_ID|182732150.000e+029.80tr|A0A267G0C7|A0A267G0C7_9PLAT AAA_16 domain-conta... [more]
gnl|BL_ORD_ID|171955834.688e-8625.24tr|A0A4Z2CY30|A0A4Z2CY30_SCHJA NACHT and WD repeat... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nwd15.951e-2325.16NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd12.206e-2224.68NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd21.445e-2120.75NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.616e-2120.85NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd22.672e-1421.45NACHT and WD repeat domain containing 2 [Source:NC... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405171.230e-2122.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311171.158e-2023.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471079.356e-1425.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372616.508e-1323.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349941.410e-1124.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nwd17.625e-1223.98NACHT and WD repeat domain containing 1 [Source:ZF... [more]
nwd29.683e-1023.80NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd29.683e-1023.80NACHT and WD repeat domain containing 2 [Source:NC... [more]
nwd21.089e-923.80NACHT and WD repeat domain containing 2 [Source:NC... [more]
back to top
BLAST of ATPase_AAA_core domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072345.10.000e+0100.00SMESG000072345.1[more]
SMESG000074035.13.171e-728.45SMESG000074035.1[more]
SMESG000074035.13.354e-728.45SMESG000074035.1[more]
SMESG000074035.13.358e-728.45SMESG000074035.1[more]
SMESG000074035.13.410e-728.45SMESG000074035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002600 ID=SMED30002600|Name=ATPase_AAA_core domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5501bp
GCATCATTAACTGCCATTGCCATGTCTGCTAGGTTGGTGTTGGTAACAAT
AGATAAAATTTTATTTTTCATTTAACTTTTTTTTTGTTTAATTTCATTCG
ATTTTTATGTGGAATTTTATTTGATTTATCGATTTTTCTATGGACGAAAT
CGATTCGTCACAAATGTCGGAAATCCGAATTCTTTTGATTGCGGAAGAAT
CGGAATTTAAAGTGGAAAGAGACATCATCAATGAACTCGTCACTCCAAAT
TTGAAAAAATATTTTTGTAATGAATTTAATATTGATTTTAATATTATTGA
TGCTTATCAAAATACAAGTTGTAAAAATTTACCGAAATTTGACAAACAGG
AATTTTTGTTAATGGAAATGGAAAAGTGCCAAACTTTATCTAATGGATTA
ACCTCACTGATGTTGCTGGGAAATGAATACGGAAAGCTAGAATCTCCAAG
ATCTCTGACGATCTCGCAGTTTGATCATGTACTAAATTTTCTTCAATCCA
GGAACGACTCTTCTTGGATTATTTTTAATAATAAATTCAATAAACACCAG
AAACTGGAAAAGTATATTCTGGATAACAATACTTCGGAAGACGAGCACTT
TTCCATACTCAATGCAATCGATTCAGCACTAAAAATCAAAAATGAACATT
