TBC1 domain family member 9

Overview
NameTBC1 domain family member 9
Smed IDSMED30002596
Length (bp)3638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TBC1 domain family member 9 (SMED30002596) t-SNE clustered cells

Violin plots show distribution of expression levels for TBC1 domain family member 9 (SMED30002596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TBC1 domain family member 9 (SMED30002596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TBC1 domain family member 9 (SMED30002596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30002596SMESG000015478.1 dd_Smed_v4_3646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002596SMESG000015478.1 dd_Smed_v4_3646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002596SMESG000015478.1 dd_Smed_v4_3646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002596SMESG000015478.1 dd_Smed_v4_3646_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Match: TBC1D9B (TBC1 domain family member 9B [Source:HGNC Symbol;Acc:HGNC:29097])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 409/1108 (36.91%), Postives = 608/1108 (54.87%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL------------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTK---QAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW +P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV +  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P++ +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D   LIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL                  +  +  S  +    S   A+ ++ L    S   ++     + ++K      P E+L      E  ++ +W  +F ++GRG+ M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ + ++L +  L       +   D           +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+   DEGEA   +          Q +S    HL          P ++ I EL+  +YE F ++    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+              DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLD++ D++INFKEF   +  + HG L EKL++L++L+  P L P + E   +      +  + +E++P                   E        E +  +SP   H                 + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLP---QLSEKMQDLG---------VISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTM----AGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEEALPQEE---------------QEGSGSEERGEEKGTSSPDYRH-----------------YLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1050          
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Match: TBC1D9B (TBC1 domain family member 9B [Source:HGNC Symbol;Acc:HGNC:29097])

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 410/1117 (36.71%), Postives = 610/1117 (54.61%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL------------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYI------------HAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW +P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV +  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P++ +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D   LIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL                  +  +  S  +    S   A+ ++ L    S   ++     + ++K      P E+L      E  ++ +W  +F ++GRG+ M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ + ++L +  L       +   D           +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+   DEGEA   +          Q +S    HL          P ++ I EL+  +YE F ++    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+              DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLD++ D++INFKEF   +  + HG L EKL++L++L+  P L P       +  + A          S  +   + ++  + L  E  E +              E +  +SP   H                 + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLP---QLSEKMQDLG---------VISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTM----AGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSP-------EEAESALEAAHYFTEDSSSEASPLASDLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRH-----------------YLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1067          
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Match: TBC1D9 (TBC1 domain family member 9 [Source:HGNC Symbol;Acc:HGNC:21710])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 406/1116 (36.38%), Postives = 614/1116 (55.02%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY-----DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEE---SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXX--------XXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENL------------DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HLG-------DP-DQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAES------ENPASPAKTHNFGDVQDNLSGKQRTNSHAK---LRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW NP EV +  +LW  E+ N YF+L++RKG    G  G  +        D ++DS A    YRIL +  +  + + I    S+  I + WE LE ++L  +S F N ++   F++ K+  + A   +  D +E   +E +K A VKF ++F MP EEKLVNYYSCS   G++P QGW+YLS+NH+CFYSFLMG+E +++I WV +  +EK+     P+ I + T+  E+ F+ FLNI ETF L++QLANI +++LL  EG++++  L     K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK  +   LIIP REV   E    S  L S       + T     F F NL +RD ++ +I++FL  T +     K    S +++        SS            D     +F +   + P  T+ L            +  +  E  ++  W+ +F ++G+G+ M+RT + R LVL G+   +R E+W+++SGA NE   +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L + ++       D   D           +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ+AL +L  +   L++ KD+GEA   + +  +  +          HL        +P  ++ I  LI ++YE FGT+   LI+Q+R + RL V+  +E  T R+VVR++   T    DELE L+ +FK  ++ S Y+     +    +  +DP  PY + +RID+E F  +F  L PW    H+  LA R+F+LLD++ D++INF+EF   +   CHG L EKL+LL++++  P                          SSD  + D    S  E T+   E I  E       ++ +       F  V       +R NS      LR  + E  S+  +N   LPK+     +    T+Y++ + D +E +L +A A V + + +  E+
Sbjct:    1 MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMYLSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRK-SPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKADSSSVLPSPLS----ISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSDDEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLAKEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVP---QLYDCMQDLG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLTSCYWGGSSNA----LDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDENGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLP------------------------EPSSDQDEPD----SAFEATQYFFEDITPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSK-SKNAKDLPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEV 1066          
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Match: TBC1D9B (TBC1 domain family member 9B [Source:HGNC Symbol;Acc:HGNC:29097])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 387/1071 (36.13%), Postives = 581/1071 (54.25%), Query Frame = 2
Query:  164 DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL------------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYI------------HAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV +  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P++ +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D   LIIP REV   E        SS       + T +   F F NL +RD ++ +I++FL                  +  +  S  +    S   A+ ++ L    S   ++     + ++K      P E+L      E  ++ +W  +F ++GRG+ M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ + ++L +  L       +   D           +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+   DEGEA   +          Q +S    HL          P ++ I EL+  +YE F ++    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+              DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLD++ D++INFKEF   +  + HG L EKL++L++L+  P L P       +  + A          S  +   + ++  + L  E  E +              E +  +SP   H                 + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:   47 DVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVE----KADSSSVLPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLP---QLSEKMQDLG---------VISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTM----AGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSP-------EEAESALEAAHYFTEDSSSEASPLASDLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRH-----------------YLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1067          
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Match: TBC1D9B (TBC1 domain family member 9B [Source:HGNC Symbol;Acc:HGNC:29097])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 387/1062 (36.44%), Postives = 580/1062 (54.61%), Query Frame = 2
Query:  164 DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL------------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTK---QAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV +  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P++ +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D   LIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL                  +  +  S  +    S   A+ ++ L    S   ++     + ++K      P E+L      E  ++ +W  +F ++GRG+ M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ + ++L +  L       +   D           +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+   DEGEA   +          Q +S    HL          P ++ I EL+  +YE F ++    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+              DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLD++ D++INFKEF   +  + HG L EKL++L++L+  P L P + E   +      +  + +E++P                   E        E +  +SP   H                 + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:   47 DVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLP---QLSEKMQDLG---------VISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTM----AGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSPEEAESALEAAHYFTEDSSSEEALPQEE---------------QEGSGSEERGEEKGTSSPDYRH-----------------YLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1050          
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 356/1009 (35.28%), Postives = 560/1009 (55.50%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEED--ISYEICKSNSQANIMKCWESLENDILNKVS--EFNRDEAIEFIKTKVMSMAAVEKQSVD--TEE--SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTK-IKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLK----VQSE--KLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIA---CEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKII-------------EIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSEC------------------CSHLGDPDQ-------------------LTIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRP---YYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQ 2839
            +W  P  + +  S W+ EK ++YF L++RKG  T G + L+V T D++ D++   YRI+    +ED  IS  +  +  +  I + W  +    +  +   +F +D    ++ TKV S+A   ++ V   +EE  S S +    KF K F++P +EKLVNYY C +  G++P QG L+LS+N +CF++F+MG ET+I + W  +  +E+ +    P+SI + TK  K++SF+ FLN +ETF L  QLANI +++L+ EEG+ E+  L+    ++SE  +    K S LK DLDA+ R++ +R  F LP+ E LDGD +C L T Y+++ V G+L++S NF+CFAS+    V +++P  EV +   C P++     SS   +   +     +   F  + +RD V+SKI  FL                              ++ + +S+ GR     +++     + DK+I             +  +K +  W KY  ++G G+ M+RT EL RL+L G+  +LR +IWM+ SGA  E+ LNP YY  L+ + +   S   EEIERDLHRSLPEHP +    G+ +LRR+LTAYA+RNPNIGYCQAMNIV SVLLLF  EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V  +LV+  L             T  A      + +MV++SWFLT++L+ + F  A+ I+D FF++GA+++FQ+ALE+L+ ++ ++ + +D+GE    + K +E                    + L D ++                   + I +L+ ++Y+NFG   TN  I+ LRL+NRL VV  +E N +R +++S+G+  +   +ELEAL+ V K+ ++ S  +   V +     +  +  RP       +R+DY+LF+ +F  LLPW  T    +R+FRLLD   + ++ F++ A  + I+  G   EKL L ++ +  P     D + +D       + +ES P   DG+
Sbjct:    2 VWVKPEHLILAQSFWSCEKASKYFQLQRRKGHGTRGFSSLIVATIDSVFDTRPPPYRIIYDFDDEDVHISIVLAVAVEEKEIEEHWNHVLQHFVPAIEPLQFEKD-VRRYVTTKVESLANNSEEVVSPYSEELDSVSTRSCLEKFHKSFSIPPDEKLVNYYKCCLWKGKVPAQGDLFLSVNFLCFHAFMMGNETKIKLKWTDIVRLERVSSILFPQSILVVTKEDKKFSFSMFLNFEETFQLASQLANIAMKQLIEEEGFCEDSALRRKMLMESEHRRTVKTKASFLKRDLDARHRSDAFRCQFNLPLTEKLDGDTQCRLFTPYDRRHVPGKLFVSANFVCFASRTERLVSIVVPLIEVTSIEECSPVS-----SSQTTQGILLCLRNDATVIFSAVPDRDRVLSKITVFLERGKIERTM---------------------EKAKADSERGRSSTSSSSS-----SFDKLIWDCPLIEKYPFGADASDKCREKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLL------------PTVGAQLTRLGLDDMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVVERKPSTVQLGTTILSDLEEAASTMINFMGTDITRTFPKIPIGDLLANSYQNFGYCFTNENIETLRLKNRLKVVQNLEDNQMRSIIKSIGKDCRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKMAAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNGLLTFRDLAINLSILLRGEATEKLALFYKCHLPPAFNMSDLDGLD-------SSEESSPERKDGE 959          
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 356/1009 (35.28%), Postives = 560/1009 (55.50%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEED--ISYEICKSNSQANIMKCWESLENDILNKVS--EFNRDEAIEFIKTKVMSMAAVEKQSVD--TEE--SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTK-IKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLK----VQSE--KLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIA---CEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKII-------------EIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSEC------------------CSHLGDPDQ-------------------LTIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRP---YYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQ 2839
            +W  P  + +  S W+ EK ++YF L++RKG  T G + L+V T D++ D++   YRI+    +ED  IS  +  +  +  I + W  +    +  +   +F +D    ++ TKV S+A   ++ V   +EE  S S +    KF K F++P +EKLVNYY C +  G++P QG L+LS+N +CF++F+MG ET+I + W  +  +E+ +    P+SI + TK  K++SF+ FLN +ETF L  QLANI +++L+ EEG+ E+  L+    ++SE  +    K S LK DLDA+ R++ +R  F LP+ E LDGD +C L T Y+++ V G+L++S NF+CFAS+    V +++P  EV +   C P++     SS   +   +     +   F  + +RD V+SKI  FL                              ++ + +S+ GR     +++     + DK+I             +  +K +  W KY  ++G G+ M+RT EL RL+L G+  +LR +IWM+ SGA  E+ LNP YY  L+ + +   S   EEIERDLHRSLPEHP +    G+ +LRR+LTAYA+RNPNIGYCQAMNIV SVLLLF  EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V  +LV+  L             T  A      + +MV++SWFLT++L+ + F  A+ I+D FF++GA+++FQ+ALE+L+ ++ ++ + +D+GE    + K +E                    + L D ++                   + I +L+ ++Y+NFG   TN  I+ LRL+NRL VV  +E N +R +++S+G+  +   +ELEAL+ V K+ ++ S  +   V +     +  +  RP       +R+DY+LF+ +F  LLPW  T    +R+FRLLD   + ++ F++ A  + I+  G   EKL L ++ +  P     D + +D       + +ES P   DG+
Sbjct:    2 VWVKPEHLILAQSFWSCEKASKYFQLQRRKGHGTRGFSSLIVATIDSVFDTRPPPYRIIYDFDDEDVHISIVLAVAVEEKEIEEHWNHVLQHFVPAIEPLQFEKD-VRRYVTTKVESLANNSEEVVSPYSEELDSVSTRSCLEKFHKSFSIPPDEKLVNYYKCCLWKGKVPAQGDLFLSVNFLCFHAFMMGNETKIKLKWTDIVRLERVSSILFPQSILVVTKEDKKFSFSMFLNFEETFQLASQLANIAMKQLIEEEGFCEDSALRRKMLMESEHRRTVKTKASFLKRDLDARHRSDAFRCQFNLPLTEKLDGDTQCRLFTPYDRRHVPGKLFVSANFVCFASRTERLVSIVVPLIEVTSIEECSPVS-----SSQTTQGILLCLRNDATVIFSAVPDRDRVLSKITVFLERGKIERTM---------------------EKAKADSERGRSSTSSSSS-----SFDKLIWDCPLIEKYPFGADASDKCREKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLL------------PTVGAQLTRLGLDDMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVVERKPSTVQLGTTILSDLEEAASTMINFMGTDITRTFPKIPIGDLLANSYQNFGYCFTNENIETLRLKNRLKVVQNLEDNQMRSIIKSIGKDCRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKMAAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNGLLTFRDLAINLSILLRGEATEKLALFYKCHLPPAFNMSDLDGLD-------SSEESSPERKDGE 959          
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 356/1009 (35.28%), Postives = 560/1009 (55.50%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEED--ISYEICKSNSQANIMKCWESLENDILNKVS--EFNRDEAIEFIKTKVMSMAAVEKQSVD--TEE--SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTK-IKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLK----VQSE--KLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIA---CEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKII-------------EIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSEC------------------CSHLGDPDQ-------------------LTIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRP---YYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQ 2839
            +W  P  + +  S W+ EK ++YF L++RKG  T G + L+V T D++ D++   YRI+    +ED  IS  +  +  +  I + W  +    +  +   +F +D    ++ TKV S+A   ++ V   +EE  S S +    KF K F++P +EKLVNYY C +  G++P QG L+LS+N +CF++F+MG ET+I + W  +  +E+ +    P+SI + TK  K++SF+ FLN +ETF L  QLANI +++L+ EEG+ E+  L+    ++SE  +    K S LK DLDA+ R++ +R  F LP+ E LDGD +C L T Y+++ V G+L++S NF+CFAS+    V +++P  EV +   C P++     SS   +   +     +   F  + +RD V+SKI  FL                              ++ + +S+ GR     +++     + DK+I             +  +K +  W KY  ++G G+ M+RT EL RL+L G+  +LR +IWM+ SGA  E+ LNP YY  L+ + +   S   EEIERDLHRSLPEHP +    G+ +LRR+LTAYA+RNPNIGYCQAMNIV SVLLLF  EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V  +LV+  L             T  A      + +MV++SWFLT++L+ + F  A+ I+D FF++GA+++FQ+ALE+L+ ++ ++ + +D+GE    + K +E                    + L D ++                   + I +L+ ++Y+NFG   TN  I+ LRL+NRL VV  +E N +R +++S+G+  +   +ELEAL+ V K+ ++ S  +   V +     +  +  RP       +R+DY+LF+ +F  LLPW  T    +R+FRLLD   + ++ F++ A  + I+  G   EKL L ++ +  P     D + +D       + +ES P   DG+
Sbjct:    2 VWVKPEHLILAQSFWSCEKASKYFQLQRRKGHGTRGFSSLIVATIDSVFDTRPPPYRIIYDFDDEDVHISIVLAVAVEEKEIEEHWNHVLQHFVPAIEPLQFEKD-VRRYVTTKVESLANNSEEVVSPYSEELDSVSTRSCLEKFHKSFSIPPDEKLVNYYKCCLWKGKVPAQGDLFLSVNFLCFHAFMMGNETKIKLKWTDIVRLERVSSILFPQSILVVTKEDKKFSFSMFLNFEETFQLASQLANIAMKQLIEEEGFCEDSALRRKMLMESEHRRTVKTKASFLKRDLDARHRSDAFRCQFNLPLTEKLDGDTQCRLFTPYDRRHVPGKLFVSANFVCFASRTERLVSIVVPLIEVTSIEECSPVS-----SSQTTQGILLCLRNDATVIFSAVPDRDRVLSKITVFLERGKIERTM---------------------EKAKADSERGRSSTSSSSS-----SFDKLIWDCPLIEKYPFGADASDKCREKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLL------------PTVGAQLTRLGLDDMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVVERKPSTVQLGTTILSDLEEAASTMINFMGTDITRTFPKIPIGDLLANSYQNFGYCFTNENIETLRLKNRLKVVQNLEDNQMRSIIKSIGKDCRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKMAAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNGLLTFRDLAINLSILLRGEATEKLALFYKCHLPPAFNMSDLDGLD-------SSEESSPERKDGE 959          
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 356/1010 (35.25%), Postives = 559/1010 (55.35%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEED--ISYEICKSNSQANIMKCWESLENDILNKVS--EFNRDEAIEFIKTKVMSMAAVEKQSVD--TEE--SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTK-IKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLK----VQSE--KLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIA---CEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKII-------------EIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDP--------------------------------------DQLTIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRP---YYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQ 2839
            +W  P  + +  S W+ EK ++YF L++RKG  T G + L+V T D++ D++   YRI+    +ED  IS  +  +  +  I + W  +    +  +   +F +D    ++ TKV S+A   ++ V   +EE  S S +    KF K F++P +EKLVNYY C +  G++P QG L+LS+N +CF++F+MG ET+I + W  +  +E+ +    P+SI + TK  K++SF+ FLN +ETF L  QLANI +++L+ EEG+ E+  L+    ++SE  +    K S LK DLDA+ R++ +R  F LP+ E LDGD +C L T Y+++ V G+L++S NF+CFAS+    V +++P  EV +   C P++     SS   +   +     +   F  + +RD V+SKI  FL                              ++ + +S+ GR     +++     + DK+I             +  +K +  W KY  ++G G+ M+RT EL RL+L G+  +LR +IWM+ SGA  E+ LNP YY  L+ + +   S   EEIERDLHRSLPEHP +    G+ +LRR+LTAYA+RNPNIGYCQAMNIV SVLLLF  EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V  +LV+  L             T  A      + +MV++SWFLT++L+ + F  A+ I+D FF++GA+++FQ+ALE+L+ ++ ++ + +D+GE    + K +E   + GD                                        ++ I +L+ ++Y+NFG   TN  I+ LRL+NRL VV  +E N +R +++S+G+  +   +ELEAL+ V K+ ++ S  +   V +     +  +  RP       +R+DY+LF+ +F  LLPW  T    +R+FRLLD   + ++ F++ A  + I+  G   EKL L ++ +  P     D + +D       + +ES P   DG+
Sbjct:    2 VWVKPEHLILAQSFWSCEKASKYFQLQRRKGHGTRGFSSLIVATIDSVFDTRPPPYRIIYDFDDEDVHISIVLAVAVEEKEIEEHWNHVLQHFVPAIEPLQFEKD-VRRYVTTKVESLANNSEEVVSPYSEELDSVSTRSCLEKFHKSFSIPPDEKLVNYYKCCLWKGKVPAQGDLFLSVNFLCFHAFMMGNETKIKLKWTDIVRLERVSSILFPQSILVVTKEDKKFSFSMFLNFEETFQLASQLANIAMKQLIEEEGFCEDSALRRKMLMESEHRRTVKTKASFLKRDLDARHRSDAFRCQFNLPLTEKLDGDTQCRLFTPYDRRHVPGKLFVSANFVCFASRTERLVSIVVPLIEVTSIEECSPVS-----SSQTTQGILLCLRNDATVIFSAVPDRDRVLSKITVFLERGKIERTM---------------------EKAKADSERGRSSTSSSSS-----SFDKLIWDCPLIEKYPFGADASDKCREKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLL------------PTVGAQLTRLGLDDMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESI-YEGDTVVERKPSTVQLGTTILSDLEEAASTMINFMGTDITRTFPKIPIGDLLANSYQNFGYCFTNENIETLRLKNRLKVVQNLEDNQMRSIIKSIGKDCRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKMAAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNGLLTFRDLAINLSILLRGEATEKLALFYKCHLPPAFNMSDLDGLD-------SSEESSPERKDGE 959          
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Match: tbc-9 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:A0A061ACS9])

HSP 1 Score: 498.049 bits (1281), Expect = 3.771e-157
Identity = 292/820 (35.61%), Postives = 452/820 (55.12%), Query Frame = 2
Query:  572 MGKETRIIIPWVHVRIIEKSTRYFGPESITIKTK-IKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLK----VQSE--KLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIA---CEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKII-------------EIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSEC------------------CSHLGDPDQ-------------------LTIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRP---YYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQ 2839
            MG ET+I + W  +  +E+ +    P+SI + TK  K++SF+ FLN +ETF L  QLANI +++L+ EEG+ E+  L+    ++SE  +    K S LK DLDA+ R++ +R  F LP+ E LDGD +C L T Y+++ V G+L++S NF+CFAS+    V +++P  EV +   C P++     SS   +   +     +   F  + +RD V+SKI  FL                              ++ + +S+ GR     +++     + DK+I             +  +K +  W KY  ++G G+ M+RT EL RL+L G+  +LR +IWM+ SGA  E+ LNP YY  L+ + +   S   EEIERDLHRSLPEHP +    G+ +LRR+LTAYA+RNPNIGYCQAMNIV SVLLLF  EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V  +LV+  L             T  A      + +MV++SWFLT++L+ + F  A+ I+D FF++GA+++FQ+ALE+L+ ++ ++ + +D+GE    + K +E                    + L D ++                   + I +L+ ++Y+NFG   TN  I+ LRL+NRL VV  +E N +R +++S+G+  +   +ELEAL+ V K+ ++ S  +   V +     +  +  RP       +R+DY+LF+ +F  LLPW  T    +R+FRLLD   + ++ F++ A  + I+  G   EKL L ++ +  P     D + +D       + +ES P   DG+
Sbjct:    1 MGNETKIKLKWTDIVRLERVSSILFPQSILVVTKEDKKFSFSMFLNFEETFQLASQLANIAMKQLIEEEGFCEDSALRRKMLMESEHRRTVKTKASFLKRDLDARHRSDAFRCQFNLPLTEKLDGDTQCRLFTPYDRRHVPGKLFVSANFVCFASRTERLVSIVVPLIEVTSIEECSPVS-----SSQTTQGILLCLRNDATVIFSAVPDRDRVLSKITVFLERGKIERTM---------------------EKAKADSERGRSSTSSSSS-----SFDKLIWDCPLIEKYPFGADASDKCREKWNKYLQEYGTGVCMYRTVELHRLLLEGVPLQLRGQIWMVCSGAAAEMALNPGYYRELLHKNQGVYSVALEEIERDLHRSLPEHPAFQQGPGIDALRRILTAYAFRNPNIGYCQAMNIVGSVLLLFTKEEEAFWLLVAVCERLLPDYYNTKVVGALVDQGVFSELVERLL------------PTVGAQLTRLGLDDMVALSWFLTVFLSAIKFDAAVRILDLFFFEGARLMFQVALEMLKENEKLICESRDDGEILMSLAKYTESIYEGDTVVERKPSTVQLGTTILSDLEEAASTMINFMGTDITRTFPKIPIGDLLANSYQNFGYCFTNENIETLRLKNRLKVVQNLEDNQMRSIIKSIGKDCRFTNEELEALYNVVKEEHLLSWRHRLGVSARGKMAAVTERPRPDPCAQSQYRLDYDLFSEVFPRLLPWPVTNIFIIRVFRLLDISDNGLLTFRDLAINLSILLRGEATEKLALFYKCHLPPAFNMSDLDGLD-------SSEESSPERKDGE 770          
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Match: CG7324 (gene:FBgn0037074 transcript:FBtr0331797)

HSP 1 Score: 500.36 bits (1287), Expect = 6.539e-156
Identity = 320/947 (33.79%), Postives = 518/947 (54.70%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXX-XXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIK-EYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSR---LKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEA-SSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSH-------LGDPDQL-------TIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVA------SSYYTNHVVSPAPDMSSYDPIRPY---------YDAFRIDYELFARLFTSLLPWGH--TKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCL 2752
            MW  P E+ +  + W  E  ++YFVL+KR+G         +LVGTYD+++++K   YRIL +    ++SYEI    +Q  I+K WE L+ ++   + E  N DE   F   K+ S+     Q  DT ES  +K    KF +IF MP EE+LV  YS + +  +IP QG LY+SLNH+CFYS+++G+E + II +  +  I ++       +I +KT     Y+FT   N  +   LI+QL  + IQ+L+ +              +L  +K S+   L  DL A+ ++ E+R  FRLP +EI+DG I+  + T Y+K+  SG +Y+S NF CF S + D V ++IP + + + E          N I    +IT+ +  F F ++ +R ++ISKI + L           + V    +   AK D+  SK+    +    F  +++          +II+ + ++   WE +F D GRG+ MFRT ++  L++ G+ +KLR EIW+I SGA ++  +NP  Y  LV +     + F  +EI+RDL RSLPEHP + + +G+ +LRRVL AYA RNP +GYCQAMNIV+SV LLFC+EE AFW+L ++CE LLPDYY  KV+G ++DQ VL +LV++HL       +               +I+M+SISWFLTI+++V+S+ ++++I+DCFFY+GA++IF I+L+++  ++  L+  +D+GEA   +Q   E   +         D  ++       T++ LI  AY  FG  +T   I++LR ++R   + + + +  + +V++  ++    + EL  L  + ++   A              +S  P +      RP          Y+A+ + YE+F  LFT L PW    +  +  ++FRL D+    +++F +    +G++C     EKL+LL+ L+  P L
Sbjct:    1 MWIQPKELLLPSAFWIAEMHSRYFVLQKRRGHGESRGFGSMLVGTYDSVMNTKPAPYRILHQTPSSEVSYEIAIGITQDEIVKDWEWLKANLFKVLDEMENEDEVTNFTICKIQSLYTQNNQD-DTGESADFKVMKSKFRQIFKMPEEERLVISYSATYVKNKIPRQGQLYISLNHVCFYSYMLGQEIKRIIRFAELEDISRNAN-----TIYLKTTNNMTYNFTMLFNASDAHLLIEQLNKMAIQQLIHDPDSPVVDHDTSNFSRLG-SKTSKKPVLLRDLTARQKSEEFRIYFRLPQSEIIDGKIKANIWTPYSKRFNSGFIYLSPNFFCFRSDVKDLVSVVIPMKTIKSVEKKDDGQQRFENQI---VIITSENVPFMFAHIVDRAVLISKITDLL-----------ARVHVPLSRERAKYDISWSKQ---TALMNTFKTQFSA---------EIIQKQEEKMVRWEAHFRDFGRGIGMFRTTDVINLIVEGIPDKLRQEIWLIFSGAIHDKEMNPGLYEDLVEKAACIKNCFAHDEIDRDLPRSLPEHPAFQSTDGIGALRRVLQAYALRNPQVGYCQAMNIVSSVFLLFCDEENAFWMLASLCENLLPDYYKDKVVGAQIDQGVLNELVETHLPDLHGHLEQLG------------VIKMISISWFLTIFMSVISYESSLHILDCFFYEGAKIIFMISLQIIEWNRDKLLICQDDGEAMLVLQNYLEGVYNPEYQVPPTTDKRKMERKVQTQTVQTLIHEAYTKFGEDITQQRIEELRNKHRRLTMRQFDIDNEKTIVKAYVQNPYFNRSELHMLLTIIREEKHALKSLQQQQQKVQCPLSETPQLVPQSTSRPIQDAGASGGRYEAYSVSYEVFHTLFTELTPWRKCVSVDIGEKLFRLTDKKGTGVLDFGQLINALGLVCSNKNMEKLKLLYVLHLPPLL 902          
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Match: CG7324 (gene:FBgn0037074 transcript:FBtr0078404)

HSP 1 Score: 501.13 bits (1289), Expect = 7.035e-156
Identity = 320/947 (33.79%), Postives = 518/947 (54.70%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXX-XXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIK-EYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSR---LKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEA-SSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSH-------LGDPDQL-------TIEELIGSAYENFG-TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVA------SSYYTNHVVSPAPDMSSYDPIRPY---------YDAFRIDYELFARLFTSLLPWGH--TKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCL 2752
            MW  P E+ +  + W  E  ++YFVL+KR+G         +LVGTYD+++++K   YRIL +    ++SYEI    +Q  I+K WE L+ ++   + E  N DE   F   K+ S+     Q  DT ES  +K    KF +IF MP EE+LV  YS + +  +IP QG LY+SLNH+CFYS+++G+E + II +  +  I ++       +I +KT     Y+FT   N  +   LI+QL  + IQ+L+ +              +L  +K S+   L  DL A+ ++ E+R  FRLP +EI+DG I+  + T Y+K+  SG +Y+S NF CF S + D V ++IP + + + E          N I    +IT+ +  F F ++ +R ++ISKI + L           + V    +   AK D+  SK+    +    F  +++          +II+ + ++   WE +F D GRG+ MFRT ++  L++ G+ +KLR EIW+I SGA ++  +NP  Y  LV +     + F  +EI+RDL RSLPEHP + + +G+ +LRRVL AYA RNP +GYCQAMNIV+SV LLFC+EE AFW+L ++CE LLPDYY  KV+G ++DQ VL +LV++HL       +               +I+M+SISWFLTI+++V+S+ ++++I+DCFFY+GA++IF I+L+++  ++  L+  +D+GEA   +Q   E   +         D  ++       T++ LI  AY  FG  +T   I++LR ++R   + + + +  + +V++  ++    + EL  L  + ++   A              +S  P +      RP          Y+A+ + YE+F  LFT L PW    +  +  ++FRL D+    +++F +    +G++C     EKL+LL+ L+  P L
Sbjct:    1 MWIQPKELLLPSAFWIAEMHSRYFVLQKRRGHGESRGFGSMLVGTYDSVMNTKPAPYRILHQTPSSEVSYEIAIGITQDEIVKDWEWLKANLFKVLDEMENEDEVTNFTICKIQSLYTQNNQD-DTGESADFKVMKSKFRQIFKMPEEERLVISYSATYVKNKIPRQGQLYISLNHVCFYSYMLGQEIKRIIRFAELEDISRNA-----NTIYLKTTNNMTYNFTMLFNASDAHLLIEQLNKMAIQQLIHDPDSPVVDHDTSNFSRLG-SKTSKKPVLLRDLTARQKSEEFRIYFRLPQSEIIDGKIKANIWTPYSKRFNSGFIYLSPNFFCFRSDVKDLVSVVIPMKTIKSVEKKDDGQQRFENQI---VIITSENVPFMFAHIVDRAVLISKITDLL-----------ARVHVPLSRERAKYDISWSKQ---TALMNTFKTQFSA---------EIIQKQEEKMVRWEAHFRDFGRGIGMFRTTDVINLIVEGIPDKLRQEIWLIFSGAIHDKEMNPGLYEDLVEKAACIKNCFAHDEIDRDLPRSLPEHPAFQSTDGIGALRRVLQAYALRNPQVGYCQAMNIVSSVFLLFCDEENAFWMLASLCENLLPDYYKDKVVGAQIDQGVLNELVETHLPDLHGHLEQLG------------VIKMISISWFLTIFMSVISYESSLHILDCFFYEGAKIIFMISLQIIEWNRDKLLICQDDGEAMLVLQNYLEGVYNPEYQVPPTTDKRKMERKVQTQTVQTLIHEAYTKFGEDITQQRIEELRNKHRRLTMRQFDIDNEKTIVKAYVQNPYFNRSELHMLLTIIREEKHALKSLQQQQQKVQCPLSETPQLVPQSTSRPIQDAGASGGRYEAYSVSYEVFHTLFTELTPWRKCVSVDIGEKLFRLTDKKGTGVLDFGQLINALGLVCSNKNMEKLKLLYVLHLPPLL 902          
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Match: CG12241 (gene:FBgn0038304 transcript:FBtr0083051)

HSP 1 Score: 145.976 bits (367), Expect = 2.852e-35
Identity = 89/287 (31.01%), Postives = 153/287 (53.31%), Query Frame = 2
Query: 1460 RTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHT--DEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLR 2311
            RT +LR +V  G+ + LRA++WM +SGA  +   +   Y  +V  +       S++IE+DL R LP +  +      G+  LRR+L   A+  P+IGYCQ   ++ + LLLF  EE AFW++  I E LLP  YY+  ++G++ DQ V+  L+ ++L    S +++        S        ++++ WFLT++ NV+     + I D FFY+G+ V+FQ+ L +L+  +    D+K    +++    LS+    + D     +E L   A E  G+++ ++I   R
Sbjct:  153 RTEKLRNMVRQGIPHTLRAQMWMRLSGALAKKQKSETSYHDIVKASSNDQLMTSKQIEKDLLRILPTNACFSNPNGTGIPRLRRILRGIAWLFPDIGYCQGTGVIVACLLLFMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYLS---SVDESLRKHDIELS--------LITLHWFLTLFANVVHMKILVRIWDWFFYEGSIVLFQLTLGMLKVKEQ---DLKHLENSAQIFNSLSDIPGEVTD-----VEVLFRQALEVGGSLSQTVIDTHR 420          
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Match: CG5916 (gene:FBgn0038401 transcript:FBtr0344009)

HSP 1 Score: 115.546 bits (288), Expect = 1.974e-27
Identity = 72/269 (26.77%), Postives = 133/269 (49.44%), Query Frame = 2
Query: 1373 LDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEE-AFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEM----VSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKD 2164
            +D  ++   +R+  WE   +     ++     +L+R +  G+    R ++WM +SGA      +PD +  L+ +TE     +S+ I  DL R+ P++   H D     L  +L AYA+ N ++GYCQ +N +A +LL+  ++EE +FWLL  I E ++P Y++  +  +  D  V ++LV   +               PA N   + + +    ++  WF+ I+  V+     + I DC F +G +++F+ AL +   HK  ++   D
Sbjct:   32 MDGYLKTLTRRRMKWEA-ILQQNTDLTQV-DAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISDSISIDLPRTFPDN--IHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRI---------------PAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDD 280          
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Match: CG5916 (gene:FBgn0038401 transcript:FBtr0083251)

HSP 1 Score: 115.546 bits (288), Expect = 1.974e-27
Identity = 72/269 (26.77%), Postives = 133/269 (49.44%), Query Frame = 2
Query: 1373 LDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEE-AFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEM----VSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKD 2164
            +D  ++   +R+  WE   +     ++     +L+R +  G+    R ++WM +SGA      +PD +  L+ +TE     +S+ I  DL R+ P++   H D     L  +L AYA+ N ++GYCQ +N +A +LL+  ++EE +FWLL  I E ++P Y++  +  +  D  V ++LV   +               PA N   + + +    ++  WF+ I+  V+     + I DC F +G +++F+ AL +   HK  ++   D
Sbjct:   32 MDGYLKTLTRRRMKWEA-ILQQNTDLTQV-DAKLKRYIRKGIPGPYRPDVWMKISGAAAAQRRSPDLFRNLL-RTEPFDKEISDSISIDLPRTFPDN--IHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYIAGLLLIVTDDEEKSFWLLKHIVENIVPQYHSHNMANLLRDLAVFRELVIRRI---------------PAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWDCVFAEGYKIVFRAALTMFVTHKNAILGCDD 280          
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Match: tbc1d9 (TBC1 domain family, member 9 (with GRAM domain) [Source:ZFIN;Acc:ZDB-GENE-060810-33])

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 407/1110 (36.67%), Postives = 620/1110 (55.86%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY--DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEE---SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKE-------------IRDNSQTGRFMIKYANAPKPT------------ENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HL-------GDPD-QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW NP EV +  +LW  E+ N YFVL+KRKG   GG     +     D ++DS A    YRIL +  +  + + I   +S+  I + WE LE ++L  +S F N ++   F+K K+  + A   +S D +E   ++ +K A  KF K+F MP EEKLVNYYSCS   G++P QGWLYLS+NHICFYS+L+GKE ++++ W  V  +EKS     P+ + + T+  E+ F+ FLNI ETF L++QLANI +++LL  +G++++ +   + +K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK      LIIP REV   E        SSN + +P  I+T +   F F NL +RD ++ +I++FL  T +     +    S S++     D V S++             + +     +F +     P  T            E  +  +  E  ++  W+ +F ++G+G+ M+RT + + LVL G+   +R E+W++ SGA NE+  +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L   H+           D           +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ+AL +L  +   L+  KD+GEA   + +  +  +          HL       G+P  ++ I +L+ S+YE FG++   +I+Q+R + RL V+  +E  T R+VVR++   T    DELE L+ +FK  ++ S Y+     S +  MS +DP  PY + +RID E F  LFT L PW    H   LA R FRLLD + D +INF+EF   + ++CHG L EKL+ L++++  P L    +E         Y  ++  P +S G                 L++     ++      T     V+   +   RT  + +L +   +E    + N   LPK+     +    TLY++ + D +E +L +A A V + + +  E+
Sbjct:    1 MWVNPEEVLLASALWMTERANPYFVLQKRKGHGDGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIAHGSSRKEITENWEWLEQNLLQTLSIFENENDITTFVKGKIQGIIAEYNKSHDIKEDDDTDKFKEAIAKFRKLFVMPEEEKLVNYYSCSYWKGKVPRQGWLYLSINHICFYSYLLGKEVKLVVRWADVTQLEKSATLLLPDMVRVSTRCSEHVFSVFLNINETFKLMEQLANIAMRQLLDNKGFEQD-RSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEETVCSLIIPLREVTIVEKAD-----SSNVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFLQQTTSKIYFEREITGSLSSSD----DEVYSQQGSVLSCSPQRSALVSEGESERQFNLNDNRVPTATQALMTMYRRRSPEEFNPKLAKEFLKEQAWKNHFTEYGQGVCMYRTDKTKDLVLQGIPENMRGELWLLFSGAINEMATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVAMCERMLPDYYNTRVVGALVDQGVFEELAHVHVP-------QLYDCMQALG-----VISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALSVLDANIHQLLGCKDDGEAMTILGRYLDSVTNKDSTLPPIPHLHSLLTDNGEPHPEVDIFKLVRSSYEKFGSIRADVIEQMRFKQRLRVIQAIEDTTKRNVVRTIVTETPFSIDELEELYSLFKAEHLTSCYWG----SSSNPMSRHDPSLPYLEQYRIDLEQFKGLFTLLFPWACGSHADDLAFRFFRLLDHNTDALINFREFISGLSVLCHGDLTEKLKFLYKIHILPELHHEQEEPDSACEATQYFFEDITPETSSG-----------------LDHKSRSEKDDGFVRVTFKNEKVKKTHTADYRT--YLRLWN---QETKAKLENMKDLPKLNQSQFIELCKTLYNMFSEDPNEQELYHATATVTSLLLEMGEV 1062          
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Match: tbc1d9 (TBC1 domain family, member 9 (with GRAM domain) [Source:ZFIN;Acc:ZDB-GENE-060810-33])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 404/1095 (36.89%), Postives = 602/1095 (54.98%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL--IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQT------GRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRT-NSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N YF+L++RKG   GG    L VGT D ++DS A    YRIL +  E  I + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +    +E E    ++ A +K  K+F MP EEKLVNYY CS   GR+P QGW+YLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PESI + T+  E+ F+ FLNI ETF L++QLANI +++LL  E +  +  L   + K   N VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICF S+  D  +LIIP REV   E    S  L S       + T     F F NL +RD ++ +I++FL              + S  +  S   L + +S +++  S +      G   I   + P   E L   +  E  ++ +W+ +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV Q     +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL          P ++ + ELI ++YE FG++   +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     +PA     +DP  PY + +RID   F +LF++L PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + EKL+LL++L+  P L P +                               ES +E T+   +    + E       +   GD  D    K +    + ++ +   E   + I++   LP+M  +  +    TLY++ + D  E +L + +A V + + +  E+  K
Sbjct:    1 MWITPEEVLLANALWVSERANPYFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGESQIFWNIACGSSRKEITEHWEWLEANLLQTLSIFDNDDDITTFVKGKIQGIIAEENKGGKPQEDEDPGKFREAELKMRKLFGMPEEEKLVNYYPCSYWKGRVPRQGWIYLSVNHLCFYSFLLGKEVSLVVQWTDVTQLDKNATLVFPESIRVSTRDTEHFFSMFLNINETFKLMEQLANIAMRQLLDNESFAADRSLPKPANKTLKN-VSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFTSREEDLCQLIIPLREVTIVEKADSSSVLPSPLS----ISTKNKMTFLFANLKDRDFLVQRISDFLQRTPDGPCGVLQSENPSPSTPPSPPVLSLSESAQMQHYSPSLPTARKGLLQIYQQDVP---EELGPKVTRERMKEESWKIHFFEFGRGVCMYRTSKTRELVLNGIPESLRGELWLLFSGAQNEMATHPGYYGNLVEQAMGRCTLATEEIERDLHRSMPEHHAFQNETGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMDQLLSCSDEGEAMTILGRYLDNVVNKQTVSPPIPHLHALLTSGNNPPPEIDVFELIKASYEKFGSLRADVIEQMRFKQRLKVIQSLEDTAKRSVVRAIMTESAFTIEELEELYVLFKAKHIMSCYW-GASSTPA---ERHDPSLPYLEQYRIDCGQFVQLFSALAPWSCGLHTHTLSSRLFRLLDHNKDSLINFKEFVTGLSGMYHGDMTEKLKLLYKLHLPPALCPEE------------------------------AESALEATQFFTDDDTPQGEELKEAGDSAAAGDTDDRKEEKPKDYKYYLRMWAKEKEPKKKSIKD---LPRMNQEQFIEMCKTLYNMFSEDPLEQELYHGIATVASLLLRIGEVGKK 1038          
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Match: tbc1d9 (TBC1 domain family, member 9 (with GRAM domain) [Source:ZFIN;Acc:ZDB-GENE-060810-33])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 408/1098 (37.16%), Postives = 607/1098 (55.28%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL--IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQT------GRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTE---SGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRT-NSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N YF+L++RKG   GG    L VGT D ++DS A    YRIL +  E  I + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +    +E E    ++ A +K  K+F MP EEKLVNYY CS   GR+P QGW+YLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PESI + T+  E+ F+ FLNI ETF L++QLANI +++LL  E +  +  L   + K   N VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICF S+  D  +LIIP REV   E    S  L S       + T     F F NL +RD ++ +I++FL              + S  +  S   L + +S +++  S +      G   I   + P   E L   +  E  ++ +W+ +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV Q     +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL          P ++ + ELI ++YE FG++   +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     +PA     +DP  PY + +RID   F +LF++L PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + EKL+LL++L+  P L P + E   + T Q +   ++          D   +   SG EL E                  +   GD  D    K +    + ++ +   E   + I++   LP+M  +  +    TLY++ + D  E +L + +A V + + +  E+  K
Sbjct:    1 MWITPEEVLLANALWVSERANPYFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGESQIFWNIACGSSRKEITEHWEWLEANLLQTLSIFDNDDDITTFVKGKIQGIIAEENKGGKPQEDEDPGKFREAELKMRKLFGMPEEEKLVNYYPCSYWKGRVPRQGWIYLSVNHLCFYSFLLGKEVSLVVQWTDVTQLDKNATLVFPESIRVSTRDTEHFFSMFLNINETFKLMEQLANIAMRQLLDNESFAADRSLPKPANKTLKN-VSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFTSREEDLCQLIIPLREVTIVEKADSSSVLPSPLS----ISTKNKMTFLFANLKDRDFLVQRISDFLQRTPDGPCGVLQSENPSPSTPPSPPVLSLSESAQMQHYSPSLPTARKGLLQIYQQDVP---EELGPKVTRERMKEESWKIHFFEFGRGVCMYRTSKTRELVLNGIPESLRGELWLLFSGAQNEMATHPGYYGNLVEQAMGRCTLATEEIERDLHRSMPEHHAFQNETGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMDQLLSCSDEGEAMTILGRYLDNVVNKQTVSPPIPHLHALLTSGNNPPPEIDVFELIKASYEKFGSLRADVIEQMRFKQRLKVIQSLEDTAKRSVVRAIMTESAFTIEELEELYVLFKAKHIMSCYW-GASSTPA---ERHDPSLPYLEQYRIDCGQFVQLFSALAPWSCGLHTHTLSSRLFRLLDHNKDSLINFKEFVTGLSGMYHGDMTEKLKLLYKLHLPPALCPEEAESALEAT-QFFTDDDTPQDPPFLSHLDFLAQEVTSGEELKEA---------------GDSAAAGDTDDRKEEKPKDYKYYLRMWAKEKEPKKKSIKD---LPRMNQEQFIEMCKTLYNMFSEDPLEQELYHGIATVASLLLRIGEVGKK 1055          
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Match: tbc1d8b (TBC1 domain family member 8B [Source:NCBI gene;Acc:566657])

HSP 1 Score: 507.679 bits (1306), Expect = 6.350e-160
Identity = 313/922 (33.95%), Postives = 499/922 (54.12%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXX--XXXXXXXXXXXXXYDNIIDS--KATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVEKQSV-DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDP-----------------DQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEE 2710
            MW  P EV +     LW  EK N YFVL++R+G  + +GGLTGLLVGT D ++DS  K   +RIL +  +  + + I    S   I + W+ L+ +I+  +S F+  E I  F++ K+  + A E  S  D E+ E ++ A ++F ++F +P  EKLV Y+SCS   GR+P QGW+YLS N +CFYS+++G E +++ PW  V  +E+++     ESI ++ + +++ F+  L +Q+T+ ++QQLA+  I +   +E +  E+ L       NP  +++  L++ A  RN  +R  FRLP  E L    E  L   ++     G++ +S N++CFAS+   Q  LIIP  EV        S+ L   + +   V      A  F  + + + + + I               S     +      + V  S+ +   +    F       P   ENLD  +  E  ++ +W+ +F ++GRG  MF T + R L++ G+   LR E+WM+ SGA ++++ +P YY  L+     SSS   +EIERDLHRSLPEHP + +D G+S+LRRVLTAYA+RNP IGYCQAMNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N ++IG  VDQ V ++L++ HL       +   D +             VS+SWFLT++++V+   +A+ ++DCFFYDG + I Q+ L +L  +   L+   D+ EA   + +  +  ++   P                  ++ I +LI  AYE +G +    ++ +R +N+L V+  +E  T ++V+R V +  K    +L+ L+ +FK+                     +DP  PY D +++D   F+ LF  L PW    H++ LA   F LLD++ D ++NFKEF   + I+ + +  E
Sbjct:    1 MWLKPEEVLLKNALKLWVTEKSNDYFVLQRRRGYGEDSGGLTGLLVGTLDTVLDSTAKVAPFRILHQTPDSQVYWTIACGASLEEISQHWDWLQQNIVRTLSVFDSGEDITSFVQGKIRGLIAEEGTSAGDEEDPERFREAVLRFERLFGLPQREKLVTYFSCSYWRGRVPNQGWIYLSTNFLCFYSYMLGNEVKLVYPWDEVSRLERTSSVLLAESIRVRVRGEDHFFSMLLRLQQTYLIMQQLADYAIVRFFDKETFHAEHPLA------NPLHITQRALEIHA--RNQSFRSFFRLPQEENLCEVYESFLWVPFSHVNTLGKICVSENYLCFASQDGSQCHLIIPLWEVF-------SVELPDRSSRALTVCLRGKRALRFSEVRDFERLAATIRR-------KCGTLGSPQHCITNPDEEGVMVGQSQAVSTEALMNVFH------PHDAENLDPKMLKERMKEQSWQIHFAEYGRGTGMFCTKKTRDLIVRGVPETLRGELWMLFSGAVHDMISHPGYYGRLLEDCMGSSSLACDEIERDLHRSLPEHPAFQSDTGISALRRVLTAYAHRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQAVFEELIREHL---TQLTEHMTDLSF---------FSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAVLDYNMDNLLCCNDDAEAVTVLNRFFDSVTNKDSPLPATVQQASATANDKSIQKVDISDLIKEAYEKYGDIRTEEVENMRKRNKLYVIQTLEDTTKQNVLRVVAQDVKFSASQLDELYLLFKN---------------------HDPSLPYLDQYQLDQSQFSSLFNLLQPWTTHTHSRSLARSAFHLLDENGDGLVNFKEFICGLDILYNRSFTE 861          
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Match: LO018176.1 (TBC1 domain family member 8 [Source:NCBI gene;Acc:100333881])