TTCCTTCGAATTTTATTGATCAGCATTTCACTTCAAACTTAGAAAAATGT
ATAAATTGTGCGGCAAAAACTCTCGGTACGATGTCAACAAGTTACGTTAT
CCACAGATCCATCATTAATTCCATTCAAACAACAGAACCGAAAATTCCGA
CAAAAAATTTATTGCGTGAGAAATTCAATGAAAAATATGAAAACCTTTTT
AGATATGTTAAAAAAAAATTCATTCAAGAAAATTTTATTTCTTATTCTAT
AAGCAATACAACATTATTCGCGGCTGAACGGGATGTAAAAACTAACGCAA
ATAAATTGCAAACCGTTTTTGATTCCTGTAACTTTATGGCCGTCAAATCT
AGACTACTTACAAAAGACTTGAGAATAAGTTCGACATCAGATCTCTATTT
ACAAATATTCACGGAAAACCTCATGAGAATCATTCAGGATTCTTGCAAGA
AAATCTTCTTGAAAAGGGAATTTTCTCAATCCAGTTCGTTTTATGAAATG
TCAACTCACAATTTGCGCAAATCGAAAACAACCAACGCAGAATTTATAAA
CGTAATTAACCGGAATAGAGAAAGGGAAATGGCTATTTTCAACAATTATT
TAACATCAACGACTGTCAAGACCCCCGGATTGATATTTGGTCCCATTGGG
TCCGGTAAATCGAGTTTATTGTTTGAATTATCGGAGAAAATTAAAGGTTT
TCCAAGCACGAATTTAATCATTCGACGATGTGGAAATACTATTAATTCAA
GCAGTCTTCAGTTGTTGTTGGCATCAATTACTCAACAGGTTCATTCGTAT
AGTTCAAAAGTCAAATATTGTTCTCAGTCTTCGGAGTATGCGGTTTGCGT
TTATGAATTCTGGTTGAGTTTGAATAAATCTAATCCGAATAAACAATTGT
TCATTTTATTAGACGACGTCGATAGACTGTATCCGTCCAGTCACACTGAC
ATGGTCAAATGGTTGCCTCATTCTTTGCCAAAAAATGTGAAAATACTTTT
ATCATCCTCTTCGGATTCGTTTTATCAAGGATTCAAAAAACACTATGATC
TTTCAAATATAGTAAACATTCCAATGATTGATTCTCGAGAGGCCATCAAA
TTAATGACTCTTTCAATTCCACAGAACGTTGAGAAAACGATTCCTGAAGC
CATTCTTAATCAAGCAAGTTTTGTTCTGCAGGAAAATTCGACTCCTTTAT
TTTTTTCTTTATTATTATGGAGCTTGGATGTCATCGATGATCCTAATAGT
TTGAATGGTGACATTAAATCCTTAATAAAAATTTTTCTAAAAAAGCTAGA
GTTATCCACGACCCCTTTACTTTTTATTCATACGATCTCCTATTTAGCTC
TCAGTCGGTTTGGGCTTTCTTTGTCAGAATTAGTTGACATTTTGTCTCTG
GACAATAGAATAGTTCAGTTAGTTGATTTTGACATTCTGTCTAGAAATGG
TTTTAAATTTCCAGTTTACATAATAGAAGAGCTTTTAATCAAATGCTCAA
ATATTTTAGAATCAATTCAAACAAACAAACGGCTTTTAATAAGATTGAAG
CATAGTATATACATAACCACTGTCATTGAACATTACCAGTTATTACAAGA
GGAAGGTAAATATTTTTATCAGAACCTCTTTGACTTTTGGACATCAAAGT
ACGAAAACGGTAAACTCAGACCTTTATTTGAAAAGCTTTCCGAGGATGAC
TTACCAAATGAGTCGTCGCATATGTATTTGAAAAGAAATATAATGTCTCA
ACCGTACTATACGATAAATAACTCAAAAACTTTAATATCAAATGAAAGGA
AATTAATCGAGCTCCCATTTCTTCTTATTTCATATGGCAAGGCAAATGAG
TTGTATAAATATGTCATTTTCAATTTTGAATACCTCTTTTCAAGTCTTTC
TAATTTCGGAATCAACTATTTGGTTAGTGAGTTGTACTTCTGTCGGCAGA
TTAATGACGTCAAAAATAACTTCGAAGTTGAATTGCTATTGGTTCAGTTG
CGGCTTTTACCCGCCGAAGTGGTCAACAATGCTAAGCTTTTATCCACGGA
ACTAACAGGTCGCTTGTGTCATTTGGTTGGATCCAATCCGTTAATTTCTC
AGCTCCATCAACATGTCGATTCTTTGGCTCCAAAGGTCAACTCGATTTTA
TCTGCGATTCCTAATTATTCCACAATTGATGTGGAAAATCTTCGAGTAGA
CATTGGATTGAAAACGCAAATAGTTTTATCCGCTCTTTCTCCTGATAATA
GATTCATTTCTACAATTCATAGCCAAAAAGTTCCAAATGAATGGATTATA
ACAATATGGGATACCCGGTCGGCAACAAAGTCTCAAATTATCAATCTTGG
AACCATACAAAATATTAAATTCACTTTCATGTTTTATATGCCTCAACGAG