HSP 1 Score: 480.715 bits (1236), Expect = 9.897e-151
Identity = 334/1094 (30.53%), Postives = 530/1094 (48.45%), Query Frame = 2
Query:  164 DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVE---KQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITT-TSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXX------LDVVDSKE---------------IRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEA-------SECIQKLSECCSHL---GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQD---NLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKT---EKDWVINFEEFRHSFYSEPGLVEFLGSKQDISS 3304
            D ++DS A    +RI+L   E  +S+ I    +   +MK W+ L+ ++L  ++ F N+++A  F++ KV  + A E    Q+   ++   ++   V+F + F +P  EKLV +YSC     R+P QG LYL+ NH+ FYSFL+GKE ++++PW  V  +E+ +     + I + T+ K   F+ F+N++E   ++ QLA+I +++LL   G   +  L+        +  +  K  L+ Q         F LP  E L   + C+L T + +   SG +Y +  ++CF+S+   Q  LIIP  E+++ E        S+  +  P +I+     AF    L  RD ++ K+   L   +      +          S+        D + S E               +  N+    F    ++A   T N +++      R+  W+ +F + GRG+ MFR+ ++R LV  GL   LR E+W+  S A + L  +P+YY  L+ +    SS  +EEIERDLHRSLPEHP + ++ G+S+LRRVLTAYAYRNP+IGYCQ+MNI+ASV+LL+  EEEAFWLLV +CER+LPDY+N +VIG +VDQ+V ++L++  L  DL+      D +  AS          S++WFLT++++V+ F +A+ ++D FFY G + IFQI+L +L  + A L    D+G A        E ++   E   HL   G    L I  LI  AYE F +V+   ++Q+R  +RL V+   E  +               KD     F         S Y+   V       ++     PY+    +D   F  LF  L PW    HT  LA R F LLDQD D  ++F EF  ++ ++    L EK+RLL+RL+  P L                                                  +E    +SP K+      +    NL   +R +   +L+    + NS+       LP M   + + F  TLY +   ++ ES+L  A+    + + Q  E R  +   ++ W ++F++   SF +E  LV FL    D+S+
Sbjct:   26 DTVLDSNARVAPFRIVLHVPESQLSWVIASGGTIEEVMKHWKWLDQNLLPYMAVFENKEDAASFVQGKVKGLIAEEVLGGQAAHEDDPARFREDLVRFEQRFGLPQREKLVVHYSCCCWKSRVPRQGSLYLTTNHMAFYSFLLGKEVKLLVPWAEVTRLERVSVGVLTDVIRVHTRRKHREFSMFMNVEEVMMVMCQLADIALRRLLDSGGLTLDQALQ--------DFTNITKRVLEEQALRQYVLSLFGLPRGEQLQEVMSCSLWTPHARCHTSGTVYTTDGYLCFSSRQEGQCALIIPLAEIVSVEKAD-----STAALPNPLIISVRCKRAFQLIELQQRDTLVEKLRERLRELHWRQAVIRGHEQRKKTTVSSTPYYTFCYDTIQSDEEDGSVSISDKALRHTVLSNTLLSSFHPSQSDASG-TRNTEQV------RERLWQDHFSEFGRGVHMFRSEKIRTLVSLGLPESLRGELWLHFSDASSSLAAHPNYYADLLEKCRGESSVATEEIERDLHRSLPEHPAFQSETGISALRRVLTAYAYRNPSIGYCQSMNILASVMLLYLREEEAFWLLVTVCERMLPDYFNRRVIGAQVDQSVFEELIRERLP-DLA--AAVGDVSPLAS---------ASLTWFLTLFVSVLPFRSALCVLDGFFYQGIRAIFQISLAVLEANAAELSGCTDDGYALIILSTFLERVRHEDESADHLENAGASQHLNITNLITDAYEKFSSVSVKQLEQMRCLHRLQVLQAHEDTS---------------KDNATEHF--------ISLYWGESVC--CSAAAASSSTEPYF----LDGAQFKSLFELLAPWPCGTHTDTLAQRAFTLLDQDRDQRVSFSEFIHMLDVLYCEELNEKIRLLYRLHIPPAL--------------------------------------------------SEDSEDSSPLKSPVLSSTRPLYVNLPNGERKSYEEQLQQMLEDLNSRKKDQEKPLPHMNQREFIQFCKTLYSMFQGESSESELFQAIGMFTSLLLQIGEARQHSDAADEQWTVSFQQILASFLTEQVLVNFLERPVDLSA 1008          
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Match: tbc1d9b (sterol 26-hydroxylase, mitochondrial [Source:Xenbase;Acc:XB-GENE-984298])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 406/1105 (36.74%), Postives = 614/1105 (55.57%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL--IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYAN---APKPTENLDKIIE------------IENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW NP EV +  +LW  E+ N +F+   +R     GGL+GLLVGT D ++DS A    YRIL +  E  + + +   +S+  I + WE LEN++L  +S F  +E I  F+K K+  + A E +S+   D E+   ++ A VK  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +II W+ V  ++K+     PE IT+ T+  E+ F+ FLNI ETF L++QLANI +++LL  EG+ E+  L      L   K S LK DLDA+ +N  YR +FRLP +E LDG  +C L T + K  + G++++S N+ICF+SK  +   LIIP REV   E    S  L S       + T     F F NL +R+ ++  I++FL   +           +   +A ++   +  +         +  F     N   AP  +  L K+ +             E  ++ +W  +F+++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    +  ++EIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+CNEEEAFWLLV++CER+LPDYYN +V+G  VDQ V ++L + +L                 S  + E  +I  +S+SWFLT++L+VM F +A+ ++DCFF++G ++I Q++L +L  +   L++  DEGEA   +          Q +S    HL      GD  P ++ I ELI ++YE F  + +  I+Q+R + RL V+  +E    R +VR++        +ELE L+ +FK  ++ + Y+  +  S     S +DP  PY + +RID + F  LF  L PW    H   LA RIFRLLD + D++INFKEF   +G + HG + EKL+ L++L+  P L P + E   + T  ++  ++  P  SDGQ  +     G                   SP K        +  +       + ++ ++  E+  + I++   LPKM  +  +    T Y++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWLNPEEVLLANALWVTERANPFFLLQRRRGHGKGGGLSGLLVGTLDVVLDSSARVAPYRILHQTQESQVYWTVACGSSRKEITEHWEWLENNLLQTLSIFENEEDITTFVKGKIHGIIAEENKSLQPKDEEDPGKFREAEVKMRKQFGMPEVEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVTLIIQWLDVTQLDKNATLLFPECITVSTRDSEHYFSMFLNISETFKLMEQLANIAMRQLLDNEGFHEDRNLSKPKRSL--KKTSALKRDLDARAKNERYRATFRLPRDERLDGHTDCTLWTPFAKMHIPGQMFVSNNYICFSSKEEEACLLIIPLREVTIVEKADSSSVLPSPLS----ISTKAKMTFLFANLKDRNFLVQLISDFLQKTSAQRVKGDCTGEILKGNAQNNGCEEATNPSPSSSTDVSPTFSTPQNNGSDAPTASHGLLKLFQREITEDMKPKWDKEKMKEESWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWLLFSGASNEMVTHPGYYADLVEKSMGRCNLATDEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYCNEEEAFWLLVSLCERMLPDYYNTRVVGALVDQGVFEELTRLYL--------------PQLSEKMQELGVISTISLSWFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVLEANMESLMNCMDEGEAMTILGRYLDNVLNKQSVSPPIPHLHALLTIGDEPPPEVDIFELIEASYEKFSALRSDDIEQMRFKQRLKVIQSLEDTAKRSIVRAISTDLGFSMEELEDLYVLFKAQHLMNCYWGGNRTSG----SRHDPSLPYLEQYRIDLQQFQELFNQLTPWSCGQHAPILATRIFRLLDSNKDSLINFKEFVTGLGGMYHGDMTEKLKFLYKLHMPPALGPEETESALEAT--SFFTEDLHPEDSDGQGNEPTAVQG------------------NSPEKK------DEKTTSSVDYKYYLRMWASEKEQKKETIKD---LPKMNQEQFIELCKTFYNMFSEDPQEQELYHAIATVASLLLRIGEVGKK 1052          
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Match: tbc1d9b (sterol 26-hydroxylase, mitochondrial [Source:Xenbase;Acc:XB-GENE-984298])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 408/1099 (37.12%), Postives = 614/1099 (55.87%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDN----SQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESE-------NPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW NP EV +  +LW  E+ N +F+   +R     GGL+GLLVGT D ++DS A    YRIL +  E  + + +   +S+  I + WE LEN++L  +S F  +E I  F+K K+  + A E +S+   D E+   ++ A VK  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +II W+ V  ++K+     PE IT+ T+  E+ F+ FLNI ETF L++QLANI +++LL  EG+ E+  L      L   K S LK DLDA+ +N  YR +FRLP +E LDG  +C L T + K  + G++++S N+ICF+SK  +   LIIP REV   E        SS       + T     F F NL +R+ ++  I++FL       +K+ +   + + + S+  DV  +     N    + T    +      + TE++    + E  ++ +W  +F+++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    +  ++EIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+CNEEEAFWLLV++CER+LPDYYN +V+G  VDQ V ++L + +L                 S  + E  +I  +S+SWFLT++L+VM F +A+ ++DCFF++G ++I Q++L +L  +   L++  DEGEA   +          Q +S    HL      GD  P ++ I ELI ++YE F  + +  I+Q+R + RL V+  +E    R +VR++        +ELE L+ +FK  ++ + Y+  +  S     S +DP  PY + +RID + F  LF  L PW    H   LA RIFRLLD + D++INFKEF   +G + HG + EKL+ L++L+  P L P +                              TES +E T    E +H E           A   KT +  D +  L          ++ ++  E+  + I++   LPKM  +  +    T Y++ + D  E +L +A+A V + + +  E+  K
Sbjct:   20 MWLNPEEVLLANALWVTERANPFFLLQRRRGHGKGGGLSGLLVGTLDVVLDSSARVAPYRILHQTQESQVYWTVACGSSRKEITEHWEWLENNLLQTLSIFENEEDITTFVKGKIHGIIAEENKSLQPKDEEDPGKFREAEVKMRKQFGMPEVEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVTLIIQWLDVTQLDKNATLLFPECITVSTRDSEHYFSMFLNISETFKLMEQLANIAMRQLLDNEGFHEDRNLSKPKRSLK--KTSALKRDLDARAKNERYRATFRLPRDERLDGHTDCTLWTPFAKMHIPGQMFVSNNYICFSSKEEEACLLIIPLREVTIVE----KADSSSVLPSPLSISTKAKMTFLFANLKDRNFLVQLISDFL-------QKTSAQREATNPSPSSSTDVSPTFSTPQNNGSDAPTASHGLLKLFQREITEDMKPKWDKEKMKEESWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWLLFSGASNEMVTHPGYYADLVEKSMGRCNLATDEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYCNEEEAFWLLVSLCERMLPDYYNTRVVGALVDQGVFEELTRLYL--------------PQLSEKMQELGVISTISLSWFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVLEANMESLMNCMDEGEAMTILGRYLDNVLNKQSVSPPIPHLHALLTIGDEPPPEVDIFELIEASYEKFSALRSDDIEQMRFKQRLKVIQSLEDTAKRSIVRAISTDLGFSMEELEDLYVLFKAQHLMNCYWGGNRTSG----SRHDPSLPYLEQYRIDLQQFQELFNQLTPWSCGQHAPILATRIFRLLDSNKDSLINFKEFVTGLGGMYHGDMTEKLKFLYKLHMPPALGPEE------------------------------TESALEATSFFTEDLHPEGNWSIYLFLATARDEKTTSSVDYKYYL----------RMWASEKEQKKETIKD---LPKMNQEQFIELCKTFYNMFSEDPQEQELYHAIATVASLLLRIGEVGKK 1044          
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Match: tbc1d9b (sterol 26-hydroxylase, mitochondrial [Source:Xenbase;Acc:XB-GENE-984298])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 412/1126 (36.59%), Postives = 618/1126 (54.88%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL--IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYAN---APKPTENLDKIIE------------IENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAE-------------SENPASPAKTHNFGDVQDNLSGK--QRTNS------HAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW NP EV +  +LW  E+ N +F+   +R     GGL+GLLVGT D ++DS A    YRIL +  E  + + +   +S+  I + WE LEN++L  +S F  +E I  F+K K+  + A E +S+   D E+   ++ A VK  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +II W+ V  ++K+     PE IT+ T+  E+ F+ FLNI ETF L++QLANI +++LL  EG+ E+  L      L   K S LK DLDA+ +N  YR +FRLP +E LDG  +C L T + K  + G++++S N+ICF+SK  +   LIIP REV   E    S  L S       + T     F F NL +R+ ++  I++FL   +           +   +A ++   +  +         +  F     N   AP  +  L K+ +             E  ++ +W  +F+++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    +  ++EIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+CNEEEAFWLLV++CER+LPDYYN +V+G  VDQ V ++L + +L                 S  + E  +I  +S+SWFLT++L+VM F +A+ ++DCFF++G ++I Q++L +L  +   L++  DEGEA   +          Q +S    HL      GD  P ++ I ELI ++YE F  + +  I+Q+R + RL V+  +E    R +VR++        +ELE L+ +FK  ++ + Y+  +  S     S +DP  PY + +RID + F  LF  L PW    H   LA RIFRLLD + D++INFKEF   +G + HG + EKL+ L++L+  P L P +                              TES +E T    E +H E              E P S  + +    VQ N   K  ++T S      + ++ ++  E+  + I++   LPKM  +  +    T Y++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWLNPEEVLLANALWVTERANPFFLLQRRRGHGKGGGLSGLLVGTLDVVLDSSARVAPYRILHQTQESQVYWTVACGSSRKEITEHWEWLENNLLQTLSIFENEEDITTFVKGKIHGIIAEENKSLQPKDEEDPGKFREAEVKMRKQFGMPEVEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVTLIIQWLDVTQLDKNATLLFPECITVSTRDSEHYFSMFLNISETFKLMEQLANIAMRQLLDNEGFHEDRNLSKPKRSL--KKTSALKRDLDARAKNERYRATFRLPRDERLDGHTDCTLWTPFAKMHIPGQMFVSNNYICFSSKEEEACLLIIPLREVTIVEKADSSSVLPSPLS----ISTKAKMTFLFANLKDRNFLVQLISDFLQKTSAQRVKGDCTGEILKGNAQNNGCEEATNPSPSSSTDVSPTFSTPQNNGSDAPTASHGLLKLFQREITEDMKPKWDKEKMKEESWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWLLFSGASNEMVTHPGYYADLVEKSMGRCNLATDEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYCNEEEAFWLLVSLCERMLPDYYNTRVVGALVDQGVFEELTRLYL--------------PQLSEKMQELGVISTISLSWFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVLEANMESLMNCMDEGEAMTILGRYLDNVLNKQSVSPPIPHLHALLTIGDEPPPEVDIFELIEASYEKFSALRSDDIEQMRFKQRLKVIQSLEDTAKRSIVRAISTDLGFSMEELEDLYVLFKAQHLMNCYWGGNRTSG----SRHDPSLPYLEQYRIDLQQFQELFNQLTPWSCGQHAPILATRIFRLLDSNKDSLINFKEFVTGLGGMYHGDMTEKLKFLYKLHMPPALGPEE------------------------------TESALEATSFFTEDLHPEVSPFLSELDLILQCEFPDSDGQGNEPTAVQGNSPEKKDEKTTSSVDYKYYLRMWASEKEQKKETIKD---LPKMNQEQFIELCKTFYNMFSEDPQEQELYHAIATVASLLLRIGEVGKK 1069          
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Match: tbc1d9b (sterol 26-hydroxylase, mitochondrial [Source:Xenbase;Acc:XB-GENE-984298])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 407/1100 (37.00%), Postives = 623/1100 (56.64%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIE------------IENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW NP EV +  +LW  E+ N +F+   +R     GGL+GLLVGT D ++DS A    YRIL +  E  + + +   +S+  I + WE LEN++L  +S F  +E I  F+K K+  + A E +S+   D E+   ++ A VK  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +II W+ V  ++K+     PE IT+ T+  E+ F+ FLNI ETF L++QLANI +++LL  EG+ E+  L      L   K S LK DLDA+ +N  YR +FRLP +E LDG  +C L T + K  + G++++S N+ICF+SK  +   LIIP REV   E    S  L S       + T     F F NL +R+ ++  I++FL  T+    K   +      N +       S ++     T +     ++AP  +  L K+ +             E  ++ +W  +F+++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    +  ++EIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+CNEEEAFWLLV++CER+LPDYYN +V+G  VDQ V ++L + +L                 S  + E  +I  +S+SWFLT++L+VM F +A+ ++DCFF++G ++I Q++L +L  +   L++  DEGEA   +          Q +S    HL      GD  P ++ I ELI ++YE F  + +  I+Q+R + RL V+  +E    R +VR++        +ELE L+ +FK  ++ + Y+  +  S     S +DP  PY + +RID + F  LF  L PW    H   LA RIFRLLD + D++INFKEF   +G + HG + EKL+ L++L+  P L P + E   + T  ++  ++  P  +      + T  GI +   ++++ + +     +  KT +  D +  L          ++ ++  E+  + I++   LPKM  +  +    T Y++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWLNPEEVLLANALWVTERANPFFLLQRRRGHGKGGGLSGLLVGTLDVVLDSSARVAPYRILHQTQESQVYWTVACGSSRKEITEHWEWLENNLLQTLSIFENEEDITTFVKGKIHGIIAEENKSLQPKDEEDPGKFREAEVKMRKQFGMPEVEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVTLIIQWLDVTQLDKNATLLFPECITVSTRDSEHYFSMFLNISETFKLMEQLANIAMRQLLDNEGFHEDRNLSKPKRSLK--KTSALKRDLDARAKNERYRATFRLPRDERLDGHTDCTLWTPFAKMHIPGQMFVSNNYICFSSKEEEACLLIIPLREVTIVEKADSSSVLPSPLS----ISTKAKMTFLFANLKDRNFLVQLISDFLQKTSAQRVKGDCTGEILKGNEATNPSPSSSTDVSPTFSTPQN--NGSDAPTASHGLLKLFQREITEDMKPKWDKEKMKEESWNIHFLEYGRGMCMYRTSKTRELVLKGIPENLRGELWLLFSGASNEMVTHPGYYADLVEKSMGRCNLATDEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYCNEEEAFWLLVSLCERMLPDYYNTRVVGALVDQGVFEELTRLYL--------------PQLSEKMQELGVISTISLSWFLTLFLSVMPFESAVVVVDCFFFEGIKLILQLSLAVLEANMESLMNCMDEGEAMTILGRYLDNVLNKQSVSPPIPHLHALLTIGDEPPPEVDIFELIEASYEKFSALRSDDIEQMRFKQRLKVIQSLEDTAKRSIVRAISTDLGFSMEELEDLYVLFKAQHLMNCYWGGNRTSG----SRHDPSLPYLEQYRIDLQQFQELFNQLTPWSCGQHAPILATRIFRLLDSNKDSLINFKEFVTGLGGMYHGDMTEKLKFLYKLHMPPALGPEETESALEAT--SFFTEDLHPEGNWSIYLFLATARGIFI---IIQFSNIKCRCCVTDEKTTSSVDYKYYL----------RMWASEKEQKKETIKD---LPKMNQEQFIELCKTFYNMFSEDPQEQELYHAIATVASLLLRIGEVGKK 1056          
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Match: tbc1d9 (TBC1 domain family member 9 [Source:NCBI gene;Acc:100192377])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 418/1130 (36.99%), Postives = 636/1130 (56.28%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXX---XXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDT----EESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTG--RFMIKYANAPKPTENLDKIIEI-------ENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HL-------GDP-DQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVN----AVARVCTKVQQKAEMRVKT--EKDWVINFEEFRHSFYSEPGLVEFL 3280
            MW NP EV +  +LW  E+ N YF+L++RK    + +GGL GLLVGT D ++DS A    YRIL +  +  + + I     +  + + WE LE ++L  +S F N ++   F+K K+  + A E   ++     ++++ +K A VKF K+F MP EEKLVNYYSCS   GR+P QGW+YLS+NH+CFYSFL+GKE +++I WV +  +EK+     P+ I + T+  E+ F+ FLNI ETF L++QLANI +++LL  EG++++ +   + +K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T ++K+ + G++++S N+ICF SK  +   LIIP REV   E    S  L S       + T     F F NL +RD ++ +I++FL  T       K    SD        + +D ++   N   G  +F +   +AP  T+ L  I          E  ++  W+ +F ++G+G+ M+RT + R LVL G+   +R E+W++ SGA NE+  +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+S+LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L + ++       D   D           +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ+AL +L  +   L++ KD+GEA   + +  +  +          HL        +P  ++ I +LI ++Y+ FGT+   LI+Q+R + RL V+  +E  T R+VVR++   T    +ELE L+ +FK  ++ S Y+  +    +  +  +DP  PY + +RID++ F  +F  L PW    HT  +A R+FRLLD++ D +INF+EF   +   CHG L EKL+LL+R++     LPG     D   ++ Y+   ++                   T  +LE                  G+V     GKQ      +LRS+   E  ++      L +  +DD      + Y + +  +HE D +         V  + QQK+ +   T  ++DW + FE+F  S   EP LV + 
Sbjct:    1 MWVNPEEVLLANALWVTERANPYFILQRRKGHGTRGSGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACGGCRREVTEHWEWLEVNLLQTLSIFENENDITTFVKGKIQGIIA-EYNKINGIKEDDDTDKFKEAIVKFHKLFGMPEEEKLVNYYSCSYWKGRVPRQGWMYLSINHLCFYSFLLGKEAKLVIRWVDITQLEKTATLLLPDMIKVNTRSSEHFFSVFLNIGETFKLMEQLANIAMRQLLDNEGFEQD-RSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFSKRHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKADSSSVLPSPLS----ISTRNRMTFLFANLKDRDFLVQRISDFLQQTTLKMYFDKDISGSD--------NSLDEEQSVGNETDGERQFNLNCNSAPTATQTLMTIYVFIFASKAKEFLKEQAWKTHFTEYGQGVCMYRTEKTRDLVLKGIPEVMRGELWLLFSGAINEMATHPGYYEELVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEIGISALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVP---QLYDCMQDLG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLEANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLITDDSEPYPEVDIFKLISTSYQKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTDTAFTINELEELYALFKAEHLTSCYWGGN----SSAVERHDPSLPYLEQYRIDFQQFKGMFCLLFPWASGAHTDVMAFRLFRLLDENGDCLINFREFVSSLSAACHGDLTEKLKLLYRMHT----LPGTCMCEDPCEQELYHATAAV-------------------TSLLLE-----------------IGEV-----GKQ--CRRPQLRSDGGSEAGRF------LSQRQWDDSS---MSSYSVLSAGSHEDDKLQCEDIGEDTVLVRTQQKSSLPSSTSLDRDWAVTFEQFLASLLMEPALVRYF 1044          
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Match: Tbc1d9b (TBC1 domain family, member 9B [Source:MGI Symbol;Acc:MGI:1924045])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 426/1108 (38.45%), Postives = 613/1108 (55.32%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKE-------------------IRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSC+   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV V  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P+K +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D  RLIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL  T +    S    +  S +  A   +   +E                    ++   T + ++K      P E+L      E  ++ +W  +F ++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ +              FE+   D     S  + E  +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+D  DEGEA   +          Q +S    HL      GD  P ++ I +L+  +YE F  +    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+  +  +        DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLDQ+ D++INFKEF   +  + HG L EKL+ L++L+  P L+P + E   +          S     + Q+G     SG E T E  E      E   SP    ++                  LR  + E+ +Q     D LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLGPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWIVACGSSRKEITKHWEWLENNLLQTLSIFDNEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCNFWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHKNISALKRDLDARAKNECYRATFRLPKDERLDGHTGCTLWTPFNKLHIPGQMFISNNYICFASKEEDACRLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQTGSSIGGTKASVSDPAPESLPTPQEASEPPASPSSPLSSPPSFSTQEIPTTSQGLLKVFQKNSPMEDLGAKGAKEKMKEESWNIHFFEYGRGMCMYRTAKTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSLGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGI--------------FEELTRDVLPRLSEKMQELGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANVEQLLDCNDEGEAMTVLGRYLDNVVNKQSISPPIPHLHALLTSGDDPPVEVDIFDLLRVSYEKFSNLRADDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGGNRSAAV----HRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPVLAGRMFRLLDQNKDSLINFKEFVTGMSGMYHGDLTEKLKALYKLHLPPALIPEEAESALEAAHYFTEDSSSEALLQEQQEG-----SGNEDTPERRE------EKGTSPPDYRHY------------------LRMWAKEKEAQKETIKD-LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1053          
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Match: Tbc1d9b (TBC1 domain family, member 9B [Source:MGI Symbol;Acc:MGI:1924045])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 418/1111 (37.62%), Postives = 616/1111 (55.45%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKE-------------------IRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIEL---TEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSC+   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV V  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P+K +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D  RLIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL  T +    S    +  S +  A   +   +E                    ++   T + ++K      P E+L      E  ++ +W  +F ++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ +              FE+   D     S  + E  +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+D  DEGEA   +          Q +S    HL      GD  P ++ I +L+  +YE F  +    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+  +  +        DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLDQ+ D++INFKEF   +  + HG L EKL+ L++L+  P L+P       +  + A          S  +   + ++  + L    + +L+     S N  +P +    G      +       + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLGPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWIVACGSSRKEITKHWEWLENNLLQTLSIFDNEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCNFWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHKNISALKRDLDARAKNECYRATFRLPKDERLDGHTGCTLWTPFNKLHIPGQMFISNNYICFASKEEDACRLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQTGSSIGGTKASVSDPAPESLPTPQEASEPPASPSSPLSSPPSFSTQEIPTTSQGLLKVFQKNSPMEDLGAKGAKEKMKEESWNIHFFEYGRGMCMYRTAKTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSLGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGI--------------FEELTRDVLPRLSEKMQELGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANVEQLLDCNDEGEAMTVLGRYLDNVVNKQSISPPIPHLHALLTSGDDPPVEVDIFDLLRVSYEKFSNLRADDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGGNRSAAV----HRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPVLAGRMFRLLDQNKDSLINFKEFVTGMSGMYHGDLTEKLKALYKLHLPPALIP-------EEAESALEAAHYFTEDSSSEASPLASDLDLFLPWEAQALLQEQQEGSGNEDTPERREEKG------TSPPDYRHYLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1070          
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Match: Tbc1d8b (TBC1 domain family, member 8B [Source:MGI Symbol;Acc:MGI:1918101])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 386/1161 (33.25%), Postives = 611/1161 (52.63%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY---DNIIDS--KATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVE-KQSVDTEES-ESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKIN----NFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASEC------------------IQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVF-KDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTK---QLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAV--------------------------ARVCTKVQQKAEMRVKT-------EKDWVINFEEFRHSFYSEPGLVEFLGSKQDISS 3304
            MW  P EV +     LW  E+ N+YFVL++R+G    G  GL        D+++DS  K   +RIL +  +  +   I    ++  I K W+ LE +I+  +S F+ +E I  F++ K+  + A E KQS   E+  E ++ A +KF K F +P +EKLV YYSCS   GR+P QGWLYLS N + FYSFL+G E ++II W  +  +EK++     ESI + ++ + + F+ FL+I ET+ L++QLAN  I++L  +E +  +  L       +P ++++  L+  A   + +++  FRLP  E L    EC L   ++  +  G++ IS N+ICFAS+  +   +IIP REV+A       I  + ++ ++  +     +AF F  L + + +++K+           + ++  + SS S+  + +  +  +   KE      T   M  +   P+  ENLD  +  E  ++ +W   F + GRG+SMFRT + R LV+ G+   LR E+WM+ SGA N++  NP YY  +V Q+  +S+  +EEIERDL RSLPEHP + +D G+S+LRRVLTAYAYRNP IGYCQAMNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N ++IG  VDQ V ++L++ HL       D   D T  +S         VS+SWFLT++++V+   +A+ ++DCFFYDG + I Q+ L +L  +   L+  KD+ EA                     +Q+ S   +   D  ++ I +LI  + E +G++    I  +R +NRL V+  +E  T ++V+R V +  K+   EL+ L+ +F K+L+++  +Y +      P +  +DP  PY + ++ID + F  L+  L PW H+     LAL  FRLLD++ D +INFKEF+  + I+ +G+  +KL+LLF+L+  P       E++ K +                 KGD  +      TEE+L +   +   PA   +T +  +  +   GK    ++     + + +  + I++   LP+M     + F  TLY+L   D  E  L  A+                          AR     +  AE  VK        E  W   FE+   S  +EP LV F     D+ +
Sbjct:    1 MWLKPEEVLLKNALKLWLMERSNEYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAPFRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRGLIAEEGKQSFAKEDDPEKFREALLKFEKSFGLPEQEKLVTYYSCSYWRGRVPCQGWLYLSTNFLSFYSFLLGSEIKLIISWDAISKLEKTSTVILTESIHVCSQGENHYFSMFLHINETYLLMEQLANYAIKRLFDKETFDNDPVLD------DPLQITKRGLEYRAH--SEQFKAFFRLPKEETLKEVHECFLWVPFSHFSSHGKMCISENYICFASQDGNLCSVIIPLREVLA-------IDKTDDSNRSVIISIKGKTAFRFSELKDFEQLVAKLRLKCRAASTQDDVSTEVAVSSDSTGPSENFEEQPLTCPKECSKTVNTEALMTVFH--PQNLENLDSKMLKEKMKEQSWNILFSECGRGVSMFRTKKTRDLVVRGIPETLRGELWMLFSGAVNDMATNPGYYAEVVEQSLGTSNLATEEIERDLRRSLPEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQAVFEELIRDHLP---QLTDHMTDMTFFSS---------VSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVINKDSPLPSNVQQGSNISNEKSDHTKVDITDLIKESNEKYGSIRYEDIHSMRCRNRLYVIQTLEETTKQNVLRVVSQDVKMSLQELDELYVIFKKELFISCYWYLS-----CPGLKHHDPSLPYLEQYQIDCQQFRVLYHLLSPWAHSANRDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTDKLKLLFKLHIPPAY----TEVMSKTS----------------SKGDELS------TEELLYFSQLQVSKPADEKETESGRNSPEKGKGKIDIQAYLSQWQDELLKKEETIKD---LPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAIVTNLLLRMEEVGRKLHSPASSASTARDSGPSEGNAESSVKKDLPSPREEHQWSFAFEQILASLLNEPALVRFFERPLDLKA 1098          
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Match: Tbc1d8 (TBC1 domain family, member 8 [Source:MGI Symbol;Acc:MGI:1927225])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 347/966 (35.92%), Postives = 546/966 (56.52%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXXXXXXXXXXX--XXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKI--------NNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKP---------TENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHL------GDP----------DQ-----LTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +     LW  +K + YFVL++R+G   GG      LVG  D ++DS A    +RILL+     +   I    +   I + W+ LE ++L+ +S F N+D+   F+K KV ++ A E  S      EE E ++ A VKF   FN P  EKLV YYSC    GR+P QGWLYLS+NH+CFYSF +GKE +++IPWV ++ +E+++  F  ++I I T+ KE  F+ FLN+ E F +++QLA++ +++LL  E +  +  L+       P++++  K DL+A+ +N  +R  FRLP  E L    +C+L T +++   +GR++ S ++ICFAS+      +++P REV++ E M       ++ +  P +++  S  AF F  L +R+ ++  +         N  +    +      +     + S       D + +   S   R   +    P+P         +++ D  +  E  +   W  +F+++GR + MFRT ++R+LV  G+   LR  +W++ S A  +L  +P YY  LV Q+      V+EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNP IGYCQ+MNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N +VIG +VDQ+V ++L++  L       +  +D ++ AS         +S+SWFLT++L++M   +A++++DCFFYDG + IFQ+ L +L  +   L   KD+G+A   +  LS    H+      G P          DQ       I +LI  +YE FG  +   I+ LR ++R+ V+   E  T ++V+R V     +  ++LE L+ +FK  ++ S Y+ +H     P    +DP RPY + +RID   FA LF  + PW    HT+ LA R+FRLLD ++D +I FK F   + I+ +G + EK++LL+RL+  P L   D++
Sbjct:    1 MWLKPEEVLLKNALKLWVTQKSSCYFVLQRRRGHGEGGGRLTGRLVGALDAVLDSSARVAPFRILLQVPGSQVYSPIACGATLEEINRHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKALIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYLSINHLCFYSFFLGKELKLVIPWVDIQKLERTSNVFLTDTIRITTQNKERDFSTFLNLDEVFKIMEQLADVTLRRLLDNEVFDLDPDLQ------EPSQIT--KRDLEARAQNEFFRAFFRLPREEKLHAVADCSLWTPFSRCHTAGRIFSSDSYICFASREDGCCNVVLPLREVVSIEKME-----DTSLLPNPIIVSIRSKMAFQFIELKDRENLVEGLLLRLKQVHANHPVHYETSPSDDDMASPVFYSASICTDKFGDLEMVASQSSEEREEKRPLPHPEPLTAVFQQSGSQSPDSRLSREQIKISLWNDHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEQSLGRCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEQLP---ELAEHMSDLSALAS---------ISLSWFLTLFLSIMPLESAVHVVDCFFYDGIKAIFQLGLAVLEANAEELCSSKDDGQA---LMVLSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPYPVTDIADLIRDSYEKFGNQSVEQIEHLRCKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKRAHMMSCYWEHH----RPMALRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGVHTEILAERLFRLLDDNMDQLIEFKAFTSCLDIMYNGEMNEKIKLLYRLHIPPALTENDRD 934          
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Match: Tbc1d8 (TBC1 domain family, member 8 [Source:MGI Symbol;Acc:MGI:1927225])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 347/966 (35.92%), Postives = 546/966 (56.52%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXXXXXXXXXXX--XXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKI--------NNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKP---------TENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHL------GDP----------DQ-----LTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +     LW  +K + YFVL++R+G   GG      LVG  D ++DS A    +RILL+     +   I    +   I + W+ LE ++L+ +S F N+D+   F+K KV ++ A E  S      EE E ++ A VKF   FN P  EKLV YYSC    GR+P QGWLYLS+NH+CFYSF +GKE +++IPWV ++ +E+++  F  ++I I T+ KE  F+ FLN+ E F +++QLA++ +++LL  E +  +  L+       P++++  K DL+A+ +N  +R  FRLP  E L    +C+L T +++   +GR++ S ++ICFAS+      +++P REV++ E M       ++ +  P +++  S  AF F  L +R+ ++  +         N  +    +      +     + S       D + +   S   R   +    P+P         +++ D  +  E  +   W  +F+++GR + MFRT ++R+LV  G+   LR  +W++ S A  +L  +P YY  LV Q+      V+EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNP IGYCQ+MNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N +VIG +VDQ+V ++L++  L       +  +D ++ AS         +S+SWFLT++L++M   +A++++DCFFYDG + IFQ+ L +L  +   L   KD+G+A   +  LS    H+      G P          DQ       I +LI  +YE FG  +   I+ LR ++R+ V+   E  T ++V+R V     +  ++LE L+ +FK  ++ S Y+ +H     P    +DP RPY + +RID   FA LF  + PW    HT+ LA R+FRLLD ++D +I FK F   + I+ +G + EK++LL+RL+  P L   D++
Sbjct:    1 MWLKPEEVLLKNALKLWVTQKSSCYFVLQRRRGHGEGGGRLTGRLVGALDAVLDSSARVAPFRILLQVPGSQVYSPIACGATLEEINRHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKALIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYLSINHLCFYSFFLGKELKLVIPWVDIQKLERTSNVFLTDTIRITTQNKERDFSTFLNLDEVFKIMEQLADVTLRRLLDNEVFDLDPDLQ------EPSQIT--KRDLEARAQNEFFRAFFRLPREEKLHAVADCSLWTPFSRCHTAGRIFSSDSYICFASREDGCCNVVLPLREVVSIEKME-----DTSLLPNPIIVSIRSKMAFQFIELKDRENLVEGLLLRLKQVHANHPVHYETSPSDDDMASPVFYSASICTDKFGDLEMVASQSSEEREEKRPLPHPEPLTAVFQQSGSQSPDSRLSREQIKISLWNDHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEQSLGRCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEQLP---ELAEHMSDLSALAS---------ISLSWFLTLFLSIMPLESAVHVVDCFFYDGIKAIFQLGLAVLEANAEELCSSKDDGQA---LMVLSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPYPVTDIADLIRDSYEKFGNQSVEQIEHLRCKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKRAHMMSCYWEHH----RPMALRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGVHTEILAERLFRLLDDNMDQLIEFKAFTSCLDIMYNGEMNEKIKLLYRLHIPPALTENDRD 934          
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Match: sp|Q5SVR0|TBC9B_MOUSE (TBC1 domain family member 9B OS=Mus musculus OX=10090 GN=Tbc1d9b PE=1 SV=1)

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 418/1111 (37.62%), Postives = 616/1111 (55.45%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKE-------------------IRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSE--IIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIEL---TEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSC+   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV V  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P+K +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D  RLIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL  T +    S    +  S +  A   +   +E                    ++   T + ++K      P E+L      E  ++ +W  +F ++GRGM M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ +              FE+   D     S  + E  +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+D  DEGEA   +          Q +S    HL      GD  P ++ I +L+  +YE F  +    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+  +  +        DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLDQ+ D++INFKEF   +  + HG L EKL+ L++L+  P L+P       +  + A          S  +   + ++  + L    + +L+     S N  +P +    G      +       + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLGPEEVLVANALWVTERANPFFVLQRRRGHGKGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWIVACGSSRKEITKHWEWLENNLLQTLSIFDNEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCNFWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDVTRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHKNISALKRDLDARAKNECYRATFRLPKDERLDGHTGCTLWTPFNKLHIPGQMFISNNYICFASKEEDACRLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQTGSSIGGTKASVSDPAPESLPTPQEASEPPASPSSPLSSPPSFSTQEIPTTSQGLLKVFQKNSPMEDLGAKGAKEKMKEESWNIHFFEYGRGMCMYRTAKTRELVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSLGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGI--------------FEELTRDVLPRLSEKMQELGVISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANVEQLLDCNDEGEAMTVLGRYLDNVVNKQSISPPIPHLHALLTSGDDPPVEVDIFDLLRVSYEKFSNLRADDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPGDIGFSIEELEDLYMVFKAKHLASQYWGGNRSAAV----HRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPVLAGRMFRLLDQNKDSLINFKEFVTGMSGMYHGDLTEKLKALYKLHLPPALIP-------EEAESALEAAHYFTEDSSSEASPLASDLDLFLPWEAQALLQEQQEGSGNEDTPERREEKG------TSPPDYRHYLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1070          
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Match: sp|Q66K14|TBC9B_HUMAN (TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 410/1117 (36.71%), Postives = 610/1117 (54.61%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFV-XXXXXXXXXXXXXXXXXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNK-VSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFL------------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL--------GDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYI------------HAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW +P EV +  +LW  E+ N +FV   +R     GGLTGLLVGT D ++DS A    YRIL +  +  + + +   +S+  I K WE LEN++L  +S F+ +E I  F+K K+  + A E +++  +  E    +K A +K  K F MP  EKLVNYYSCS   GR+P QGWLYL++NH+CFYSFL+GKE  +++ WV +  +EK+     PESI + T+ +E  F+ FLNI ETF L++QLAN+ +++LL  EG+ E+   K     + P++ +S LK DLDA+ +N  YR +FRLP +E LDG   C L T +NK  + G+++IS N+ICFASK  D   LIIP REV   E    S  L S       + T +   F F NL +RD ++ +I++FL                  +  +  S  +    S   A+ ++ L    S   ++     + ++K      P E+L      E  ++ +W  +F ++GRG+ M+RT + R LVL G+   LR E+W++ SGA NE++ +P YY  LV ++    S  +EEIERDLHRS+PEHP +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CER+LPDYYN +V+G  VDQ + ++L +  L       +   D           +I  +S+SWFLT++L+VM F +A+ I+DCFFY+G +VI Q+AL +L  +   L+   DEGEA   +          Q +S    HL          P ++ I EL+  +YE F ++    I+Q+R + RL V+  +E    R VVR++        +ELE L+ VFK  ++AS Y+              DP  PY + +RID   F  LF SL PW    HT  LA R+FRLLD++ D++INFKEF   +  + HG L EKL++L++L+  P L P       +  + A          S  +   + ++  + L  E  E +              E +  +SP   H                 + ++ +   E   + I++   LPKM  +  +    TLY++ + D  E DL +A+A V + + +  E+  K
Sbjct:    1 MWLSPEEVLVANALWVTERANPFFVLQRRRGHGRGGGLTGLLVGTLDVVLDSSARVAPYRILHQTQDSQVYWTVACGSSRKEITKHWEWLENNLLQTLSIFDSEEDITTFVKGKIHGIIAEENKNLQPQGDEDPGKFKEAELKMRKQFGMPEGEKLVNYYSCSYWKGRVPRQGWLYLTVNHLCFYSFLLGKEVSLVVQWVDITRLEKNATLLFPESIRVDTRDQELFFSMFLNIGETFKLMEQLANLAMRQLLDSEGFLED---KALPRPIRPHRNISALKRDLDARAKNECYRATFRLPRDERLDGHTSCTLWTPFNKLHIPGQMFISNNYICFASKEEDACHLIIPLREVTIVEKADSSSVLPSPLS----ISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTESSPAPQEGSEQPASPASPLSSRQSFCAQEAPTASQGLLKLFQKNSPMEDLGAKGAKEKMKEESWHIHFFEYGRGVCMYRTAKTRALVLKGIPESLRGELWLLFSGAWNEMVTHPGYYAELVEKSTGKYSLATEEIERDLHRSMPEHPAFQNELGIAALRRVLTAYAFRNPTIGYCQAMNIVTSVLLLYGSEEEAFWLLVALCERMLPDYYNTRVVGALVDQGIFEELTRDFLP---QLSEKMQDLG---------VISSISLSWFLTLFLSVMPFESAVVIVDCFFYEGIKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSVSPPIPHLRALLSSSDDPPAEVDIFELLKVSYEKFSSLRAEDIEQMRFKQRLKVIQSLEDTAKRSVVRAIPVDIGFSIEELEDLYMVFKAKHLASQYWGCSRTM----AGRRDPSLPYLEQYRIDASQFRELFASLTPWACGSHTPLLAGRMFRLLDENKDSLINFKEFVTGMSGMYHGDLTEKLKVLYKLHLPPALSP-------EEAESALEAAHYFTEDSSSEASPLASDLDLFLPWEAQEALPQEEQEGSGSEERGEEKGTSSPDYRH-----------------YLRMWAKEKEAQKETIKD---LPKMNQEQFIELCKTLYNMFSEDPMEQDLYHAIATVASLLLRIGEVGKK 1067          
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Match: sp|Q6ZT07|TBCD9_HUMAN (TBC1 domain family member 9 OS=Homo sapiens OX=9606 GN=TBC1D9 PE=2 SV=2)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 406/1116 (36.38%), Postives = 614/1116 (55.02%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY-----DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEE---SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXX--------XXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENL------------DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HLG-------DP-DQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAES------ENPASPAKTHNFGDVQDNLSGKQRTNSHAK---LRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW NP EV +  +LW  E+ N YF+L++RKG    G  G  +        D ++DS A    YRIL +  +  + + I    S+  I + WE LE ++L  +S F N ++   F++ K+  + A   +  D +E   +E +K A VKF ++F MP EEKLVNYYSCS   G++P QGW+YLS+NH+CFYSFLMG+E +++I WV +  +EK+     P+ I + T+  E+ F+ FLNI ETF L++QLANI +++LL  EG++++  L     K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK  +   LIIP REV   E    S  L S       + T     F F NL +RD ++ +I++FL  T +     K    S +++        SS            D     +F +   + P  T+ L            +  +  E  ++  W+ +F ++G+G+ M+RT + R LVL G+   +R E+W+++SGA NE   +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L + ++       D   D           +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ+AL +L  +   L++ KD+GEA   + +  +  +          HL        +P  ++ I  LI ++YE FGT+   LI+Q+R + RL V+  +E  T R+VVR++   T    DELE L+ +FK  ++ S Y+     +    +  +DP  PY + +RID+E F  +F  L PW    H+  LA R+F+LLD++ D++INF+EF   +   CHG L EKL+LL++++  P                          SSD  + D    S  E T+   E I  E       ++ +       F  V       +R NS      LR  + E  S+  +N   LPK+     +    T+Y++ + D +E +L +A A V + + +  E+
Sbjct:    1 MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQGIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMYLSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINETFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRK-SPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKADSSSVLPSPLS----ISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSDDEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLAKEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVP---QLYDCMQDLG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDKLLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEKFGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLTSCYWGGSSNA----LDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDENGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLP------------------------EPSSDQDEPD----SAFEATQYFFEDITPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSK-SKNAKDLPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEV 1066          
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Match: sp|A3KGB4|TBC8B_MOUSE (TBC1 domain family member 8B OS=Mus musculus OX=10090 GN=Tbc1d8b PE=1 SV=1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 386/1161 (33.25%), Postives = 611/1161 (52.63%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY---DNIIDS--KATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVE-KQSVDTEES-ESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKIN----NFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASEC------------------IQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVF-KDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTK---QLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAV--------------------------ARVCTKVQQKAEMRVKT-------EKDWVINFEEFRHSFYSEPGLVEFLGSKQDISS 3304
            MW  P EV +     LW  E+ N+YFVL++R+G    G  GL        D+++DS  K   +RIL +  +  +   I    ++  I K W+ LE +I+  +S F+ +E I  F++ K+  + A E KQS   E+  E ++ A +KF K F +P +EKLV YYSCS   GR+P QGWLYLS N + FYSFL+G E ++II W  +  +EK++     ESI + ++ + + F+ FL+I ET+ L++QLAN  I++L  +E +  +  L       +P ++++  L+  A   + +++  FRLP  E L    EC L   ++  +  G++ IS N+ICFAS+  +   +IIP REV+A       I  + ++ ++  +     +AF F  L + + +++K+           + ++  + SS S+  + +  +  +   KE      T   M  +   P+  ENLD  +  E  ++ +W   F + GRG+SMFRT + R LV+ G+   LR E+WM+ SGA N++  NP YY  +V Q+  +S+  +EEIERDL RSLPEHP + +D G+S+LRRVLTAYAYRNP IGYCQAMNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N ++IG  VDQ V ++L++ HL       D   D T  +S         VS+SWFLT++++V+   +A+ ++DCFFYDG + I Q+ L +L  +   L+  KD+ EA                     +Q+ S   +   D  ++ I +LI  + E +G++    I  +R +NRL V+  +E  T ++V+R V +  K+   EL+ L+ +F K+L+++  +Y +      P +  +DP  PY + ++ID + F  L+  L PW H+     LAL  FRLLD++ D +INFKEF+  + I+ +G+  +KL+LLF+L+  P       E++ K +                 KGD  +      TEE+L +   +   PA   +T +  +  +   GK    ++     + + +  + I++   LP+M     + F  TLY+L   D  E  L  A+                          AR     +  AE  VK        E  W   FE+   S  +EP LV F     D+ +
Sbjct:    1 MWLKPEEVLLKNALKLWLMERSNEYFVLQRRRGYGEEGGGGLTGLLVGTLDSVLDSTAKVAPFRILHQTPDSQVYLSIACGANREEITKHWDWLEQNIMKTLSVFDSNEDITNFVQGKIRGLIAEEGKQSFAKEDDPEKFREALLKFEKSFGLPEQEKLVTYYSCSYWRGRVPCQGWLYLSTNFLSFYSFLLGSEIKLIISWDAISKLEKTSTVILTESIHVCSQGENHYFSMFLHINETYLLMEQLANYAIKRLFDKETFDNDPVLD------DPLQITKRGLEYRAH--SEQFKAFFRLPKEETLKEVHECFLWVPFSHFSSHGKMCISENYICFASQDGNLCSVIIPLREVLA-------IDKTDDSNRSVIISIKGKTAFRFSELKDFEQLVAKLRLKCRAASTQDDVSTEVAVSSDSTGPSENFEEQPLTCPKECSKTVNTEALMTVFH--PQNLENLDSKMLKEKMKEQSWNILFSECGRGVSMFRTKKTRDLVVRGIPETLRGELWMLFSGAVNDMATNPGYYAEVVEQSLGTSNLATEEIERDLRRSLPEHPAFQSDTGISALRRVLTAYAYRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQAVFEELIRDHLP---QLTDHMTDMTFFSS---------VSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAILQLGLAILDYNLDKLLTCKDDAEAVTALNRFFDNVINKDSPLPSNVQQGSNISNEKSDHTKVDITDLIKESNEKYGSIRYEDIHSMRCRNRLYVIQTLEETTKQNVLRVVSQDVKMSLQELDELYVIFKKELFISCYWYLS-----CPGLKHHDPSLPYLEQYQIDCQQFRVLYHLLSPWAHSANRDSLALWTFRLLDENSDCLINFKEFSSAIDIMYNGSFTDKLKLLFKLHIPPAY----TEVMSKTS----------------SKGDELS------TEELLYFSQLQVSKPADEKETESGRNSPEKGKGKIDIQAYLSQWQDELLKKEETIKD---LPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAIVTNLLLRMEEVGRKLHSPASSASTARDSGPSEGNAESSVKKDLPSPREEHQWSFAFEQILASLLNEPALVRFFERPLDLKA 1098          
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Match: sp|Q9Z1A9|TBCD8_MOUSE (TBC1 domain family member 8 OS=Mus musculus OX=10090 GN=Tbc1d8 PE=1 SV=2)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 347/966 (35.92%), Postives = 546/966 (56.52%), Query Frame = 2
Query:   29 MWKNPSEVFI--GYSLWTQEKQNQYFVXXXXXXXXXXXXXXX--XXXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKI--------NNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKP---------TENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHL------GDP----------DQ-----LTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +     LW  +K + YFVL++R+G   GG      LVG  D ++DS A    +RILL+     +   I    +   I + W+ LE ++L+ +S F N+D+   F+K KV ++ A E  S      EE E ++ A VKF   FN P  EKLV YYSC    GR+P QGWLYLS+NH+CFYSF +GKE +++IPWV ++ +E+++  F  ++I I T+ KE  F+ FLN+ E F +++QLA++ +++LL  E +  +  L+       P++++  K DL+A+ +N  +R  FRLP  E L    +C+L T +++   +GR++ S ++ICFAS+      +++P REV++ E M       ++ +  P +++  S  AF F  L +R+ ++  +         N  +    +      +     + S       D + +   S   R   +    P+P         +++ D  +  E  +   W  +F+++GR + MFRT ++R+LV  G+   LR  +W++ S A  +L  +P YY  LV Q+      V+EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNP IGYCQ+MNI+ SVLLL+  EEEAFWLLVA+CER+LPDY+N +VIG +VDQ+V ++L++  L       +  +D ++ AS         +S+SWFLT++L++M   +A++++DCFFYDG + IFQ+ L +L  +   L   KD+G+A   +  LS    H+      G P          DQ       I +LI  +YE FG  +   I+ LR ++R+ V+   E  T ++V+R V     +  ++LE L+ +FK  ++ S Y+ +H     P    +DP RPY + +RID   FA LF  + PW    HT+ LA R+FRLLD ++D +I FK F   + I+ +G + EK++LL+RL+  P L   D++
Sbjct:    1 MWLKPEEVLLKNALKLWVTQKSSCYFVLQRRRGHGEGGGRLTGRLVGALDAVLDSSARVAPFRILLQVPGSQVYSPIACGATLEEINRHWDWLEQNLLHTLSVFDNKDDIASFVKGKVKALIAEETSSRLAEQEEEPEKFREALVKFEARFNFPEAEKLVTYYSCCCWKGRVPRQGWLYLSINHLCFYSFFLGKELKLVIPWVDIQKLERTSNVFLTDTIRITTQNKERDFSTFLNLDEVFKIMEQLADVTLRRLLDNEVFDLDPDLQ------EPSQIT--KRDLEARAQNEFFRAFFRLPREEKLHAVADCSLWTPFSRCHTAGRIFSSDSYICFASREDGCCNVVLPLREVVSIEKME-----DTSLLPNPIIVSIRSKMAFQFIELKDRENLVEGLLLRLKQVHANHPVHYETSPSDDDMASPVFYSASICTDKFGDLEMVASQSSEEREEKRPLPHPEPLTAVFQQSGSQSPDSRLSREQIKISLWNDHFVEYGRTVCMFRTEKIRKLVAMGIPESLRGRLWLLFSDAVTDLASHPGYYGNLVEQSLGRCCLVTEEIERDLHRSLPEHPAFQNETGIAALRRVLTAYAHRNPKIGYCQSMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNHRVIGAQVDQSVFEELIKEQLP---ELAEHMSDLSALAS---------ISLSWFLTLFLSIMPLESAVHVVDCFFYDGIKAIFQLGLAVLEANAEELCSSKDDGQA---LMVLSRFLDHIKNEDSPGPPIGSHHAFFSDDQEPYPVTDIADLIRDSYEKFGNQSVEQIEHLRCKHRIRVLQGHEDTTKQNVLRVVIPEVSILPEDLEELYDLFKRAHMMSCYWEHH----RPMALRHDPSRPYAEQYRIDARQFAHLFQLVSPWTCGVHTEILAERLFRLLDDNMDQLIEFKAFTSCLDIMYNGEMNEKIKLLYRLHIPPALTENDRD 934          
BLAST of TBC1 domain family member 9 vs. TrEMBL
Match: R7TPZ1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_186677 PE=4 SV=1)

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 455/1167 (38.99%), Postives = 660/1167 (56.56%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX--XXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSV---DTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTP---FVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYAN-----APKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQK-----------LSECCSHLGDPDQLTIE--ELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLL-------------PGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM--------RVKTEKD---------------------WVINFEEFRHSFYSEPGLVEFLGSKQDISSSCK 3313
            MW  P E+ +  + W  E+ N +FVL++RKG+           VGT D ++DSKA  +RIL +    ++SY +  ++SQA I K W  LE  ++  ++ F N D+  +F++ K+ S+ A ++  V   D E+S  +K +  KF ++FNMP EE+LVNYYSCS+  GR+P QGW+YLS+NH CFYSFLMGKE +II  W  V  +E+      P+SI + T+  +Y+F+ F++  ET++LI+QLAN+ +++L+ EEG++E+  L  +S K +  K+S LK DLDA+ R+  YR SF LP++E LDGD EC+L T YNK    G+LYIS +FICF+S++ D V +IIP R+V   E +      S N    P    V   + + F F  + +RD+V+ KI +FL                              K     S TG     +AN     AP+   N D+I   E+   H W+ +F ++GRG+S +RT +   L+L G+  KLR E WM+ SGA NE+L +P YY +LV +T    +F ++EIERDLHRSLPEHP + ++ G+ +LRRVLTAYA+RNPNIGYCQAMNIV SV+LL+C+EEEAFWLL A+CERLLPDYYN KV+G  VDQ V +DLV  ++       D               +I M+S+SWFLT++L+V+ F  A+ I+DCFFYDGA+VIFQIAL +L   +  L+  KD+G+A   + +           L    +   D  Q +I+  +LI  AY  FGT+TN  I +LR+++RL VV  +E   +R+V+RSV   T  +  EL+ +F VFK+ ++ S Y+  H   P+  +  YDP +PYY+ ++ID++ F  LF +L PW    H+  LALR+FRLLD + DNMINF++FAW +G+ C G L E+L+LL+RL+  PCLL             P   E  D   + A    E  P  ++    DI   SG  L E          E+P +  KT    + +D L  +Q  +S AKLR+               +P+M     +    TLYD+   D +E  L +++A V T + Q  E+        R   E+D                     W I+FE++  S  +EP LV+    + D  +S +
Sbjct:    1 MWVKPEELLLANAFWDTEQANPFFVLQRRKGRGGANKGLSGLLVGTLDTVLDSKAPPFRILHQMAGSEVSYTVAIASSQAEINKDWLWLEQHLMETLASFENEDQTTDFLRCKIESLLANKEPEVVGEDEEDSSGFKSSLKKFRRLFNMPPEERLVNYYSCSVWKGRVPRQGWMYLSVNHFCFYSFLMGKEAKIITRWTDVTKLERGNNLLFPDSIKVSTRDTDYNFSLFISSDETYALIEQLANMAMKQLISEEGFEEDKALP-KSRKRSQRKISTLKRDLDARARSESYRSSFNLPLSEKLDGDAECSLWTPYNKSHAWGKLYISAHFICFSSRVRDLVTVIIPMRDVNLVEKVD-----SGNRDVLPSALLVSVKSKNNFLFAQIRDRDVVLQKIIDFLSKQPGHRAYEHFI-----------------KRDGTESMTGEMTQFFANESNPLAPQMNPN-DEISPKESVTDHLWQLHFSEYGRGVSAYRTHKTHELILKGVPEKLRGETWMVYSGAINEMLAHPGYYASLVEKTLGKENFTTDEIERDLHRSLPEHPAFQSELGIGALRRVLTAYAWRNPNIGYCQAMNIVTSVILLYCSEEEAFWLLTAVCERLLPDYYNTKVVGALVDQGVFEDLVCEYIPELYQKLDCLG------------LISMISLSWFLTLFLSVIPFDCAVNIVDCFFYDGARVIFQIALSILDGLRERLLACKDDGQAMSLLSQYLMNITNRDSTLPTSANTQVDKRQTSIDVTDLIYEAYSKFGTMTNQEIDKLRVKHRLKVVQSLEDTMMRNVLRSVSAETLFQGSELQDIFVVFKEEFMTSYYWRTH-QPPSDLLDKYDPAKPYYEQYKIDFDQFKTLFIALSPWSGFQHSDVLALRMFRLLDSNADNMINFRDFAWFLGVCCRGDLAERLKLLYRLHLPPCLLDTDKDDEEGEEETPAAAEETDSAIEAATFFHEDSP-KAESSPTDIVA-SGSSLVE----------EDPHTQYKTR---EKRDLLLAQQ--DSKAKLRN---------------VPRMNQWQFIQLCKTLYDMFHEDANEQKLYHSLATVGTLLLQIGEVGKKFPSTSRTPEEEDTPPIPGEVKSLHESGAKVDVEWSISFEQYLASMLTEPALVKQFEERLDQFASSR 1098          
BLAST of TBC1 domain family member 9 vs. TrEMBL
Match: A0A1S3JSL2 (TBC1 domain family member 9 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106175754 PE=4 SV=1)