ATGAGCTATTGCTGCTTAAGTACGAAGATCCAAACAATCAAGGATTTCTC
GTTGTCAATGTTGATTTTTCTAACATTGAAAGTACAATAAAACTTCCGAA
AAAGTCTTCAATTAAACTAGAATATATTTCAAAATCGCATTTGTTTATTT
TTGTCAATGAGGAATTGCAAGTCCTTTTGGTACCAACGGGTCAGAAAGAT
CACAATCTTAGCAAACTGCCTTGGCCGACTATTCTCAGTCCAAATGATAA
GTATCTTATTGGTCCGAAACCACCGACGAAAAGAGATATTTCCGAAAAGA
ATATAAATTTCAATTTAAGAGTCATGAATGGAGTTTCTGGGGAAATGGTT
TGTCAGTTGCTTTTGAACCATAATTCGTGTGCTTTGCTTATCAATGTGAG
AAATGAAGTTATGTTTCTGTCGACAAAGTCTCATGGGATTATTTACAAAT
ATGAAATTGGTCAAATCGCTAAGAAGGATGTCAAGAAGCTTAAATTCAGC
TATCAATTGCAGATAATGGAACAGTCAACACTTTCAGATGGGGTCAGAGA
CTTGTTAATGAAATATTCCCCGAACATTAAGGCGTATAAATTATACTTAT
CAGTGGATGAAAAATATTTGTTGGCAGATTATAACTTAAATGACTCTATA
AGATTGGCAGCAGTTTGGAGTTTGACGAACAAGTCATGCGTGTTTTGCCA
TCAGGTTTCCCATTCAACAATAGTCAGTTTTTCGACTGATGCGCAATTTT
TGTATTATTACGTCAAGAATGAACCTTTAAAAGTGATGAATTTATCTAAC
GGGACAAACTACAGTATAGAAATGGATGAATACCCCGACCAAATTTACAT
GCTGCGAACTGGAAGTTTTTTTATGGTTTTTACCAATTCAATTAAAATAG
CAGCATTAAAATCGTTAAATAAAAAAAATAAAAATTCCCAAAAAAATTCT
GAAATCCTCCCGGAAACGTTTCATATAAGTTTACCGAAACCAAAAGTCAG
TTCGGAAAATGTTGTTCTATTTAGTAATGCTGAAAACACATCTCAGTTTT
TGTATTACAGTTTACTTAGCAATGCTGTTTTTAATTTGGATATCTCCCAC
ACAAATGAAAGTTTAACAGAATTTGCCAACGATAAATTCCTATCACCGGA
TGGGGAAAAGTTGTTGCTGGTTTTTGGGTTCCGTCTGGCTCAAAAGATCA
AGGAAAATAATGATCAAAATGTTGATAGATTTATGTTAAAAGTGGATCAC
AACGGATTGATAATATCTAGCAGAAATGATTATCGGAAACCGGAAATTCC
AGGGGAAAACTATTTTTTTGGCGATGACAAAGATTCCAACAAAGGTAATA
AAGAAACTCATGATGCATACTCTCAAAAGATAGTAAAAATAGTCAATCTA
AAAACTTCCCAAACAATATTTCAAGTATCTTTAACTGGAGAAAAGATTTT
AAAACTAACGGATAACATTCTTTTGACGTTCAAACCCGATTACTCAAGTC
TTACAAGAAATAATGAAGAAGCATACGATATTGTCAGTGTATATCATATA
ATAGAAGGAAAATTTGTATCTTATTTGTACATAGAATATCCTGTAATTGA
CTCAATTTTAATTCCAAAAGATAAGGAAAATCTTTTGATTTCTTGTGGAA
AAAATGGCAAGTTAATAAAAGTTTTAGGGGGAGAATATTTCTCAACAGTT
TTGCTAGAATTCGATATTCAAATTTTATTAAAATATTTTGATGAGTTTGC
CCGATCATCTTCAGTAACAAAATTATTCGTTTTCAAGGAGAACAGCAATT
CCATTTTTGTTCAGTACTCGTGGCTGGAACATAATTCTAACACTGTTAAA
TCCGACAAGGAAATTCATTATGCTAAAATAGACATGTACAAAAAGGAAAT
AGTATGTCAGTTGAGTACCGTAGGCCGTATCGTCGACGTTTCTAATGATG
GCACTATGGCAATTGACTCATTGTTGAATGTATATGAATTGTCTAAAGGA
AGTATTTTAAGGAAGTTGCAAAATTCTATTATTTCAAGCAATGAAACTTT
TTTGGGAGAATTCACGAGTCTTTTTATTAATGATGCTTCATTTGTGGCAA
CGTTAGATCCTATCAAACGAAACTTATGGATAATCTCAAATAATGAAGAA
TCTTTAGTAACTGGTCGAGCAATTTTAACTTCGTCATTAAACAGTAACCG
ATCAGATAAAACCTTTGAAATGTGTTTGGGTCTAGATGGTCGTTTCATAA
TTGTCTACAATGATCAAGAATTCAAAGTATTTGCTATTAGAATGACTTCT
AAACCTATGTCTGAAGTGCCTTATAAATCTAATTTAGATAGAATTAAAAA