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 451/1161 (38.85%), Postives = 680/1161 (58.57%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAA----VEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-FFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHL-GIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEA----SECIQKLSECCSHLGD-------------PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSS--DGQKGDICTESGIELTEEML--EYIHAESENPASPAKTHNFGDVQD-------------------------NLSGK----------QRTNSHAKLRSNSVEENSQWIRNTDL-----LPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTEKDWVINFEEFRHSFYSEPGLVEFLGSKQDI 3298
            MW  P EV +  +LW  E+ N +F+L++RKG+  GGLTGLLVGT D ++D+K   YRIL +    ++SY +  +NS+  I K WE LE  ++  +  F N D+A EF++ K+ S+ A     +    D EE+ ++K A+ +F K+FNMP EEKLVNYYSCS   G +P QGW+YLS+NH+CFYSFL+GKE  ++I W  V  +EK      P+SI + T+ +++ F+  L  +ETF L++QLAN+ +++LL EE ++E+  L ++ +K  P KV  LK DLDA++R+  YR  F LP++E LDG+IEC L T YNK  V G++YIS N+ICFAS++ + V ++IP REV   E   K+ + + N I    ++TT     F F  L +R+ VI K+++ L A   T R+ ++SV SD+++ S +    DS   +     G    K  N+       D+++  E  ++H W+ +F ++GRG+ M+RT +   L+L G+ +KLR EIWM+ SGA NE+  N  YY +LV Q+   ++  ++EIERDLHRSLPEHP + +  G+ +LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V +DL++ +L  +    E                ++ M+++SWFLT++L+VM F +A+ IMDCFFYDGA+V FQ+AL +L      L+   D+GEA     E ++ ++   + L D             P  + + +L+  AY  FG ++N  I++LRL++RL VV  +E NT+++V+RSV   T L+ +EL+ LF +FK+ Y++S Y+  H   P      YDP RPYY+ +RIDY+ +  +F S+ PW      +  ALR FRL+D + DN+INFKEFAW +G++C GTLEEK+RLL+RL+  P L   D + I+  T ++ + + ++  ++  D  + DI    G+   E++L  +   A  ++P SP+    F  V                            L+G+          + TNS          E  +  R +       +P++     +  W TLYDL      E  L +++A   T + Q  E+    ++ ++        S Y   G+ E +GS + +
Sbjct:    1 MWVKPEEVLLANALWVTERANPFFILQRRKGRGGGGLTGLLVGTMDAVLDNKTPPYRILHQTTNSEVSYGVAVANSKREIFKDWEWLEQHVMETLDTFENEDDATEFVRGKINSLVANVVTDDDDGKDDEETANFKIASRRFHKMFNMPKEEKLVNYYSCSYWKGGLPRQGWVYLSVNHLCFYSFLIGKEAMLVIRWTDVTKLEKGNNMIFPDSIRVNTRNQQHVFSMLLRSEETFGLMEQLANMAMKQLLSEETFEEDRDLMLKIKKSTPKKVPLLKRDLDARVRSEAYRILFNLPLDEKLDGNIECTLWTPYNKHYVWGKMYISQNYICFASRVKNLVSVVIPLREVYVVE---KTDNSTKNVINEALLVTTKGKMNFLFCELPDRNFVIEKLSDLLSAQPATGRQREASVCSDASSKSDE----DSTSSQFQPALGSLFSKRRNSQ------DEVMAKEKVKEHLWDVHFAEYGRGICMYRTHKTHELILRGIPDKLRGEIWMVYSGAINEMATNDGYYASLVEQSSGKNTLANDEIERDLHRSLPEHPAFQSPLGIGALRRVLTAYAWRNPTIGYCQAMNIVTSVLLLYASEEEAFWLLVALCERLLPDYYNTKVVGALVDQGVFEDLIRENLPNLHAKLEHL-------------GLLSMIALSWFLTLFLSVMRFASAVNIMDCFFYDGAKVAFQVALAILDGRSEDLLSCNDDGEAMTIMGEYLENITNRDATLIDIPHTKLYSTGVDPPPSIDVADLVREAYLKFGHISNEDIEKLRLKHRLKVVQNIEDNTMKNVLRSVANDTLLQGEELQDLFLLFKEEYLSSCYWRTH-PQPCDPSEKYDPARPYYEQYRIDYDQYKEIFLSICPWAGGPSAETTALRSFRLMDTNSDNLINFKEFAWCLGVVCKGTLEEKVRLLYRLHQPPALRDTDDDEIEPATPKSDSTESAMEATNFFDEDEDDI---PGV--GEDILGPKSPDANLQSPVSPSIHLEFSQVLQIPPTAETAKAAQTAAAVTPPGGSTLTLTGQNDASSSSSSSKDTNSQKSWDMKPESERQRLYRESSRARYGDIPRLTQGQFIKLWKTLYDLMMEHPEEQQLYHSLAMAGTLLLQIGEV---GKQFYLPKSTSMDSSAYGSEGMSEVIGSVESV 1126          
BLAST of TBC1 domain family member 9 vs. TrEMBL
Match: A0A1S3JSN9 (TBC1 domain family member 9 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175754 PE=4 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 451/1173 (38.45%), Postives = 680/1173 (57.97%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAA----VEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-------------FFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHL-GIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEA----SECIQKLSECCSHLGD-------------PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSS--DGQKGDICTESGIELTEEML--EYIHAESENPASPAKTHNFGDVQD-------------------------NLSGK----------QRTNSHAKLRSNSVEENSQWIRNTDL-----LPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTEKDWVINFEEFRHSFYSEPGLVEFLGSKQDI 3298
            MW  P EV +  +LW  E+ N +F+L++RKG+  GGLTGLLVGT D ++D+K   YRIL +    ++SY +  +NS+  I K WE LE  ++  +  F N D+A EF++ K+ S+ A     +    D EE+ ++K A+ +F K+FNMP EEKLVNYYSCS   G +P QGW+YLS+NH+CFYSFL+GKE  ++I W  V  +EK      P+SI + T+ +++ F+  L  +ETF L++QLAN+ +++LL EE ++E+  L ++ +K  P KV  LK DLDA++R+  YR  F LP++E LDG+IEC L T YNK  V G++YIS N+ICFAS++ + V ++IP REV   E   K+ + + N I    ++TT                 F F  L +R+ VI K+++ L A   T R+ ++SV SD+++ S +    DS   +     G    K  N+       D+++  E  ++H W+ +F ++GRG+ M+RT +   L+L G+ +KLR EIWM+ SGA NE+  N  YY +LV Q+   ++  ++EIERDLHRSLPEHP + +  G+ +LRRVLTAYA+RNP IGYCQAMNIV SVLLL+ +EEEAFWLLVA+CERLLPDYYN KV+G  VDQ V +DL++ +L  +    E                ++ M+++SWFLT++L+VM F +A+ IMDCFFYDGA+V FQ+AL +L      L+   D+GEA     E ++ ++   + L D             P  + + +L+  AY  FG ++N  I++LRL++RL VV  +E NT+++V+RSV   T L+ +EL+ LF +FK+ Y++S Y+  H   P      YDP RPYY+ +RIDY+ +  +F S+ PW      +  ALR FRL+D + DN+INFKEFAW +G++C GTLEEK+RLL+RL+  P L   D + I+  T ++ + + ++  ++  D  + DI    G+   E++L  +   A  ++P SP+    F  V                            L+G+          + TNS          E  +  R +       +P++     +  W TLYDL      E  L +++A   T + Q  E+    ++ ++        S Y   G+ E +GS + +
Sbjct:    1 MWVKPEEVLLANALWVTERANPFFILQRRKGRGGGGLTGLLVGTMDAVLDNKTPPYRILHQTTNSEVSYGVAVANSKREIFKDWEWLEQHVMETLDTFENEDDATEFVRGKINSLVANVVTDDDDGKDDEETANFKIASRRFHKMFNMPKEEKLVNYYSCSYWKGGLPRQGWVYLSVNHLCFYSFLIGKEAMLVIRWTDVTKLEKGNNMIFPDSIRVNTRNQQHVFSMLLRSEETFGLMEQLANMAMKQLLSEETFEEDRDLMLKIKKSTPKKVPLLKRDLDARVRSEAYRILFNLPLDEKLDGNIECTLWTPYNKHYVWGKMYISQNYICFASRVKNLVSVVIPLREVYVVE---KTDNSTKNVINEALLVTTKGKKPYKGAPYVMEQMNFLFCELPDRNFVIEKLSDLLSAQPATGRQREASVCSDASSKSDE----DSTSSQFQPALGSLFSKRRNSQ------DEVMAKEKVKEHLWDVHFAEYGRGICMYRTHKTHELILRGIPDKLRGEIWMVYSGAINEMATNDGYYASLVEQSSGKNTLANDEIERDLHRSLPEHPAFQSPLGIGALRRVLTAYAWRNPTIGYCQAMNIVTSVLLLYASEEEAFWLLVALCERLLPDYYNTKVVGALVDQGVFEDLIRENLPNLHAKLEHL-------------GLLSMIALSWFLTLFLSVMRFASAVNIMDCFFYDGAKVAFQVALAILDGRSEDLLSCNDDGEAMTIMGEYLENITNRDATLIDIPHTKLYSTGVDPPPSIDVADLVREAYLKFGHISNEDIEKLRLKHRLKVVQNIEDNTMKNVLRSVANDTLLQGEELQDLFLLFKEEYLSSCYWRTH-PQPCDPSEKYDPARPYYEQYRIDYDQYKEIFLSICPWAGGPSAETTALRSFRLMDTNSDNLINFKEFAWCLGVVCKGTLEEKVRLLYRLHQPPALRDTDDDEIEPATPKSDSTESAMEATNFFDEDEDDI---PGV--GEDILGPKSPDANLQSPVSPSIHLEFSQVLQIPPTAETAKAAQTAAAVTPPGGSTLTLTGQNDASSSSSSSKDTNSQKSWDMKPESERQRLYRESSRARYGDIPRLTQGQFIKLWKTLYDLMMEHPEEQQLYHSLAMAGTLLLQIGEV---GKQFYLPKSTSMDSSAYGSEGMSEVIGSVESV 1138          
BLAST of TBC1 domain family member 9 vs. TrEMBL
Match: V4C7V3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_152898 PE=4 SV=1)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 430/1086 (39.59%), Postives = 641/1086 (59.02%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRD-EAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKP-TENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------------QKLSECCSHLGDPD-QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGD----KELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELT----EEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW  P EV +  +LW  E+ N YFVL+KRKG   GGL GLLVGT D ++D+K   YRILL+ +  ++SY +  +N++  I K WE +E +++  ++ F  D EA EFI+ K+ S+ A   +  + +E++ +  AT KF K+FNMP+EEKLVNYYSCS   G++P QGW+YLS+NH+CFYSFLMGKE ++I+ W  +  +E+    F P+++ I T+   Y F+  ++  E++ LI+QLAN+ +++L+ E G++E+  +  +++K    K+S LK DLDA+ R+  +R++F+LP+ E LDGD EC L T YNK+ VSGRLY+S NFICFAS++ D V +IIP R++   E +  S+  S N I    ++TT    +F F    +RD ++ +I+++L                                              +  P+P ++  D++   E  + H W+ +F ++G+GM M+RT   + LVL G+ +K R  +WM+ SGA NE+  N  YY  +V  +   SS  +EEIERDLHRSLPEHP +    G+ +LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+ +EEEAFWLL AICERLLPDYYN KV+G  +DQ+V +DL++++L    S  D               ++ M+S+SWFLTI+L+VM F +AI I+DCFFYDGA+VIFQ+AL +L +    L++  ++GEA   +                 K S   S  GD +  + + +LI  +Y  FG ++N ++ +LRLQ RL VV  +E +T R+++RSV   T  +  EL+ L+ +FK+ Y+ S Y+      PA     YDP RPYYD +++D++ F  +F SL PW    H   LA+R FR LD++ DNMINFKEF  ++GIIC G++ E+++LL+ L+  P L   D    +E +D  T          P++         TESG+E T    E  LE +  E E           G +  N   ++RT S  KL+S++ E+     +N +   +M     +  W TLYD+  +   + DL +++A + T + Q  E+
Sbjct:    1 MWVKPDEVLLANALWVNERANPYFVLQKRKGYGGGGLAGLLVGTIDTVLDNKTPPYRILLQTIGSELSYYVSVANNKKEIHKDWEWIEQNLMQTLATFETDDEATEFIRCKIESLLANNVKPTEDDETQRFVTATKKFRKLFNMPIEEKLVNYYSCSYWKGKLPRQGWMYLSINHLCFYSFLMGKEDKVILRWTDITKLERGNNMFFPDTVKITTREASYYFSMIMHSAESYRLIEQLANMAMKQLMQEGGFEEDKLISFRTKKKTSKKMSSLKRDLDARARSEAFRQAFQLPVQEKLDGDEECTLWTPYNKQHVSGRLYLSSNFICFASRVRDLVTVIIPLRDIQVVEKVDNSV--SGNLISKALLVTTKGKMSFTFAQFSDRDFILERISDYL----------------------------------------------SRQPEPKSQKSDELSPKETVKTHLWDVHFAEYGKGMCMYRTHRTQELVLKGIPDKYRGGMWMVFSGAVNEMAANDGYYANIVQLSCGKSSLATEEIERDLHRSLPEHPAFQNALGIDALRRVLTAYAWRNPNIGYCQAMNIVTSVLLLYTSEEEAFWLLTAICERLLPDYYNTKVVGALIDQSVFEDLIRNYLP---SMHDKLE---------TLGLLSMISLSWFLTIFLSVMPFGSAINILDCFFYDGAKVIFQVALAILNQKSDELLNCGEDGEAMTILCQYLENVTNKDSTIPTVKHSSAMSKSGDVNPSVDVTDLIEDSYRKFGNISNQVVDKLRLQYRLRVVQNIEDSTKRNIIRSVASDTLFKDKELDELYILFKEEYLTSCYWRTS-QQPAETADKYDPSRPYYDLYKVDFDQFKTMFLSLAPWATGVHAGILAIRAFRYLDENKDNMINFKEFVHILGIICKGSVSERIKLLYLLHLPPALTSNDNIEEEEDVDTPTS---------PNTD-------STESGVEATDFFDESELEAMREEMEE----------GGIYVNKKRRKRTLSE-KLQSDTKED----YKNVE---RMNQKQFIQLWKTLYDMFLDSPQQQDLYHSIATIGTLLLQIGEV 991          
BLAST of TBC1 domain family member 9 vs. TrEMBL
Match: A0A2C9K5E8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106052097 PE=4 SV=1)

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 402/945 (42.54%), Postives = 583/945 (61.69%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQL-KVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNI-KTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQ--------TGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEA-----------------SECIQKLSECCSHLGDPDQ--LTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGD 2764
            MW  P EV +  +LW  E+ N +FVL++RKG   GGLTGLLVGT D ++DSK   YRIL +    ++SY I ++N++  I++ W+ LE++++   + F N D+  EFIK K+ S+ A  + + + EE E  + +T KF K FNMP EEKLVN+YSCS   G IP QGW+YLS+NH+CFYSFLMGKE ++I+ W  +  +E       P+S+ + T+   + F+  L+  ETF+L++QLAN+ +++L+ E G+QE+  L           K+S LK DLDA+ R+  +R +FRLP+ E LDGD EC L T +NK+ V GRLY+S N++CFAS++ D V +IIP R++   E +  S+  S N I K  F+ T     F F   H+R++++ KI++FL      +R +                 V  ++  D  Q         G F IK A      E L K    E  ++H W+ +F + GRGM M+RT +  +LVL G+ ++ R E+WM+ SGA NEL  +P+YY  +V Q++  SS  +EEIERDLHRSLPEHP +  D G+ +LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+ +EEEAFWLL AICERLLPDYYN KV+G  +DQ V +DL+  +L    +  +T              ++ M+S++WFLTI+L+VM F  A+ I+DCFFYDGA+VIFQ++L +L   +  L++ +++GEA                 +  I   S      G  ++  + + ++I  +Y+ F +++N  I +LRL++RL VV  +E N  R+++RSV   TK E  ELE L+ +FK+ Y+ S Y+       +PD   YDP RPYYD +++D++ F  LF SL PW    +   LALR FRLLD++ DN+INFKEF  V+G +C   + ++++LL+ L+  P LLP D
Sbjct:    1 MWVKPQEVLLANALWATERANPFFVLQRRKGYGGGGLTGLLVGTLDTVLDSKTPPYRILHQTEGSELSYSIAEANNKKEILQNWDWLESNVIGTCAAFDNEDDVTEFIKCKIESLLANVELTKEDEEIEDLRTSTKKFRKYFNMPKEEKLVNHYSCSYWKGNIPRQGWMYLSVNHLCFYSFLMGKEAKLILRWADITKLEIGNNMLFPDSVIVSTRDGFHHFSMLLHSTETFNLMEQLANMAMKQLMQEPGFQEDKSLVSKVKSTKKRKKMSLLKRDLDAKARSERFRLAFRLPVTEKLDGDEECTLWTPFNKQHVWGRLYLSNNYMCFASRVKDLVTMIIPMRDITVAERVDNSV--SGNLINKAIFITTKNKINFTFSEFHDRNLILEKISDFLSKQPIVNRTTS----------------VSEEKNSDQDQDLEFQPALMGLFSIKEAE-----EMLPKDEAKEAAKEHLWDLHFAEFGRGMCMYRTHDTHQLVLKGIPDRYRGEMWMVFSGAVNELATHPNYYAEIVKQSKGHSSIATEEIERDLHRSLPEHPAFQNDRGIGALRRVLTAYAWRNPNIGYCQAMNIVTSVLLLYVSEEEAFWLLTAICERLLPDYYNTKVVGALIDQGVFEDLISEYLPSLHNKLETLG------------LLSMISLAWFLTIFLSVMPFNCAVNILDCFFYDGARVIFQVSLTILDMKREELLESREDGEAMAVLCQFMDNIVNSNSTTPNIMHTSNATGVTGQTNENAVDVADIILQSYQKFWSISNQDINKLRLKHRLKVVQTIEDNVKRNILRSVAVYTKFEGKELEDLYFLFKEEYLTSCYWRTSQQVDSPD--KYDPNRPYYDQYKVDFDQFKTLFLSLSPWATGQYASTLALRTFRLLDENKDNLINFKEFISVLGTMCKSDITQRIKLLYLLHMPPALLPTD 908          
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:103035849])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 404/1103 (36.63%), Postives = 612/1103 (55.49%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXX----XXXXXXXXXXXXXXXXXXLDVVDSKEIRD---------NSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPH--SSDGQKGDICTE--SGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +F+L++RKG   GG    L VGT D ++DS A    YRIL +  +  + + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +S   +E E    ++ A +K  K+F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PES+ + T+  E+ F+ FLNI +TF L++QLANI +++LL  EG+  +  L    + L    VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICFAS+  D  +LIIP REV     + +    SS       + T     F F NL +RD ++ +I++FL  T +     + +S++   S   +      V+ + E+            ++ G   I   + P   E+L      E  ++ +W  +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV       +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL      GD  P ++   ELI ++YE FG++   +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     + +     +DP  PY + +RID   F +LF ++ PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + EKL+LL++L+  P L P + E   + T+  +   + IP   SS      +  E  SG E+ E        E        K  ++               + ++ +   E   + I++   LP+M  +  +    TLY++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWITPEEVLLANALWVSERANPFFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGDSQLFWSIACGSSRKEITEHWEWLETNLLQTLSIFDNDDDITTFVKGKIQGIIAEENKSRQAQEDEDCGKFREAELKMRKLFGMPEEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVQWTDVTQLDKNATLVFPESVRVSTRDTEHYFSMFLNINDTFKLMEQLANIAMRQLLDNEGFAADRSLPKPCKTLK--NVSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFASREEDLCQLIIPLREV----SIVEKADSSSVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFLQRTPDRLCGFAGQSETPSPSTPTSLPPTPPVLGAGELLPIQHYSPSLPTAKQGLLSIYQKDQP---EDLGPKATKEKMKEESWNIHFFEFGRGVCMYRTSKTRDLVLKGIPESLRGELWLLFSGAQNEMATHPGYYAELVETAMGKCTLATEEIERDLHRSMPEHHAFQNEMGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMEQLLACTDEGEAMTILGRYLDNVVNKQTVSTPIPHLHALLTSGDEPPPEIDAFELIKTSYEKFGSLRADVIEQMRFKQRLKVIQSLEDTAKRSVVRAIMTESAFTIEELEELYVLFKAKHIMSCYWG----ASSSAAERHDPSLPYLEQYRIDCGQFGQLFATMAPWSCGMHTATLSTRLFRLLDVNKDSLINFKEFVTGLSGMYHGDMTEKLKLLYKLHLPPALCPEEAESALEATQ--FFTDDDIPQDPSSLSHLDFLVQEVASGDEVKEAKEAGEAGEETEEKKEEKVKDY-------------KYYLRMWAKEKEPKKETIKD---LPRMNQEQFIELCKTLYNMFSEDPLEQELYHAIATVASLLLRIGEVGKK 1060          
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:103035849])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 400/1099 (36.40%), Postives = 607/1099 (55.23%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXX----XXXXXXXXXXXXXXXXXXLDVVDSKEIRD---------NSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +F+L++RKG   GG    L VGT D ++DS A    YRIL +  +  + + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +S   +E E    ++ A +K  K+F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PES+ + T+  E+ F+ FLNI +TF L++QLANI +++LL  EG+  +  L    + L    VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICFAS+  D  +LIIP REV     + +    SS       + T     F F NL +RD ++ +I++FL  T +     + +S++   S   +      V+ + E+            ++ G   I   + P   E+L      E  ++ +W  +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV       +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL      GD  P ++   ELI ++YE FG++   +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     + +     +DP  PY + +RID   F +LF ++ PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + EKL+LL++L+  P L P + E   + T+  +   + IP              G E+ E        E        K  ++               + ++ +   E   + I++   LP+M  +  +    TLY++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWITPEEVLLANALWVSERANPFFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGDSQLFWSIACGSSRKEITEHWEWLETNLLQTLSIFDNDDDITTFVKGKIQGIIAEENKSRQAQEDEDCGKFREAELKMRKLFGMPEEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVQWTDVTQLDKNATLVFPESVRVSTRDTEHYFSMFLNINDTFKLMEQLANIAMRQLLDNEGFAADRSLPKPCKTLK--NVSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFASREEDLCQLIIPLREV----SIVEKADSSSVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFLQRTPDRLCGFAGQSETPSPSTPTSLPPTPPVLGAGELLPIQHYSPSLPTAKQGLLSIYQKDQP---EDLGPKATKEKMKEESWNIHFFEFGRGVCMYRTSKTRDLVLKGIPESLRGELWLLFSGAQNEMATHPGYYAELVETAMGKCTLATEEIERDLHRSMPEHHAFQNEMGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMEQLLACTDEGEAMTILGRYLDNVVNKQTVSTPIPHLHALLTSGDEPPPEIDAFELIKTSYEKFGSLRADVIEQMRFKQRLKVIQSLEDTAKRSVVRAIMTESAFTIEELEELYVLFKAKHIMSCYWG----ASSSAAERHDPSLPYLEQYRIDCGQFGQLFATMAPWSCGMHTATLSTRLFRLLDVNKDSLINFKEFVTGLSGMYHGDMTEKLKLLYKLHLPPALCPEEAESALEATQ--FFTDDDIPQ-------------GDEVKEAKEAGEAGEETEEKKEEKVKDY-------------KYYLRMWAKEKEPKKETIKD---LPRMNQEQFIELCKTLYNMFSEDPLEQELYHAIATVASLLLRIGEVGKK 1043          
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:103035849])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 365/922 (39.59%), Postives = 535/922 (58.03%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEE 2710
            MW  P EV +  +LW  E+ N +F+L++RKG   GG    L VGT D ++DS A    YRIL +  +  + + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +S   +E E    ++ A +K  K+F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PES+ + T+  E+ F+ FLNI +TF L++QLANI +++LL  EG+  +  L    + L    VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICFAS+  D  +LIIP REV     + +    SS       + T     F F NL +RD ++ +I++FL           +  S     S     +++ K     ++ G   I   + P   E+L      E  ++ +W  +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV       +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL      GD  P ++   ELI ++YE FG++   +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     + +     +DP  PY + +RID   F +LF ++ PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + E
Sbjct:    1 MWITPEEVLLANALWVSERANPFFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGDSQLFWSIACGSSRKEITEHWEWLETNLLQTLSIFDNDDDITTFVKGKIQGIIAEENKSRQAQEDEDCGKFREAELKMRKLFGMPEEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVQWTDVTQLDKNATLVFPESVRVSTRDTEHYFSMFLNINDTFKLMEQLANIAMRQLLDNEGFAADRSLPKPCKTLK--NVSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFASREEDLCQLIIPLREV----SIVEKADSSSVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFL-QRTPDRLCGFAGQSVSQTYSKTGFSLLE-KSYLPTAKQGLLSIYQKDQP---EDLGPKATKEKMKEESWNIHFFEFGRGVCMYRTSKTRDLVLKGIPESLRGELWLLFSGAQNEMATHPGYYAELVETAMGKCTLATEEIERDLHRSMPEHHAFQNEMGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMEQLLACTDEGEAMTILGRYLDNVVNKQTVSTPIPHLHALLTSGDEPPPEIDAFELIKTSYEKFGSLRADVIEQMRFKQRLKVIQSLEDTAKRSVVRAIMTESAFTIEELEELYVLFKAKHIMSCYWG----ASSSAAERHDPSLPYLEQYRIDCGQFGQLFATMAPWSCGMHTATLSTRLFRLLDVNKDSLINFKEFVTGLSGMYHGDMTE 895          
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Match: tbc1d9 (TBC1 domain family, member 9 (with GRAM domain) [Source:ZFIN;Acc:ZDB-GENE-060810-33])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 388/1091 (35.56%), Postives = 599/1091 (54.90%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY--DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAAVEKQSVDTEE---SESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKINNFL----------------IXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKE----IRDNS---QTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVG-IICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW NP EV +  +LW  E+ N YF+L+KRKG   GG     +     D ++DS A    YRIL +  +  I + I   +S+  I + WE LE+++L  +S F N ++   F+K K+  + A   ++ D +E   +E +K A  KF K+F MP EEKLVNYYSCS   G++P QGWLYLS+NH+CFYS+L+GKE ++++ W  +  +EK+     P+ + + T+  E+ F+ FLN+ ETF L++QLANI +++LL  +G++++ +   + +K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK      LIIP REV   E        SSN + +P  I+T +   F F NL +RD ++ +I++FL                + +++    S+       +   + L      E    + DNS    T   M  Y    +  E  +  +  E  ++  W+ +F ++G+G+ M+RT + + LVL G+   +R E+W++ SGA NE+  +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L + ++       D   +           +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G ++IFQ+AL +L  +   L++ KD+GEA   + +       +    + TI   I         +T SL   L LQ                 VR++   T    DELE L+ +FK  ++ S Y+       +  M  +DP  PY + +R+D E F  LFT L  W    HT  LA+R FRLLDQ+ D +INF+EF  + G ++CHG L EKL+LL++++  P L     E         Y  ++  P +S G                 L++     ++      T     V+   +   RT  + +L +   +   + ++N   LPK+     +    TLY++ + D +E +L +A A V + + +  E+
Sbjct:    1 MWVNPEEVLLAGALWMTERANPYFILQKRKGHGDGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLIYWTIAHGSSRREITEHWEWLEHNLLQTLSIFENENDITTFVKGKIQGIIAEYNKNHDIKEDDDTEKFKEAITKFRKLFGMPEEEKLVNYYSCSYWKGKVPRQGWLYLSINHLCFYSYLLGKEVKLVVRWADITQLEKNATLLLPDMVRVSTRCSEHVFSVFLNVNETFKLMEQLANIAMRQLLDNKGFEQD-RSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEETICSLIIPLREVTIVEKAD-----SSNVLPSPLSISTKNRMTFLFANLKDRDFLVQRISDFLQQTSSKIYFEREITGSLNSSDDEVYSQQGSLLSCSPQRSSLGSEGESERQFNLNDNSVPTATQALMTMYRR--RSPEEFNPKLAKEFLKEQAWKNHFTEYGQGVCMYRTDKTKELVLKGIPENMRGELWLLFSGAINEMATHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARVYVP---QLYDCMQELG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKLIFQLALSVLDANIHQLLNCKDDGEAMTVLGRSDMRHERISKQCEETINNFI---------ITLSLSISLFLQ-----------------VRTIITETSFTIDELEELYSLFKAEHLTSCYWGG----TSNPMDRHDPSLPYLEQYRMDLEQFKSLFTVLFSWASGTHTDSLAMRFFRLLDQNADALINFREF--ITGLVLCHGDLTEKLKLLYKMHVLPELHHEQDEPDSAFEATQYFFEDITPETSHG-----------------LDHKSKNDKDDGFVRVTFKNEKVKKMHTPDYRT--YLRLWNQETKSKPENMKN---LPKLNQGQFIELCKTLYNMFSEDPNEQELYHATATVTSLLLEMGEV 1017          
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:103035849])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 393/1103 (35.63%), Postives = 593/1103 (53.76%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXX-XXXYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE---SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXX----XXXXXXXXXXXXXXXXXXLDVVDSKEI---------RDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPH--SSDGQKGDICTE--SGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVK 3202
            MW  P EV +  +LW  E+ N +F+L++RKG   GG    L VGT D ++DS A    YRIL +  +  + + I   +S+  I + WE LE ++L  +S F+ D+ I  F+K K+  + A E +S   +E E    ++ A +K  K+F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++ W  V  ++K+     PES+ + T+  E+ F+ FLNI +TF L++QLANI +++LL  EG+  +  L    + L    VS LK DLDA+ +N  YR  FRL  +E LDG  +C L T + K  V G++++S N+ICFAS+  D  +LIIP REV     + +    SS       + T     F F NL +RD ++ +I++FL  T +     + +S++   S   +      V+ + E+            ++ G   I   + P   E+L      E  ++ +W  +F + GRG+ M+RT + R LVL G+   LR E+W++ SGAQNE+  +P YY  LV       +  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYAYRNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L +                     +I  +S+SWFLT++L+VM F +A+ ++DCFFY+G +VIFQ++L +L  +   L+   DEGEA   +          Q +S    HL      GD  P ++   ELI ++YE                                 VR++   +    +ELE L+ +FK  ++ S Y+     + +     +DP  PY + +RID   F +LF ++ PW    HT  L+ R+FRLLD + D++INFKEF   +  + HG + EKL+LL++L+  P L P + E   + T+  +   + IP   SS      +  E  SG E+ E        E        K  ++               + ++ +   E   + I++   LP+M  +  +    TLY++ + D  E +L +A+A V + + +  E+  K
Sbjct:    1 MWITPEEVLLANALWVSERANPFFILQRRKGHGRGGGITGLLVGTLDVVLDSSARVAPYRILHQTGDSQLFWSIACGSSRKEITEHWEWLETNLLQTLSIFDNDDDITTFVKGKIQGIIAEENKSRQAQEDEDCGKFREAELKMRKLFGMPEEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVQWTDVTQLDKNATLVFPESVRVSTRDTEHYFSMFLNINDTFKLMEQLANIAMRQLLDNEGFAADRSLPKPCKTL--KNVSALKRDLDARAKNERYRALFRLTQDERLDGHTDCTLWTPFAKMHVVGQMFVSNNYICFASREEDLCQLIIPLREV----SIVEKADSSSVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFLQRTPDRLCGFAGQSETPSPSTPTSLPPTPPVLGAGELLPIQHYSPSLPTAKQGLLSIYQKDQP---EDLGPKATKEKMKEESWNIHFFEFGRGVCMYRTSKTRDLVLKGIPESLRGELWLLFSGAQNEMATHPGYYAELVETAMGKCTLATEEIERDLHRSMPEHHAFQNEMGIAALRRVLTAYAYRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRECLPLLYEHMQDLG------------VISTISLSWFLTLFLSVMPFDSAVLLVDCFFYEGIKVIFQVSLAVLHANMEQLLACTDEGEAMTILGRYLDNVVNKQTVSTPIPHLHALLTSGDEPPPEIDAFELIKTSYE---------------------------------VRAIMTESAFTIEELEELYVLFKAKHIMSCYWG----ASSSAAERHDPSLPYLEQYRIDCGQFGQLFATMAPWSCGMHTATLSTRLFRLLDVNKDSLINFKEFVTGLSGMYHGDMTEKLKLLYKLHLPPALCPEEAESALEATQ--FFTDDDIPQDPSSLSHLDFLVQEVASGDEVKEAKEAGEAGEETEEKKEEKVKDY-------------KYYLRMWAKEKEPKKETIKD---LPRMNQEQFIELCKTLYNMFSEDPLEQELYHAIATVASLLLRIGEVGKK 1027          
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Match: TBC1D9 (TBC1 domain family member 9 [Source:HGNC Symbol;Acc:HGNC:21710])

HSP 1 Score: 493.041 bits (1268), Expect = 6.232e-157
Identity = 296/891 (33.22%), Postives = 465/891 (52.19%), Query Frame = 2
Query:  239 ICKSNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGN--------LHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEI--RDNSQTGRFMIKYANAPKPTENLDKIIEI------------------------ENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEAS-----------------ECIQKLSECCSHLGDP-DQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGES-TKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWG---HTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLY 2737
            +    S+  I + W+ LE ++L+ +  F  D  I +F+  K+  + A E +        +   A V+F K F  P  E LV   SCS   GR+P QGWLYLS+NH CFYS L+GKE ++ IPWV V  +EK      PE++ + T+  +++F+ FLN+ ET  L+++LA+  +++LL  E  +        +   +P       ++L  + ++  +R  FRLP +E L+ + +C +    +K  VSGRL+ S ++ICFAS+      +++P  EV+  E  T     SS+ +     ++T +   F F +        LH R  ++      ++ +               +   +  ++V   EI  RD    G       + P+ +E  +  +                          E  ++  W K+F   GR   M+ T   R LV+ G+  +LR E+W++ SGA +++  NP +Y  LV ++   +S  +EEIERDLHRSLPEHP +    G+ +LRRVLTAYA+RNP IGYCQAMNIV S LL+F +EEEAFWLLVA+CERLLPDYYN +V+G  +DQ V ++L+         F  T ++            I   S+SWFLT++L+V+   +A  ++DCF  DGA+V+FQ+AL +L  +   L+  +D+GEA                   C+  +    +  G P   + I +L+ +AYE FG++ + L++Q+R + RL V+  +E  T R+VVR++    T      LE LF +FK ++V S Y+       A  +  +DP  PY   +R+  E F RL   L PW    H+  L  R+F  +D     +INF++F   +G++ +G L EKLR+L+RL+
Sbjct:    1 VSAGTSKEEIEEHWQWLEVNLLHILPVFESDGDITDFVLGKIKGIIAEEMKGEGDGAERTRGEALVRFRKFFAAPSTELLVVAVSCSYWKGRMPRQGWLYLSVNHACFYSVLLGKEAKLAIPWVDVVRLEKKGSAPFPEAVVLTTRHVQHNFSMFLNVAETHVLMERLADAAVRRLLDGERVELGDDECDGAPTTSPAAAQPGAVELIGRAQSARFRAQFRLPRSEQLEVEGDCTVWLPSDKSHVSGRLHASQSYICFASRDDSICTIVVPFLEVVVIEAAT-----SSSVLPNALAVSTQNRLTFLFAHVRERDSLLLHLRQALVRARLRSVVRSRCGGGDDDDDDDRCKSVWESPANLVVPCEINSRDEEAAG-------HEPRGSEKTNGAVSFTGTQPLLNVFYQGGFEEPNIKLSKEVSKEEMWRKHFQQFGRATCMYVTEHTRHLVMQGIPVRLRRELWLLFSGAVHDMGSNPGHYAELVDRSLGRASIATEEIERDLHRSLPEHPAFQHPLGIDALRRVLTAYAHRNPRIGYCQAMNIVTSALLIFASEEEAFWLLVALCERLLPDYYNNRVVGALIDQGVFEELIA-------EFLPTLHERLQELG-----FIATTSLSWFLTLFLSVLPLESAACVLDCFMLDGARVLFQLALAVLHANAEPLLACRDDGEAMMLLGRYLDSVVNVDSILPCVPSMHATANFDGQPLAPMEISDLLHTAYERFGSIKSELMEQMRFRQRLKVIQYLEDTTKRNVVRAISTGPTGFTAKVLEDLFDLFKLVHVQSVYWATDGGRAA--LGRHDPSLPYMQQYRVCLEQFLRLSAHLSPWACGEHSACLFSRVFSAMDVARTGLINFRDFVLWLGVLYNGDLTEKLRMLYRLH 865          
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006389.1 (pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-1 gene:ENSPMAG00000005741.1 transcript:ENSPMAT00000006389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 490.73 bits (1262), Expect = 1.652e-155
Identity = 289/808 (35.77%), Postives = 452/808 (55.94%), Query Frame = 2
Query:  248 SNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVEKQS--------VDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPK--PTENLDKIIEI---------------ENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASEC-----------------IQKLSECCSHLGDPD-QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFR 2539
             +S+    + W+ LE ++L  +S F  +E + EF+K KV  + A E +            ++S+ +  A  KF K+F MP EE+LVNYYSCS   GR+P QGWLYLS+NH+CFYS L+GKE ++++ W  V  +E++     PES+ + T+  +  F+ FL++ ETF L+++LA++ +++LL          L   +  L     S ++ DLDA++++  Y  +FRLP +E LDG  +C L   ++K   +G+LY+S N++CF+S+      L+IP REV   E    S  L S    +    T + + F F NL +R  ++ +I+  L +++   ++  +   +    SS +            S       +  +AP   P E  + ++ +               E  ++ +W  +F + GRG+ M+RT   R LV+ G+   LR E+WM  SGA +E+   P YY  +V  +    S V++EIERDLHRSLPEHP + ++ G+++LRRVLTAYA+RNP+IGYCQAMNIV SVLLL+  EEEAFWLLVA+CER+LPDYYN +V+   VDQ V ++L + HL       +   D           +I  +S+SWFLT++L+V+ F++A+ ++DCF  DG ++IFQ+AL +L  +   L+   D+GEA                    I  L    S   +P  ++ I +LI ++YE FG +   +I+Q+R + RL V+  +E  T R+VVRS+   T+   +ELE LF +FK  ++ S Y+     S A     +DP  PY +++R
Sbjct:    1 GSSRQEATRHWDWLEQNLLQTLSVFETEEDVTEFVKGKVQGIMAEEGRQRGGTAGAAGAEQDSDKFMEAVAKFRKLFGMPEEERLVNYYSCSYWKGRVPRQGWLYLSVNHVCFYSLLLGKEAKLVVRWADVTCLERTATVVLPESVRVATRDGDLFFSMFLSVGETFRLMERLADMAVRRLLNSGDAAPGPALGKHTTPL-----SAVRRDLDARVKSEAYCSAFRLPRDERLDGHTDC-LWLPFSKMHAAGQLYVSSNYLCFSSREEGLCSLVIPLREVTVVEKADSSSVLPSPLSVS----TRSRTNFLFANLRDRAFLLQRISELLRSSSAVGKQQGAPTPTAGTPSSQQGSQPQPNGAATGSAASGVDSQGGSAPSNAPQETTEALMTMFHRSDSHTIDLKQAKELMKEESWSIHFAEFGRGVCMYRTERTRDLVMRGIPESLRGELWMHFSGAIHEMNSYPGYYAEIVRSSMGRMSLVTDEIERDLHRSLPEHPAFQSEMGIAALRRVLTAYAHRNPSIGYCQAMNIVTSVLLLYTKEEEAFWLLVALCERMLPDYYNTRVVVALVDQGVFEELTREHLP---QLCERMQDLG---------VISTISLSWFLTLFLSVLPFSSAVCVVDCFMLDGVRMIFQLALAVLHANMGKLLSCHDDGEAMTILAFYLDSVTNKDSTLPPITHLHALLSENTEPQPEVDIFQLIRTSYERFGCIRAEVIEQMRFRQRLRVIQTLEDTTKRNVVRSIMTETQFTLEELEELFVLFKWEHLRSCYWG----SAAAAGERHDPSLPYLESWR 782          
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 138.272 bits (347), Expect = 2.873e-33
Identity = 78/238 (32.77%), Postives = 132/238 (55.46%), Query Frame = 2
Query: 1460 RTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLN---PDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTD--EGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLL-PDYYNVKVIGVRVDQTVLKDLVQSHLG-IDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLI 2152
            R+ EL+ L+ +G+ ++LR+ +W          +       YY  L+ ++    +  + ++E DL R+LP +  + T   EG+  LRRVL AYA+ NP +GYCQ +N +A++ L++  EE+AFW LVAI E L+ PDYY+  ++  +VDQ + K+LV   L  +   FE    D            + +++ +WFL ++++ +       I D F Y+G +VIF+ AL +L+  +  LI
Sbjct:  644 RSPELKMLMRSGVPHELRSRVWRWAVEQHVRAIRGRHAASYYCELLERSHGQHNPAARQVELDLPRTLPNNRHFETQSSEGIVKLRRVLLAYAWHNPEVGYCQGLNRLAAIALIYLEEEQAFWCLVAIVECLMPPDYYSKTLLASQVDQRLFKELVTEKLPRLAAHFEQHGVD------------VSLITFNWFLVLFVDSVGSDMVFRIWDAFLYEGTKVIFRYALAMLKCREEQLI 869          
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Match: tbc1d10b (TBC1 domain family, member 10b [Source:ZFIN;Acc:ZDB-GENE-030131-7754])

HSP 1 Score: 104.76 bits (260), Expect = 4.696e-24
Identity = 66/217 (30.41%), Postives = 109/217 (50.23%), Query Frame = 2
Query: 1493 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTD--EGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQ--SHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLR 2131
            G+   LRA  W  +SG++  +   P  +  L  +      ++ E I++DLHR  P H ++     +G   L RVL AY    P  GYCQ    VA+VLL+    EEAFW  V ICE+ LP YY+  +  +++D  +L  L++  S +G        +      + +PV  + E     WF+ ++   + + + + + D FF +G + +F++ L LLR
Sbjct:   38 GIPPSLRARAWEHLSGSKYIMEQMPGKFEEL-DKLPGDPKWL-EVIQKDLHRQFPFHELFRAKGGQGQQDLFRVLKAYTVYRPEEGYCQGQAPVAAVLLMHMPAEEAFWCFVQICEKYLPGYYSAGLESLQLDGEILFALLRKVSLIG--------YRHLKWHSVDPVLYMTE-----WFMCVFSRTLPWDSVLRVWDMFFCEGVKTMFRVGLVLLR 239          
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009275.1 (pep scaffold:Pmarinus_7.0:GL480906:1885:20274:1 gene:ENSPMAG00000008384.1 transcript:ENSPMAT00000009275.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.693e-18
Identity = 64/166 (38.55%), Postives = 94/166 (56.63%), Query Frame = 2
Query: 1421 KYFIDHGRGMSMFRTC---ELRRLVLAGLTNKLRAEIWMIVSG---AQNELLLNPDYYWTLVSQTE-ASSSFVSEEIERDLHRSLPEHPVYHTDEGLSS----LRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRV 1882
            +  +D   G      C   EL++LV  G+ + LR  +W   +G   ++      P YY  LVSQ +   ++  +  IE DL R+LP +  +   E LS     LR VL A+A+RNP+IGYCQ +N + ++LLL   EEEAFW LVA+ E ++P DYY+ K+I  +V
Sbjct:  544 RVVLDRWEGTPSHDLCVSPELKQLVRGGVPHTLRPRVWAWCAGRRVSEERRHQPPGYYHALVSQAQNERTNPDARHIELDLARTLPNNCHF---EALSPKVVELRNVLLAFAWRNPHIGYCQGLNRLTAILLLCLEEEEAFWCLVALIEFIMPADYYSKKLIASQV 706          
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Match: MDR1 (Cytoplasmic GTPase-activating protein; activates Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function [Source:SGD;Acc:S000003332])

HSP 1 Score: 205.682 bits (522), Expect = 8.726e-55
Identity = 108/355 (30.42%), Postives = 190/355 (53.52%), Query Frame = 2
Query: 1394 ENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPD-------QLT-IEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVF 2434
            E  +   W  YF ++GR +++ +T   R+L+  G+ N++R EIW + SGA      N   Y  ++++    +S   +EIE+DL RSLPE+  Y T+EG+  LR VLTAY+++NP++GYCQAMNIV +  L+F +EE+AFW L  +C+  +P YY+  + G  +DQ V +  V+  + +   +    +   S           +VS+ WFL+++   M    A+ IMD FF +G+  +FQ+AL +L+ +   ++   D+G     I+   +       PD       Q+T  +EL+ +A++ F  ++  +    R +    +   +E    R  +R + ++  L  D+L  ++ +F
Sbjct:  211 EKAKLRLWFDYFRENGRNLAVVQTPMFRKLIRIGVPNRMRGEIWELCSGAMYMRYANSGEYERILNENAGKTSQAIDEIEKDLKRSLPEYSAYQTEEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFMSEEQAFWCLCNLCDIYVPGYYSKTMYGTLLDQRVFESFVEDRMPVLWEYILQHDIQLS-----------VVSLPWFLSLFFTSMPLEYAVRIMDIFFMNGSITLFQVALAVLKINADDILQADDDGMFIAIIKHYFQTLGQSAHPDSSDIKYRQITKFQELLVTAFKEFSVISEEMAMHARHKYEKGIFQNIETFMKRTQLRHMPKTFNLSSDDLSNIYDMF 554          
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Match: MSB4 (GTPase-activating protein of the Ras superfamily; acts primarily on Sec4p, localizes to the bud site and bud tip; msb3 msb4 double mutation causes defects in secretion and actin organization; similar to the TBC-domain Tre2 oncogene; MSB4 has a paralog, MSB3, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null mutant [Source:SGD;Acc:S000005472])

HSP 1 Score: 136.732 bits (343), Expect = 2.493e-34
Identity = 88/285 (30.88%), Postives = 144/285 (50.53%), Query Frame = 2
Query: 1400 KRQHTWEKYFID-----HGRGMSMF--RTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVS--QTEASSSFVSEEIERDLHRSLPEHPVYHTDEG-------LSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHL-----GIDLSFEDTFNDSTSPASNPVS--------EIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDE 2167
            +R+  WE + +      H     ++  RT EL + V  G+  + R   W   +G Q +L  N   Y  L S  +  A S    E IERDL+R+ P++  +H +         + SLRRVL A++  +  IGYCQ+MN +  +LLLF  EE+AFW+LV I  + LP  Y   + G  VDQ VL   ++ +L      I+ S+ +  N ST   S P S          + + + SWF++ ++ V+     + I DC FY+ +  +F++AL +L+  ++  ++ K +
Sbjct:  109 RRKKKWENFLLKNKIELHNDNPLVYPARTDELSKFVRKGIPAEWRGNAWWYFAGGQRQLDANVGVYDRLKSDCREGAVSGKDMEAIERDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFMEEEKAFWMLVIITGKYLPGVYESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNG-NGSTDQISGPASGEEYLCRLPTLTLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVALGILKLSESEFLESKSQ 392          
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Match: MSB3 (Rab GTPase-activating protein; regulates endocytosis via inactivation of Vps21p at endosomes and vacuole fusion via inactivation of Ypt7p at vacuoles; also acts on Ypt52p and Sec4p; localizes to plasma membrane, sites of polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; similar to TBC-domain Tre2 oncogene; MSB3 has a paralog, MSB4, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null [Source:SGD;Acc:S000005237])

HSP 1 Score: 120.553 bits (301), Expect = 1.910e-28
Identity = 90/295 (30.51%), Postives = 145/295 (49.15%), Query Frame = 2
Query: 1400 KRQHTWEKYFIDHG-----RGMSMF--RTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEE--------IERDLHRSLPEHPVY----HTDEG---LSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQ-------SHLGIDLSFEDTFNDSTSPASNPV------SEI------IEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIK 2161
            +R+H W+      G        S F  ++  L+R V  G+  + R   W   +  Q +L  N   Y  L+ + +        E        IERDL+R+ P++  +    H  EG   + SLRRVL A++  NP IGYCQ+MN +A +LLLF +EE AFW+LV I  R LP  +N+ + GV +DQ VL   V+       S++   +      N + SP++  V      +E       I + + SWF++ ++ V+     + I DC FY+ +  +F+++L +L+  +  L  IK
Sbjct:  185 RRKHKWQLLLEKSGLPVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKIK 479          
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Match: GYP5 (GTPase-activating protein (GAP) for yeast Rab family members; involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; GYP5 has a paralog, GYL1, that arose from the whole genome duplication [Source:SGD;Acc:S000006170])

HSP 1 Score: 68.1662 bits (165), Expect = 5.802e-12
Identity = 72/308 (23.38%), Postives = 137/308 (44.48%), Query Frame = 2
Query: 1292 DSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHG---------RGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFC-NEEEAFWLLVAIC------ERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIE--MVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIK 2161
            + +E R++ Q G+  +K +      ENL +  E+EN  +   E + ID             ++      L   V  G+  ++R  IW +++ +++  +   D Y TL+     +       I RDL R+      +  ++ + SL +V+  Y+  +P++GY Q M  +A+ LL+ C NE E+F LLV +       E  LP    + ++  + D+     L++ H             S S  +  + E I   M +  WFLT +         + I D  F +G +V+ + A+ L+ +++  L+ ++
Sbjct:  376 EGEETRESLQEGQSFLK-STFTSFLENLSEYNEVENVNEEDREMFKIDWSFWTQVVNDYATVASNEPENLEAHVTNGIPPQIRGIIWQLMANSKSREM--EDIYETLLD----TECLHEATIRRDLRRT-----KFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCENEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDR-----LLEEH-------------SPSLYNRLIREGISSTMYATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLVKLR 653          
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Match: YFL042C_mRNA (Putative sterol transfer protein; one of six StART-like domain-containing proteins in yeast that may be involved in sterol transfer between intracellular membranes; conserved across eukaryotes; has both GRAM and StART-like (VASt) domains; localizes to membrane contact sites throughout the cell, including nucleus-vacuole junctions and ER-mitochondrial contact sites [Source:SGD;Acc:S000001852])