ATTATTATTATAAAAAGAACTTTAAATGTTTTTGAATTCTAAATGAAAAA
TTGTAAAACCTATAAATTCATAATTTTGTCAATTATGTCGCTTGAAATGC
C
back to top

protein sequence of SMED30002600-orf-1

>SMED30002600-orf-1 ID=SMED30002600-orf-1|Name=SMED30002600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1758bp
MDEIDSSQMSEIRILLIAEESEFKVERDIINELVTPNLKKYFCNEFNIDF
NIIDAYQNTSCKNLPKFDKQEFLLMEMEKCQTLSNGLTSLMLLGNEYGKL
ESPRSLTISQFDHVLNFLQSRNDSSWIIFNNKFNKHQKLEKYILDNNTSE
DEHFSILNAIDSALKIKNEHFPSNFIDQHFTSNLEKCINCAAKTLGTMST
SYVIHRSIINSIQTTEPKIPTKNLLREKFNEKYENLFRYVKKKFIQENFI
SYSISNTTLFAAERDVKTNANKLQTVFDSCNFMAVKSRLLTKDLRISSTS
DLYLQIFTENLMRIIQDSCKKIFLKREFSQSSSFYEMSTHNLRKSKTTNA
EFINVINRNREREMAIFNNYLTSTTVKTPGLIFGPIGSGKSSLLFELSEK
IKGFPSTNLIIRRCGNTINSSSLQLLLASITQQVHSYSSKVKYCSQSSEY
AVCVYEFWLSLNKSNPNKQLFILLDDVDRLYPSSHTDMVKWLPHSLPKNV
KILLSSSSDSFYQGFKKHYDLSNIVNIPMIDSREAIKLMTLSIPQNVEKT
IPEAILNQASFVLQENSTPLFFSLLLWSLDVIDDPNSLNGDIKSLIKIFL
KKLELSTTPLLFIHTISYLALSRFGLSLSELVDILSLDNRIVQLVDFDIL
SRNGFKFPVYIIEELLIKCSNILESIQTNKRLLIRLKHSIYITTVIEHYQ
LLQEEGKYFYQNLFDFWTSKYENGKLRPLFEKLSEDDLPNESSHMYLKRN
IMSQPYYTINNSKTLISNERKLIELPFLLISYGKANELYKYVIFNFEYLF
SSLSNFGINYLVSELYFCRQINDVKNNFEVELLLVQLRLLPAEVVNNAKL
LSTELTGRLCHLVGSNPLISQLHQHVDSLAPKVNSILSAIPNYSTIDVEN
LRVDIGLKTQIVLSALSPDNRFISTIHSQKVPNEWIITIWDTRSATKSQI
INLGTIQNIKFTFMFYMPQRDELLLLKYEDPNNQGFLVVNVDFSNIESTI
KLPKKSSIKLEYISKSHLFIFVNEELQVLLVPTGQKDHNLSKLPWPTILS
PNDKYLIGPKPPTKRDISEKNINFNLRVMNGVSGEMVCQLLLNHNSCALL
INVRNEVMFLSTKSHGIIYKYEIGQIAKKDVKKLKFSYQLQIMEQSTLSD
GVRDLLMKYSPNIKAYKLYLSVDEKYLLADYNLNDSIRLAAVWSLTNKSC
VFCHQVSHSTIVSFSTDAQFLYYYVKNEPLKVMNLSNGTNYSIEMDEYPD
QIYMLRTGSFFMVFTNSIKIAALKSLNKKNKNSQKNSEILPETFHISLPK
PKVSSENVVLFSNAENTSQFLYYSLLSNAVFNLDISHTNESLTEFANDKF
LSPDGEKLLLVFGFRLAQKIKENNDQNVDRFMLKVDHNGLIISSRNDYRK
PEIPGENYFFGDDKDSNKGNKETHDAYSQKIVKIVNLKTSQTIFQVSLTG
EKILKLTDNILLTFKPDYSSLTRNNEEAYDIVSVYHIIEGKFVSYLYIEY
PVIDSILIPKDKENLLISCGKNGKLIKVLGGEYFSTVLLEFDIQILLKYF
DEFARSSSVTKLFVFKENSNSIFVQYSWLEHNSNTVKSDKEIHYAKIDMY
KKEIVCQLSTVGRIVDVSNDGTMAIDSLLNVYELSKGSILRKLQNSIISS
NETFLGEFTSLFINDASFVATLDPIKRNLWIISNNEESLVTGRAILTSSL
NSNRSDKTFEMCLGLDGRFIIVYNDQEFKVFAIRMTSKPMSEVPYKSNLD
RIKKLLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000096ventral epidermis
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 358..518
e-value: 8.3E-7
score: 30.9
NoneNo IPR availablePANTHERPTHR19871BETA TRANSDUCIN-RELATED PROTEINcoord: 13..1033
NoneNo IPR availableSUPERFAMILYSSF82171DPP6 N-terminal domain-likecoord: 914..1463
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 359..539