HSP 1 Score: 54.299 bits (129), Expect = 9.661e-8
Identity = 33/123 (26.83%), Postives = 73/123 (59.35%), Query Frame = 2
Query:  377 VEKQSVDTEESESYKRATVKFIKIF-NMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEK-STRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQL 739
            VE++ +DT    + ++    F + F ++P +++L++ ++C  L+  + +QG LY++  H+CF S ++G   +++I +  V  +EK S     P +I+I+TK+ +  F  F++    F L++++
Sbjct:  180 VEERYMDTPYHYASEQRNKDFHETFKSVPKDDRLLDDFNCG-LNRELLYQGKLYITETHLCFNSNVLGWIAKVLIAFEDVTFMEKTSAAGLFPSAISIETKMGKTLFNGFISRDAAFGLMKEV 301          
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Match: EDO49828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REP1])

HSP 1 Score: 394.045 bits (1011), Expect = 9.230e-118
Identity = 244/625 (39.04%), Postives = 342/625 (54.72%), Query Frame = 2
Query: 1376 DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------------QKLSECCSHLGDPD-----QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVG-ESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTK---QLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNL----SGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARV 3163
            D+I   E  ++H W  +  ++GRG+ M+RT +   L+L G+ + LRAEIW+I SGA NE+  +P YY +LV Q E  SS   +EIERDLHRSLPEHP + +D G+ +LRRVLTAYA+RNP+IGYCQAMNIVASVLLL+C EE+AFWLLVA+CERLLPDYYN KV+G  VDQ V +DL + HL       D   D           I+ M+S+SWFLT++L+VM F  A+ I+DCFFYDGA+V+FQIAL  L  ++  L+ I+D+GEA   +                  +S     LG P       + +  LI  +Y+ FG +T   I+ +R   RL VV  +E +  R+ VRS+G ES+  ++ ELE L+ VFK  ++ +    N   S   D +S+   + Y D +      F  LF +L  WG  +    LA R F+++  D  ++I FK   W +G IC G ++ +LR ++R++  P +     +L D                SDG   D C+E    +TE+        SE P    KT     V D      S K R +    LRS+  E N    R+   LP+M  +  +  W T+Y L     +E  +  A+A V
Sbjct:  481 DQITAKETVKEHLWRLHLAEYGRGVCMYRTVKTHELILKGIPDNLRAEIWLIFSGAINEIETHPGYYVSLVEQCEGKSSLAFDEIERDLHRSLPEHPAFQSDVGIGALRRVLTAYAWRNPSIGYCQAMNIVASVLLLYCTEEQAFWLLVAVCERLLPDYYNTKVVGALVDQGVFEDLTRDHLP---ELYDHLKDLG---------ILNMISLSWFLTLFLSVMPFVCAVNIIDCFFYDGAKVLFQIALACLDANRTKLLSIEDDGEAMTILGAYLDHVTNRDSSIPATTMSVNNRSLGIPSPGFSTSVDVSNLILESYQKFGFITAENIESMRNTQRLKVVQGLEDSMRRNAVRSIGAESSDFDQKELEQLYAVFKTGHIQAR---NRGFSEVKDSTSWQ--QQYIDLYG-----FEPLFVTLTNWGKCEIADTLARRAFKVIAGDDSDLITFKGLVWGLGTICKGDVQHRLRFMYRMHIAPAI---TDDLED----------------SDGI--DTCSE----VTEDEQGAGVGASE-PTGIPKTQKDVLVPDEATVSSSLKSRESIDRMLRSD--EGN----RDAVELPRMTQEQFIHLWKTMYSLFRELPNEQQMYQAIATV 1051          

HSP 2 Score: 287.345 bits (734), Expect = 2.104e-80
Identity = 168/404 (41.58%), Postives = 249/404 (61.63%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKA---TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAI-EFIKTKVMSMAAVEKQSVDT----EESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKV--QSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-FFFGNLHNRDIVISKINNFL 1207
            MW  P +V +  +LW  E+ N YFV+++RKG   GGLT LL+GT DN++DSK      +RILL+    D+SY I  ++S   I   WE L   +L  +S  + D+ I +F+K K+ S+ A  +   DT    +E+  +K A+ +F ++FNMP ++KLVNYYSCS   GR+P QGWLYLS+NH+CFYSFLMGKE R++I W  V  +E++     P+ I + T+  E+ F+  L+  ETF L++QLAN+ +++LL +EG++++  L +  +++     KV  LK DLDA+ ++  YR  FRLP+ E LDG  EC L + +NK  V G LY S NF+CF SKI   + +++P RE+   E +      +S  I     ITT S A F F +L +RD +   I++FL
Sbjct:    1 MWVRPEDVLLANALWATERANPYFVMQRRKGHGGGGLTSLLIGTLDNVLDSKVKLPAPFRILLQLANSDVSYVISSASSFKEIESDWEWLTKYLLETLSNIDSDDDIKDFVKAKIESLVANCEPDEDTSTIEQETSKFKSASNRFHRLFNMPEQDKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLMGKEARLVIRWTDVTSLERTNSVLLPDGIKVTTRDGEFCFSLLLHPTETFGLMEQLANLAMRQLLSQEGFEQDKSLPILTKNQGKTMKKVPTLKRDLDARAQSEYYRNLFRLPVEEKLDGHCECTLWSPHNKAHVWGTLYCSPNFLCFNSKIRQLLSVVVPMREITLVEKVD-----TSALIPNALHITTRSKANFLFASLRDRDYLTHLISDFL 399          
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Match: EDO34047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE4])

HSP 1 Score: 137.117 bits (344), Expect = 1.160e-35
Identity = 79/238 (33.19%), Postives = 133/238 (55.88%), Query Frame = 2
Query: 1460 RTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVY--HTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEE-AFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKD 2164
            ++ +++R V  G+ +  RA++WM +SGA+  +   P YY +L+ ++E     V   I  D+ R+ PE+  +   +D     L+ +L AYA  NP IGYCQ +N +A +LLL    EE AFWLL A+  + LPDYY   ++G++V+Q VL +LV+  L       ++   S S           + S  WF+ +Y++V+     + I D  FY+G++++ ++A+ LL  H+  L+  KD
Sbjct:   47 KSRKIKRFVRKGVPSSHRAQVWMDISGARKRMKKLPGYYQSLL-ESELDD-IVRNSILTDIDRTFPENIYFGSSSDSLKQKLKNILVAYAVHNPKIGYCQGLNYIAGLLLLIIKTEEPAFWLLEAMMMKRLPDYYAKDMMGLQVEQEVLSELVKIKLPTLHHHIESIGLSYS-----------IFSTKWFICLYIDVLPVETVLRIWDSLFYEGSKILLRVAITLLALHQDKLLAAKD 271          
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Match: EDO34196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ41])

HSP 1 Score: 133.65 bits (335), Expect = 4.510e-35
Identity = 77/240 (32.08%), Postives = 132/240 (55.00%), Query Frame = 2
Query: 1415 WEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWM-----IVSGAQNELLLNPDYYWTLVSQTEASSSF--VSEEIERDLHRSLPEHPVYHTDE--GLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLG-IDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQV 2101
            WE Y + H    S  +T EL+ +V  G+ N+ R++IW       V G ++  +  P+YY  L+    ++  F   +++IE DL R+LP +  Y+  +  G+  LR VL AY++ NP +GYCQ +N + ++ +L   EEEAFW LVAI E ++P DY++  ++  + DQ VL+DL+   L  +   FE+   D            + +++ +WFLT++++       + + D F Y+G +V
Sbjct:   12 WENYMMAHKNRDSQ-KTMELKSMVRGGIPNEYRSQIWRQCINHFVRGTKS--MAGPNYYAHLLDSIASNIKFSPATKQIELDLLRTLPNNVHYNKPDANGIGMLRNVLMAYSWHNPEVGYCQGLNRLVAIAMLILKEEEAFWCLVAIVEHIMPKDYFSRTLLAAQADQRVLRDLLMEKLPRLYTHFENVRVD------------LSLITFNWFLTVFIDSFPIQTILRVWDTFLYEGNKV 236          
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Match: EDO35021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP1])

HSP 1 Score: 136.732 bits (343), Expect = 8.180e-33
Identity = 82/259 (31.66%), Postives = 141/259 (54.44%), Query Frame = 2
Query: 1469 ELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHT--DEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERL-LPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQL 2236
            +LR LV +G+ + +RA IWM +SGA  + +     Y  +V  +   +S  S++IE+DL R++P +  + T    GL  +RR+L + A+  P+IGYCQ M ++ + LLLF  EE+AFWL   I E L  P YY+  +IGV+ DQ VL+ L+ S+L             T          + ++++ WFLT + +V+     + I D +FY+G+  +F+  L +L+  +  ++ + +   +++    LS+    + D D L
Sbjct:   89 KLRELVCSGIPHSMRAPIWMRISGALQKKINAEFTYKQVVRASSDENSPASKQIEKDLLRTMPNNACFSTPTSTGLLRMRRILRSLAWLYPDIGYCQGMGMIVASLLLFVEEEDAFWLTSTIIEDLNPPSYYSSTLIGVQADQRVLRQLIVSYL-----------PHTDQQLKEHDIELSLITLHWFLTAFASVVHTKILLRIWDIYFYEGSVTLFRATLGMLKLKQEYILTLDN---SAQIFNVLSDIPGDITDADVL 333          
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Match: EDO39400 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA57])

HSP 1 Score: 99.3673 bits (246), Expect = 1.163e-22
Identity = 64/224 (28.57%), Postives = 107/224 (47.77%), Query Frame = 2
Query: 1469 ELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTD---EGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLR 2131
            +LR     G+   +R   W  +SG+      NP+ +  L S+    S      IE+DL R  P H  + TD   +G   L RVL AY+  + + GYCQAM  V +VLL+    EEAFW LV IC + LP YY  K+  +++D  +   L+   +          + S     + +  ++ M    W++ +    + F   + + D FF +G +V+F+  + +++
Sbjct:   82 KLRERCRKGIPPAVRGLAWRHLSGSIKMEKQNPNLFEDLASK---PSPEWENTIEKDLCRVFPYHEQF-TDTGGQGQKDLFRVLKAYSLYDSHTGYCQAMAPVVAVLLMHMTAEEAFWCLVMICSKYLPGYYGPKLEAIQLDGAIFGGLLSKTVP---------HISKHMKQHHIDPLMYMT--EWYMCLLARNLPFATVLRVWDMFFCEGIKVLFRTTIAIMK 290          
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:101165539])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 377/953 (39.56%), Postives = 560/953 (58.76%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXX-XYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE----SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-FFFGNLHNRDIVISKINNFLIXXXXX--------XXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTG-RFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +  +LW  E+ N +FVL++R+G   GG    L+  T D ++DS A    YRILL+  +  I + I   +S+  I + W+ LE+++L  +S F+ +E I  F+K K++ + A E +    EE E     ++ A VK  ++F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++PW  V  +EK+     PES+ + T+  E+ F+ FLNI +TF L++QLAN+ +++LL  E ++ +  L    + L    VS LK D DA+ +N  YR  FRL   E LDG  +C L   + K  V G+L+IS N+ICF SK  D  +LIIP REV   E        SS+ +  P  I+T +   F F NL +RD ++ +I++FL  T ++        S    ++ +  S++ +    V+  +       T  + +++  +   P E+L      E  ++  W  +F + GRG+ M+RT   R LVL G+  +LR E+W++ SGAQNE++ +P YY  LV       S  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L                       +I  +S+SWFLT++L+ M F +A+ ++D FFY+G +VIFQ+AL +L+ +   L+   DEGEA   +          Q +S    HL      GD  P ++ + +L+ S+YE F ++ + +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     S +     +DP  PY + +RID   F +LFT L PW   GHT  L+ R+FRLLDQ+ D++INFKEF   +  + HG + EK++LL++L+  P L P + E
Sbjct:    1 MWIPPEEVLMAGALWVSERANPFFVLQRRRGHGRGGGLSGLLVGTLDVVLDSSARVAPYRILLQTADSQIYWNIACGSSRKEITEHWDWLESNLLQTISIFDNEEDITTFVKGKILGIIAEENRPKQGEEQEEDSGKFREAEVKMRRLFGMPDEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVPWTEVTQLEKNATLVFPESVRVSTRHTEHFFSMFLNITDTFKLMEQLANLAMRQLLDNEAFEFDRSLPKPCKTLK--NVSALKRDFDARAKNEWYRAMFRLTHEERLDGHTDCTLWAPFAKMHVVGQLFISNNYICFNSKEEDLCQLIIPLREVSVVEKAD-----SSSVLPCPVSISTKNKMNFLFANLKDRDFLVQRISDFLQRTPDSLWGDTNPLSLIGPATSTVSSSSLAKSDSVLKGRHYHPGLPTATQTLLQLYHRDSP-EDLGPKAMKEKMKEEAWNIHFSEFGRGVCMYRTSRTRELVLNGIPERLRGELWLLFSGAQNEIVSHPGYYGDLVEAAMGQCSLATEEIERDLHRSMPEHRAFQNETGIAALRRVLTAYAHRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRDFLPQLYEHMQELG------------VISTISLSWFLTLFLSAMPFDSAVLLIDNFFYEGIKVIFQVALAVLQDNMNALLCCSDEGEAMTILGRYLDNVVNRQTVSAPIPHLHTLLTSGDDPPPEIDVFDLLKSSYEKFASLRSDVIEQMRFKQRLKVIQSLEDTAKRSVVRAMMTESAFTIEELEELYCLFKSKHMTSCYWG----SSSSAAERHDPSLPYLEQYRIDLVQFTQLFTVLAPWTCGGHTPILSARLFRLLDQNQDSLINFKEFITGLSGMYHGDMTEKMKLLYKLHLPPALCPEEAE 929          
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:101165539])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 376/954 (39.41%), Postives = 558/954 (58.49%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXX-XYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE----SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-FFFGNLHNRDIVISKINNFLIXXX---------XXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTG-RFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +  +LW  E+ N +FVL++R+G   GG    L+  T D ++DS A    YRILL+  +  I + I   +S+  I + W+ LE+++L  +S F+ +E I  F+K K++ + A E +    EE E     ++ A VK  ++F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++PW  V  +EK+     PES+ + T+  E+ F+ FLNI +TF L++QLAN+ +++LL  E ++ +  L    + L    VS LK D DA+ +N  YR  FRL   E LDG  +C L   + K  V G+L+IS N+ICF SK  D  +LIIP REV   E        SS+ +  P  I+T +   F F NL +RD ++ +I++FL  T           +     ++ +  S++ +    V+  +       T  + +++  +   P E+L      E  ++  W  +F + GRG+ M+RT   R LVL G+  +LR E+W++ SGAQNE++ +P YY  LV       S  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L                       +I  +S+SWFLT++L+ M F +A+ ++D FFY+G +VIFQ+AL +L+ +   L+   DEGEA   +          Q +S    HL      GD  P ++ + +L+ S+YE F ++ + +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     S +     +DP  PY + +RID   F +LFT L PW   GHT  L+ R+FRLLDQ+ D++INFKEF   +  + HG + EK++LL++L+  P L P + E
Sbjct:    1 MWIPPEEVLMAGALWVSERANPFFVLQRRRGHGRGGGLSGLLVGTLDVVLDSSARVAPYRILLQTADSQIYWNIACGSSRKEITEHWDWLESNLLQTISIFDNEEDITTFVKGKILGIIAEENRPKQGEEQEEDSGKFREAEVKMRRLFGMPDEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVPWTEVTQLEKNATLVFPESVRVSTRHTEHFFSMFLNITDTFKLMEQLANLAMRQLLDNEAFEFDRSLPKPCKTLK--NVSALKRDFDARAKNEWYRAMFRLTHEERLDGHTDCTLWAPFAKMHVVGQLFISNNYICFNSKEEDLCQLIIPLREVSVVEKAD-----SSSVLPCPVSISTKNKMNFLFANLKDRDFLVQRISDFLQRTPDSLWGDTNPLSLIGPAATSTVSSSSLAKSDSVLKGRHYHPGLPTATQTLLQLYHRDSP-EDLGPKAMKEKMKEEAWNIHFSEFGRGVCMYRTSRTRELVLNGIPERLRGELWLLFSGAQNEIVSHPGYYGDLVEAAMGQCSLATEEIERDLHRSMPEHRAFQNETGIAALRRVLTAYAHRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRDFLPQLYEHMQELG------------VISTISLSWFLTLFLSAMPFDSAVLLIDNFFYEGIKVIFQVALAVLQDNMNALLCCSDEGEAMTILGRYLDNVVNRQTVSAPIPHLHTLLTSGDDPPPEIDVFDLLKSSYEKFASLRSDVIEQMRFKQRLKVIQSLEDTAKRSVVRAMMTESAFTIEELEELYCLFKSKHMTSCYWG----SSSSAAERHDPSLPYLEQYRIDLVQFTQLFTVLAPWTCGGHTPILSARLFRLLDQNQDSLINFKEFITGLSGMYHGDMTEKMKLLYKLHLPPALCPEEAE 930          
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9B [Source:NCBI gene;Acc:101165539])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 376/954 (39.41%), Postives = 558/954 (58.49%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXX-XYDNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIE-FIKTKVMSMAAVEKQSVDTEESE----SYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSA-FFFGNLHNRDIVISKINNFLIXXX---------XXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTG-RFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECI----------QKLSECCSHL------GD--PDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKE 2770
            MW  P EV +  +LW  E+ N +FVL++R+G   GG    L+  T D ++DS A    YRILL+  +  I + I   +S+  I + W+ LE+++L  +S F+ +E I  F+K K++ + A E +    EE E     ++ A VK  ++F MP EEKLVNYYSCS   GR+P QGWLYLS+NH+CFYSFL+GKE  +++PW  V  +EK+     PES+ + T+  E+ F+ FLNI +TF L++QLAN+ +++LL  E ++ +  L    + L    VS LK D DA+ +N  YR  FRL   E LDG  +C L   + K  V G+L+IS N+ICF SK  D  +LIIP REV   E        SS+ +  P  I+T +   F F NL +RD ++ +I++FL  T           +     ++ +  S++ +    V+  +       T  + +++  +   P E+L      E  ++  W  +F + GRG+ M+RT   R LVL G+  +LR E+W++ SGAQNE++ +P YY  LV       S  +EEIERDLHRS+PEH  +  + G+++LRRVLTAYA+RNP IGYCQAMNIV SVLLL+C EEEAFWLLVA+CER+LPDYYN +V+G  VDQ V ++L +  L                       +I  +S+SWFLT++L+ M F +A+ ++D FFY+G +VIFQ+AL +L+ +   L+   DEGEA   +          Q +S    HL      GD  P ++ + +L+ S+YE F ++ + +I+Q+R + RL V+  +E    R VVR++   +    +ELE L+ +FK  ++ S Y+     S +     +DP  PY + +RID   F +LFT L PW   GHT  L+ R+FRLLDQ+ D++INFKEF   +  + HG + EK++LL++L+  P L P + E
Sbjct:    1 MWIPPEEVLMAGALWVSERANPFFVLQRRRGHGRGGGLSGLLVGTLDVVLDSSARVAPYRILLQTADSQIYWNIACGSSRKEITEHWDWLESNLLQTISIFDNEEDITTFVKGKILGIIAEENRPKQGEEQEEDSGKFREAEVKMRRLFGMPDEEKLVNYYSCSYWKGRVPRQGWLYLSVNHLCFYSFLLGKEVTLVVPWTEVTQLEKNATLVFPESVRVSTRHTEHFFSMFLNITDTFKLMEQLANLAMRQLLDNEAFEFDRSLPKPCKTLK--NVSALKRDFDARAKNEWYRAMFRLTHEERLDGHTDCTLWAPFAKMHVVGQLFISNNYICFNSKEEDLCQLIIPLREVSVVEKAD-----SSSVLPCPVSISTKNKMNFLFANLKDRDFLVQRISDFLQRTPDSLWGDTNPLSLIGPAATSTVSSSSLAKSDSVLKGRHYHPGLPTATQTLLQLYHRDSP-EDLGPKAMKEKMKEEAWNIHFSEFGRGVCMYRTSRTRELVLNGIPERLRGELWLLFSGAQNEIVSHPGYYGDLVEAAMGQCSLATEEIERDLHRSMPEHRAFQNETGIAALRRVLTAYAHRNPGIGYCQAMNIVTSVLLLYCTEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELTRDFLPQLYEHMQELG------------VISTISLSWFLTLFLSAMPFDSAVLLIDNFFYEGIKVIFQVALAVLQDNMNALLCCSDEGEAMTILGRYLDNVVNRQTVSAPIPHLHTLLTSGDDPPPEIDVFDLLKSSYEKFASLRSDVIEQMRFKQRLKVIQSLEDTAKRSVVRAMMTESAFTIEELEELYCLFKSKHMTSCYWG----SSSSAAERHDPSLPYLEQYRIDLVQFTQLFTVLAPWTCGGHTPILSARLFRLLDQNQDSLINFKEFITGLSGMYHGDMTEKMKLLYKLHLPPALCPEEAE 930          
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9 [Source:NCBI gene;Acc:101166033])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 401/1103 (36.36%), Postives = 614/1103 (55.67%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXY--DNIIDSKA--TKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAA---VEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLD-----VVDSKEIRDNSQTGR-FMIKYANAPKPTENL------------DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HL-------GDPD-QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW +P +V +  +LW  E+ N YF+L+KRKG   GG     +     D ++DS A    YRIL +  +    + I    S+  I + WE LE+++L  +S F N ++   F+K KV  + A     +   D ++++ +K  + KF K+F MP EEKLVNYYSCS   G++P QGWLYLS+NH+CFYS L+GKE ++++ W  +  +EKS     P+ I + T+  E+ F+ FLNI ETF L +QLANI +++LL  +G++++ +   + +K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK      LIIP REV   E        SSN + +P  I+T +   F F NL +RD ++ +I++FL  T +     K    S +++           +  S +    S+T R F +   + P  TE L            +  +  E  ++  W+ +F ++G G+ M+RT + + LVL G+   +R E+W++ SGA NE+  +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLV +CER+LPDYYN +V+G  VDQ V ++L + ++       D   D           +I  +S+SWFLT++L+VM F +A+ ++DCFFYDG +VIFQ+AL +L  +   L+  KD+GEA   + +  +  +          HL       G+P  ++ I +L+ ++YE FG++   +I+Q+R + RL V+  +E  T R+VVR++   T    DELE LF +FK  ++ S Y+     S  P    +DP  PY + +RID E F  LF  L PW    H+  LA R+FRLLD++ D ++NF+EF   +G++ HG L EKL+LL++++  P   P ++E         Y  ++  P +S G      +E          +    +  N  +P   H                 + KL +   +   +   NT  LPK+     +    TLY + + D  E +L +A A V + + +  E+
Sbjct:    1 MWVSPEDVLLAGALWITERANPYFILQKRKGHGDGGGGLAGLLVGTLDVVLDSSARVAPYRILYQTPDSLSYWIIAHGTSRKEITEHWEWLEHNLLQTLSIFENENDITTFVKGKVQGIIAEYSKNQDIKDDDDTDKFKEVSAKFRKLFGMPEEEKLVNYYSCSYWKGKVPRQGWLYLSINHLCFYSHLLGKEVKLVVRWADITQLEKSATLLLPDVIKVSTRSNEHVFSVFLNINETFKLAEQLANIAMRQLLDNKGFEQD-RSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEETLCSLIIPLREVTIVEKAD-----SSNVLPSPLSISTKNRMTFLFANLKDRDFLVQRISDFLQQTTSKICLEKELNGSFNSSDDEVYSQHGSVLSSSPQHSSGSETERTFNLNDTSVPTATEALMTMYRRRSPEEFNPKLAKEFLKEQGWKNHFAEYGEGVCMYRTEKTKELVLKGIPESMRGELWLLFSGAINEMTTHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVVLCERMLPDYYNTRVVGALVDQGVFEELAREYVP---QLYDCMQDLG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYDGIKVIFQLALSVLHANIHQLLGCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLTDNGEPHPEVDIFKLVCNSYEKFGSIRADVIEQMRFKQRLRVIQTIEDTTKRNVVRTIVTETAFSIDELEELFVLFKTEHLTSCYWGG---SSNP-TERHDPSLPYLEQYRIDVEQFKGLFNLLFPWANGAHSDPLAARVFRLLDENADGLLNFREFINGLGVLYHGDLTEKLKLLYQMHVLPEFSP-EQEPDSAFEATQYFFEDITPETSIGHDSKCRSEKDDGFVRVTFKTEKVKKLN--TPDYRH-----------------YLKLWNQETKPKRE---NTKDLPKLNQSQFIELCKTLYSMFSEDAAEQELYHATATVTSLLLEMGEV 1058          
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Match: tbc1d9 (TBC1 domain family member 9 [Source:NCBI gene;Acc:101166033])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 393/1086 (36.19%), Postives = 603/1086 (55.52%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKS-----NSQANIMKCWESLENDILNKVSEF-NRDEAIEFIKTKVMSMAA---VEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSS-AFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCS----------HL-------GDPD-QLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPW---GHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEM 3193
            MW +P +V +  +LW  E+ N YF+L+KRKG   GG       T    I S    Y      +    S +   S      S+  I + WE LE+++L  +S F N ++   F+K KV  + A     +   D ++++ +K  + KF K+F MP EEKLVNYYSCS   G++P QGWLYLS+NH+CFYS L+GKE ++++ W  +  +EKS     P+ I + T+  E+ F+ FLNI ETF L +QLANI +++LL  +G++++ +   + +K +P KVS LK DLDA+ ++  YR  FRLP +E LDG  +C L T +NK  + G++++S N+ICF SK      LIIP REV   E        SSN + +P  I+T +   F F NL +RD ++ +I++FL  T +     K    S +++   +   ++   +   + T   M  Y    +  E  +  +  E  ++  W+ +F ++G G+ M+RT + + LVL G+   +R E+W++ SGA NE+  +P YY  LV ++    +  +EEIERDLHRSLPEHP +  + G+++LRRVLTAYA+RNPNIGYCQAMNIV SVLLL+  EEEAFWLLV +CER+LPDYYN +V+G  VDQ V ++L + ++       D   D           +I  +S+SWFLT++L+VM F +A+ ++DCFFYDG +VIFQ+AL +L  +   L+  KD+GEA   + +  +  +          HL       G+P  ++ I +L+ ++YE FG++   +I+Q+R + RL V+  +E  T R+VVR++   T    DELE LF +FK  ++ S Y+     S  P    +DP  PY + +RID E F  LF  L PW    H+  LA R+FRLLD++ D ++NF+EF   +G++ HG L EKL+LL++++  P   P      ++    A+   +           DI  E+ I+  +  + +            K  N  D +  L          KL +   +   +   NT  LPK+     +    TLY + + D  E +L +A A V + + +  E+
Sbjct:    1 MWVSPEDVLLAGALWITERANPYFILQKRKGHGDGGGGLAGDQTLSVHIVSTQI-YSPFESCMHFCFSCDFVSSISSTGTSRKEITEHWEWLEHNLLQTLSIFENENDITTFVKGKVQGIIAEYSKNQDIKDDDDTDKFKEVSAKFRKLFGMPEEEKLVNYYSCSYWKGKVPRQGWLYLSINHLCFYSHLLGKEVKLVVRWADITQLEKSATLLLPDVIKVSTRSNEHVFSVFLNINETFKLAEQLANIAMRQLLDNKGFEQD-RSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEETLCSLIIPLREVTIVEKAD-----SSNVLPSPLSISTKNRMTFLFANLKDRDFLVQRISDFLQQTTSKICLEKELNGSFNSSDDERTFNLNDTSV--PTATEALMTMYRR--RSPEEFNPKLAKEFLKEQGWKNHFAEYGEGVCMYRTEKTKELVLKGIPESMRGELWLLFSGAINEMTTHPGYYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQAMNIVTSVLLLYAKEEEAFWLLVVLCERMLPDYYNTRVVGALVDQGVFEELAREYVP---QLYDCMQDLG---------VISTISLSWFLTLFLSVMPFESAVVVVDCFFYDGIKVIFQLALSVLHANIHQLLGCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLTDNGEPHPEVDIFKLVCNSYEKFGSIRADVIEQMRFKQRLRVIQTIEDTTKRNVVRTIVTETAFSIDELEELFVLFKTEHLTSCYWGG---SSNP-TERHDPSLPYLEQYRIDVEQFKGLFNLLFPWANGAHSDPLAARVFRLLDENADGLLNFREFINGLGVLYHGDLTEKLKLLYQMHVLPEFSP------EQEPDSAFEATQYFFE-------DITPETSIDYDQPFVNFT----------VKKLNTPDYRHYL----------KLWNQETKPKRE---NTKDLPKLNQSQFIELCKTLYSMFSEDAAEQELYHATATVTSLLLEMGEV 1023          
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Match: SMESG000015478.1 (SMESG000015478.1)

HSP 1 Score: 2190.62 bits (5675), Expect = 0.000e+0
Identity = 1103/1107 (99.64%), Postives = 1104/1107 (99.73%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTEKDWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK 3349
            MWKNPSEVFIGYSLWTQEKQNQYFVLEKRKGKLTGGLTGLLVGTYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIATNNTSRKSKSSVSSDSANSSAKLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKV  QAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGD+QDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTE DWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK
Sbjct:    1 MWKNPSEVFIGYSLWTQEKQNQYFVLEKRKGKLTGGLTGLLVGTYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIATNNTSRKSKSSVSSDSANSSAKLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVANQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDIQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTENDWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK 1107          
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Match: SMESG000015478.1 (SMESG000015478.1)

HSP 1 Score: 2142.47 bits (5550), Expect = 0.000e+0
Identity = 1086/1107 (98.10%), Postives = 1087/1107 (98.19%), Query Frame = 2
Query:   29 MWKNPSEVFIGYSLWTQEKQNQYFVXXXXXXXXXXXXXXXXXXXYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIXXXXXXXXXXXXXXXXXXXXXXXLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLDKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTEKDWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK 3349
            MWKNPSEVFIGYSLWTQEKQNQYFVLEKRKGKLTGGLTGLLVGTYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIATNNTSRKSKSSVSSDSANSSAKLDVVDSKEIRDNSQT                 DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKV  QAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGD+QDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTE DWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK
Sbjct:    1 MWKNPSEVFIGYSLWTQEKQNQYFVLEKRKGKLTGGLTGLLVGTYDNIIDSKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNRDEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLVNYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEKSTRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEGYQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGDIECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPMTKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIATNNTSRKSKSSVSSDSANSSAKLDVVDSKEIRDNSQT-----------------DKIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHTDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFGTVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFGVFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSLLPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLFRLYCKPCLLPGDKELIDKVANQAYNPKESIPHSSDGQKGDICTESGIELTEEMLEYIHAESENPASPAKTHNFGDIQDNLSGKQRTNSHAKLRSNSVEENSQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQQKAEMRVKTENDWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVRPKYNNRK 1090          
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 148.288 bits (373), Expect = 3.885e-36
Identity = 90/277 (32.49%), Postives = 155/277 (55.96%), Query Frame = 2
Query: 1493 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYH--TDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLT-IEELIGSAYENFGTVTNSLIKQLR 2311
            G+ + LR ++WM +SGA  +       Y  +V+ T +     S++IE+DL R+LP +  +   +  G+  LRR+L   A+  P+IGYCQ M ++ S LLLF  EE+ FWL+ AI E LLP  YY+  +IGV+ DQ  L++L+  +L                A + +   I ++++ WFLTI+ ++++  N + + D FFY+G+ V+F+I L +++  ++ +++  +  +   C+ KL         P ++T I +LI  +YE    +T S I+ LR
Sbjct:  123 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLP---------KIHELLAEHDIE--ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKL---------PSEITDINKLILVSYELTEDLTFSTIQALR 379          
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 148.288 bits (373), Expect = 4.232e-36
Identity = 90/277 (32.49%), Postives = 155/277 (55.96%), Query Frame = 2
Query: 1493 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYH--TDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLT-IEELIGSAYENFGTVTNSLIKQLR 2311
            G+ + LR ++WM +SGA  +       Y  +V+ T +     S++IE+DL R+LP +  +   +  G+  LRR+L   A+  P+IGYCQ M ++ S LLLF  EE+ FWL+ AI E LLP  YY+  +IGV+ DQ  L++L+  +L                A + +   I ++++ WFLTI+ ++++  N + + D FFY+G+ V+F+I L +++  ++ +++  +  +   C+ KL         P ++T I +LI  +YE    +T S I+ LR
Sbjct:  131 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLP---------KIHELLAEHDIE--ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKL---------PSEITDINKLILVSYELTEDLTFSTIQALR 387          
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Match: SMESG000012909.1 (SMESG000012909.1)

HSP 1 Score: 147.902 bits (372), Expect = 4.544e-36
Identity = 90/277 (32.49%), Postives = 155/277 (55.96%), Query Frame = 2
Query: 1493 GLTNKLRAEIWMIVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYH--TDEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAICERLLP-DYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASNPVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELLRRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLT-IEELIGSAYENFGTVTNSLIKQLR 2311
            G+ + LR ++WM +SGA  +       Y  +V+ T +     S++IE+DL R+LP +  +   +  G+  LRR+L   A+  P+IGYCQ M ++ S LLLF  EE+ FWL+ AI E LLP  YY+  +IGV+ DQ  L++L+  +L                A + +   I ++++ WFLTI+ ++++  N + + D FFY+G+ V+F+I L +++  ++ +++  +  +   C+ KL         P ++T I +LI  +YE    +T S I+ LR
Sbjct:  126 GIPHSLRPQLWMRMSGALIKRKNCKTSYKEIVNATTSDHIMCSKQIEKDLVRTLPSNVCFSHISSTGIPRLRRILRGLAWLYPDIGYCQGMGVIVSHLLLFLEEEDTFWLMCAIIEDLLPVSYYSTNLIGVQADQMTLRELIPKYLP---------KIHELLAEHDIE--ISLITLHWFLTIFGSILNIRNLLRVWDLFFYEGSLVLFRIILGMIQLKESEMLEFDNTAQIFNCLSKL---------PSEITDINKLILVSYELTEDLTFSTIQALR 382          
The following BLAST results are available for this feature:
BLAST of TBC1 domain family member 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBC1D9B0.000e+036.91TBC1 domain family member 9B [Source:HGNC Symbol;A... [more]
TBC1D9B0.000e+036.71TBC1 domain family member 9B [Source:HGNC Symbol;A... [more]
TBC1D90.000e+036.38TBC1 domain family member 9 [Source:HGNC Symbol;Ac... [more]
TBC1D9B0.000e+036.13TBC1 domain family member 9B [Source:HGNC Symbol;A... [more]
TBC1D9B0.000e+036.44TBC1 domain family member 9B [Source:HGNC Symbol;A... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc-90.000e+035.28TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-90.000e+035.28TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-90.000e+035.28TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-90.000e+035.25TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
tbc-93.771e-15735.61TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG73246.539e-15633.79gene:FBgn0037074 transcript:FBtr0331797[more]
CG73247.035e-15633.79gene:FBgn0037074 transcript:FBtr0078404[more]
CG122412.852e-3531.01gene:FBgn0038304 transcript:FBtr0083051[more]
CG59161.974e-2726.77gene:FBgn0038401 transcript:FBtr0344009[more]
CG59161.974e-2726.77gene:FBgn0038401 transcript:FBtr0083251[more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d90.000e+036.67TBC1 domain family, member 9 (with GRAM domain) [S... [more]
tbc1d90.000e+036.89TBC1 domain family, member 9 (with GRAM domain) [S... [more]
tbc1d90.000e+037.16TBC1 domain family, member 9 (with GRAM domain) [S... [more]
tbc1d8b6.350e-16033.95TBC1 domain family member 8B [Source:NCBI gene;Acc... [more]
LO018176.19.897e-15130.53TBC1 domain family member 8 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d9b0.000e+036.74sterol 26-hydroxylase, mitochondrial [Source:Xenba... [more]
tbc1d9b0.000e+037.12sterol 26-hydroxylase, mitochondrial [Source:Xenba... [more]
tbc1d9b0.000e+036.59sterol 26-hydroxylase, mitochondrial [Source:Xenba... [more]
tbc1d9b0.000e+037.00sterol 26-hydroxylase, mitochondrial [Source:Xenba... [more]
tbc1d90.000e+036.99TBC1 domain family member 9 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbc1d9b0.000e+038.45TBC1 domain family, member 9B [Source:MGI Symbol;A... [more]
Tbc1d9b0.000e+037.62TBC1 domain family, member 9B [Source:MGI Symbol;A... [more]
Tbc1d8b0.000e+033.25TBC1 domain family, member 8B [Source:MGI Symbol;A... [more]
Tbc1d80.000e+035.92TBC1 domain family, member 8 [Source:MGI Symbol;Ac... [more]
Tbc1d80.000e+035.92TBC1 domain family, member 8 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of TBC1 domain family member 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SVR0|TBC9B_MOUSE0.000e+037.62TBC1 domain family member 9B OS=Mus musculus OX=10... [more]
sp|Q66K14|TBC9B_HUMAN0.000e+036.71TBC1 domain family member 9B OS=Homo sapiens OX=96... [more]
sp|Q6ZT07|TBCD9_HUMAN0.000e+036.38TBC1 domain family member 9 OS=Homo sapiens OX=960... [more]
sp|A3KGB4|TBC8B_MOUSE0.000e+033.25TBC1 domain family member 8B OS=Mus musculus OX=10... [more]
sp|Q9Z1A9|TBCD8_MOUSE0.000e+035.92TBC1 domain family member 8 OS=Mus musculus OX=100... [more]
back to top
BLAST of TBC1 domain family member 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TPZ10.000e+038.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JSL20.000e+038.85TBC1 domain family member 9 isoform X2 OS=Lingula ... [more]
A0A1S3JSN90.000e+038.45TBC1 domain family member 9 isoform X1 OS=Lingula ... [more]
V4C7V30.000e+039.59Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9K5E80.000e+042.54Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d90.000e+036.63TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+036.40TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+039.59TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+035.56TBC1 domain family, member 9 (with GRAM domain) [S... [more]
tbc1d90.000e+035.63TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBC1D96.232e-15733.22TBC1 domain family member 9 [Source:HGNC Symbol;Ac... [more]
ENSPMAT00000006389.11.652e-15535.77pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-... [more]
tbc1d2b2.873e-3332.77TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
tbc1d10b4.696e-2430.41TBC1 domain family, member 10b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000009275.11.693e-1838.55pep scaffold:Pmarinus_7.0:GL480906:1885:20274:1 ge... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MDR18.726e-5530.42Cytoplasmic GTPase-activating protein; activates Y... [more]
MSB42.493e-3430.88GTPase-activating protein of the Ras superfamily; ... [more]
MSB31.910e-2830.51Rab GTPase-activating protein; regulates endocytos... [more]
GYP55.802e-1223.38GTPase-activating protein (GAP) for yeast Rab fami... [more]
YFL042C_mRNA9.661e-826.83Putative sterol transfer protein; one of six StART... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498289.230e-11839.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340471.160e-3533.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341964.510e-3532.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350218.180e-3331.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394001.163e-2228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d90.000e+039.56TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+039.41TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+039.41TBC1 domain family member 9B [Source:NCBI gene;Acc... [more]
tbc1d90.000e+036.36TBC1 domain family member 9 [Source:NCBI gene;Acc:... [more]
tbc1d90.000e+036.19TBC1 domain family member 9 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of TBC1 domain family member 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015478.10.000e+099.64SMESG000015478.1[more]
SMESG000015478.10.000e+098.10SMESG000015478.1[more]
SMESG000012909.13.885e-3632.49SMESG000012909.1[more]
SMESG000012909.14.232e-3632.49SMESG000012909.1[more]
SMESG000012909.14.544e-3632.49SMESG000012909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002596 ID=SMED30002596|Name=TBC1 domain family member 9|organism=Schmidtea mediterranea sexual|type=transcript|length=3638bp
TATATAAATCTTATATGATTTTACATATATGTGGAAAAATCCATCTGAAG
TGTTTATCGGATATTCCTTATGGACCCAAGAAAAACAAAATCAATATTTT
GTTTTAGAGAAACGCAAAGGAAAATTAACTGGTGGCTTAACTGGACTTTT
AGTGGGAACTTACGATAACATAATTGATTCTAAGGCAACGAAATATCGGA
TTCTATTAAAAGGATTAGAAGAAGATATTAGTTATGAAATTTGTAAATCA
AACAGTCAAGCAAACATTATGAAATGTTGGGAAAGTCTTGAGAATGATAT
ATTGAATAAAGTTAGTGAATTTAACCGTGACGAAGCAATAGAATTTATTA
AAACAAAAGTCATGAGCATGGCAGCTGTTGAAAAGCAGTCAGTAGATACC
GAAGAAAGTGAATCTTATAAACGAGCAACCGTTAAATTTATTAAAATATT
TAATATGCCAATGGAAGAAAAGCTAGTCAACTATTACTCTTGTTCAATGT
TATCTGGTAGAATACCTTTTCAGGGTTGGCTTTATTTGAGCCTAAATCAT
ATTTGTTTTTATTCATTTCTAATGGGCAAGGAAACACGAATTATTATTCC
ATGGGTTCATGTTCGGATAATCGAAAAATCTACTCGATACTTTGGTCCAG
AATCAATTACTATTAAAACAAAAATTAAAGAGTATTCATTTACATTCTTC
CTCAATATTCAAGAAACATTCAGTTTGATACAGCAACTAGCAAATATCAA
CATTCAAAAATTATTAGTAGAAGAAGGATACCAAGAAGAATATCAATTAA
AAGTCCAATCAGAAAAATTGAATCCCAACAAAGTATCTCGACTAAAATTG
GATCTGGATGCTCAAATTCGTAATAATGAATATAGAGAATCCTTTCGTTT
GCCAATGAATGAAATTTTAGATGGTGATATCGAATGTGCGTTAGTTACAG
ATTACAATAAGAAAACCGTTTCCGGTCGTTTGTACATTTCTTGCAACTTT
ATTTGTTTCGCCAGCAAAATTCTTGATCAGGTCAGGCTTATTATTCCAAC
AAGAGAAGTGATAGCATGTGAGCCAATGACCAAAAGTATTCATCTTTCTA
GCAACAACATAAAAACCCCTTTTGTTATTACAACAACTAGTAGTGCATTT
TTCTTTGGAAATCTCCATAACCGAGATATTGTTATTTCAAAAATCAACAA
TTTTCTCATTGCAACAAATAATACTTCAAGAAAAAGTAAATCATCAGTTT
CATCAGATAGTGCTAACTCGTCAGCAAAATTGGATGTCGTAGATTCGAAA
GAGATTCGTGACAATTCACAAACAGGTCGATTTATGATTAAATATGCTAA
TGCTCCCAAACCTACTGAAAATTTAGATAAAATAATAGAAATCGAGAATA
AACGTCAACACACTTGGGAGAAGTATTTCATCGACCATGGACGTGGAATG
TCTATGTTTCGTACTTGTGAACTGAGAAGACTAGTTCTTGCTGGGCTGAC
TAATAAACTTCGAGCTGAAATATGGATGATTGTATCTGGAGCTCAAAATG
AACTGCTTTTAAATCCGGATTATTATTGGACACTAGTTAGTCAAACTGAA
GCATCTTCGAGTTTTGTTTCGGAGGAGATTGAAAGGGATCTACACAGATC
TCTCCCAGAACATCCTGTGTATCACACTGATGAAGGTCTGTCTTCGCTTC
GACGAGTTCTTACTGCTTATGCATATCGAAATCCGAATATTGGATATTGC
CAAGCCATGAATATCGTAGCTAGTGTGTTACTTTTGTTTTGTAATGAAGA
GGAGGCATTTTGGCTTTTGGTAGCAATTTGTGAGCGATTACTTCCTGATT
ATTACAACGTCAAAGTCATTGGTGTACGTGTTGATCAAACGGTTCTCAAG
GATTTAGTACAGTCTCATTTGGGAATAGACCTATCATTCGAAGATACGTT
TAATGACTCAACTTCACCGGCTTCTAATCCCGTTTCAGAAATCATAGAAA
TGGTTTCCATCTCATGGTTTTTGACCATCTATTTGAACGTTATGTCTTTC
ACAAATGCCATTTACATTATGGACTGTTTTTTCTATGATGGCGCCCAAGT
CATATTTCAAATAGCTTTGGAATTACTGAGACGACATAAGGCGATGCTGA
TAGATATAAAGGATGAAGGAGAAGCAAGTGAGTGCATTCAAAAATTAAGC
GAATGTTGTTCACATTTGGGAGATCCTGATCAGCTTACTATTGAAGAATT
GATTGGATCGGCTTATGAAAACTTTGGAACTGTAACAAATTCTCTTATTA
AACAATTGCGTCTTCAGAACCGTTTGGATGTTGTACATAAAGTTGAGGCC
AACACTTTGCGTGATGTTGTTCGTTCTGTTGGAGAATCAACTAAATTGGA
GAAAGATGAATTGGAAGCTTTGTTTGGAGTTTTTAAAGATCTATATGTGG
CATCGAGTTATTATACTAATCACGTCGTTTCTCCAGCACCTGATATGAGT
AGCTATGATCCTATCAGACCTTATTATGATGCGTTCAGAATAGACTATGA
ACTTTTCGCTCGATTGTTTACATCTTTGTTACCATGGGGACATACTAAAC
AACTAGCACTGAGAATTTTCAGACTTCTAGATCAAGATCTTGATAATATG
ATCAATTTTAAGGAATTTGCGTGGGTTGTAGGAATCATTTGTCATGGTAC
ACTTGAAGAAAAACTACGTTTACTATTTCGATTATATTGTAAACCATGCT
TGTTGCCTGGTGATAAAGAGTTAATAGACAAAGTCACTAAACAAGCTTAT
AATCCGAAAGAATCAATTCCTCACTCGAGTGATGGTCAAAAAGGAGATAT
ATGCACGGAATCGGGAATCGAGTTAACTGAGGAAATGCTGGAATATATTC
ATGCAGAAAGCGAAAATCCAGCATCACCTGCTAAAACTCATAATTTCGGT
GATGTACAAGACAACTTAAGCGGCAAGCAAAGAACAAATTCTCACGCTAA
GCTGCGTTCTAATTCCGTTGAAGAAAATAGCCAATGGATACGAAACACAG
ATCTTCTTCCGAAAATGGGATATGATGATTTGCTTTTATTTTGGACAACT
TTATATGATTTGGCTACAAATGACAATCATGAATCGGACTTGGTCAATGC
TGTAGCTAGAGTTTGTACAAAAGTACAACAAAAAGCAGAAATGAGAGTAA
AAACAGAAAAAGATTGGGTGATAAATTTTGAAGAATTTAGGCATTCATTT
TACAGTGAGCCTGGCTTGGTGGAATTTCTCGGTAGCAAACAGGACATTAG
CTCTTCCTGTAAATCTTTCTGTGTTCGACCTAAATATAATAACCGAAAAT
GAACAAAAACAGACTTTGATATATTTTTGCTCAATTAATTTCTCTTTTCA
GATCGGTTATCAATTTTTATTAGAACTGATGTTGTTATTGTTGTTGGAAA
GAAACCAATCTGTGTCTCTGTGATTAAGTATTCCATAGTGCCATTGTTAA
TGTTGATGTGATGCGATGATTGCGGTCGAGTTCATTGTAATTATAATTGC
AAGAAAATTTGGCATTTTCATTTTGTTGTGGAAAAAATTTTAGAAGTCTG
TAAAAAATAAAAGTTTTATTTCTCTTTTGAAAAAAAAA
back to top

protein sequence of SMED30002596-orf-1

>SMED30002596-orf-1 ID=SMED30002596-orf-1|Name=SMED30002596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1108bp
MWKNPSEVFIGYSLWTQEKQNQYFVLEKRKGKLTGGLTGLLVGTYDNIID
SKATKYRILLKGLEEDISYEICKSNSQANIMKCWESLENDILNKVSEFNR
DEAIEFIKTKVMSMAAVEKQSVDTEESESYKRATVKFIKIFNMPMEEKLV
NYYSCSMLSGRIPFQGWLYLSLNHICFYSFLMGKETRIIIPWVHVRIIEK
STRYFGPESITIKTKIKEYSFTFFLNIQETFSLIQQLANINIQKLLVEEG
YQEEYQLKVQSEKLNPNKVSRLKLDLDAQIRNNEYRESFRLPMNEILDGD
IECALVTDYNKKTVSGRLYISCNFICFASKILDQVRLIIPTREVIACEPM
TKSIHLSSNNIKTPFVITTTSSAFFFGNLHNRDIVISKINNFLIATNNTS
RKSKSSVSSDSANSSAKLDVVDSKEIRDNSQTGRFMIKYANAPKPTENLD
KIIEIENKRQHTWEKYFIDHGRGMSMFRTCELRRLVLAGLTNKLRAEIWM
IVSGAQNELLLNPDYYWTLVSQTEASSSFVSEEIERDLHRSLPEHPVYHT
DEGLSSLRRVLTAYAYRNPNIGYCQAMNIVASVLLLFCNEEEAFWLLVAI
CERLLPDYYNVKVIGVRVDQTVLKDLVQSHLGIDLSFEDTFNDSTSPASN
PVSEIIEMVSISWFLTIYLNVMSFTNAIYIMDCFFYDGAQVIFQIALELL
RRHKAMLIDIKDEGEASECIQKLSECCSHLGDPDQLTIEELIGSAYENFG
TVTNSLIKQLRLQNRLDVVHKVEANTLRDVVRSVGESTKLEKDELEALFG
VFKDLYVASSYYTNHVVSPAPDMSSYDPIRPYYDAFRIDYELFARLFTSL
LPWGHTKQLALRIFRLLDQDLDNMINFKEFAWVVGIICHGTLEEKLRLLF
RLYCKPCLLPGDKELIDKVTKQAYNPKESIPHSSDGQKGDICTESGIELT
EEMLEYIHAESENPASPAKTHNFGDVQDNLSGKQRTNSHAKLRSNSVEEN
SQWIRNTDLLPKMGYDDLLLFWTTLYDLATNDNHESDLVNAVARVCTKVQ
QKAEMRVKTEKDWVINFEEFRHSFYSEPGLVEFLGSKQDISSSCKSFCVR
PKYNNRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom_sf
IPR035969Rab-GTPase_TBC_sf
IPR004182GRAM
IPR000195Rab-GTPase-TBC_dom
IPR011992EF-hand-dom_pair
IPR001751S100/CaBP-9k_CS
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 490..715
e-value: 2.8E-40
score: 149.8
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 497..711
e-value: 8.9E-38
score: 130.1
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 493..692
score: 27.745
IPR004182GRAM domainSMARTSM00568gram2001ccoord: 139..206
e-value: 3.6E-20
score: 83.0
coord: 287..355
e-value: 4.1E-12
score: 56.3
IPR004182GRAM domainPFAMPF02893GRAMcoord: 141..242
e-value: 2.8E-19
score: 69.1
coord: 290..398
e-value: 1.2E-11
score: 44.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 751..910
e-value: 2.4E-19
score: 71.5
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 508..611
e-value: 2.7E-36
score: 125.6
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 612..750
e-value: 3.9E-14
score: 54.6
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 21..723
NoneNo IPR availablePANTHERPTHR22957:SF260TBC1 DOMAIN FAMILY MEMBER 8coord: 21..723
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 137..243
e-value: 1.4E-22
score: 81.6
coord: 284..397
e-value: 3.4E-10
score: 41.8
IPR001751S100/Calbindin-D9k, conserved sitePROSITEPS00303S100_CABPcoord: 867..888
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 859..894
score: 9.827
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 662..729
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 465..635
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 830..907