Protocadherin alpha-2

Overview
NameProtocadherin alpha-2
Smed IDSMED30002560
Length (bp)3219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin alpha-2 (SMED30002560) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin alpha-2 (SMED30002560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin alpha-2 (SMED30002560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin alpha-2 (SMED30002560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30002560SMESG000046595.1 dd_Smed_v4_19860_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30002560SMESG000046595.1 SmedASXL_015900SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002560SMESG000046595.1 dd_Smed_v6_19860_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002560SMESG000046595.1 SMESG000046598.1 OX_Smed_1.0.13031ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 214.157 bits (544), Expect = 1.048e-55
Identity = 187/676 (27.66%), Postives = 325/676 (48.08%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK--AIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRL---HLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQL--SNKSKVYVKILDVNDNAPQ-STTLMTYHIAEN-TQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPS-LTSWMEFFIVLSQAN 2430
            ++  D  QS    +N+TV+  D ND  P F +  Y  +I E +  P  L+    A D DS VNG   Y I N  +   I +++    + N+T  +DYE    + ++ L    +DG  +F     ++ +I D NDN P F     +  ++EN+ VGS V  F  +D D G+NS + YS++        S   +     G+LK++  +D E+     +  +V   D  ++     +++A V + ++D+NDN P  +  +   I EN P   +V     TD D    + ++       G   +I ++ DG  R+  T   D E      + +   D   P +     + V ++DINDN P F+QA Y  EI EN    T++ Q+ A+D D     ++ + I+  N    F ID   G +++   +DRE+   +H  VQ TD G    ++ S V + +LD+ND  P    +  + ++ EN   + +++ Q+   D+D+  N   ++  +  + ++ F L+ SG++ + + LDRE K+ +++     D G+  ALT T T+++ + D+NDN P F      +       I  D+P+ T ++ + A+D D ++NA +  R+   N S FT IN  TG+I    +        Y++    SD G+P  L+S     + ++  N
Sbjct:  112 VRADDGLQSSDMRINITVS--DVNDHTPKFSRPVYSFDIPE-DTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFFLNPITGVFNLTRLLDYE---VQQYYILTVRAEDGGGQFT-TIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIA-----SGDSLGQFTVDKNGVLKVLKALDRES--QSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI-DGEVRL--TGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGS-PALTGTGTINVIVDDVNDNVPTF------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIGGN-SQFT-INPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVN 758          

HSP 2 Score: 166.007 bits (419), Expect = 1.318e-40
Identity = 183/680 (26.91%), Postives = 312/680 (45.88%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP--LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTN-ASSFTKINS----------ETGEIYFFYIDMIPK----PGMYS---IKATVSD-NGTPSLTSWMEFFI 2412
            S+     VT+NI+D ND+ P F KSKY   + ++ +    LI +    D+D  +N    Y I N+ N+L    +D     +++   +   D +Q  F   + A D G      +  + I +T+ N + P F     +  I E+ S+GSIV    A D+D+ +N LIKYS+S  SG +     F +NS+TG+L L   +DYE  + +     + A D G +  +   +V V V+D+NDN P  +      ++ EN PSG  V+  + TD D    N +     +S    +  +D     I +    D E  +   + +   +           +++ +   N+  P+F    YYFEI E  P  T V ++ ASD D   + +V+ L F   +   F I+   G + +   +DRE+ E    +V   + G +     ++  V V +LD ND    +  + +  I+E   I   V  +S  D+D + + +  F  +I S N     +   ++G+I +   LDRE   +Y +  +  D G   A T +A++ + ++DINDN P+    + +        +  +    T ++TL++TD DL  N    TY L  T  A+S+  +++          +  +I  FY+ ++ K    P M S   +  TV D N  PS +  +E F+
Sbjct: 1260 SLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISND-NHLGKFKLDNDTGWISVASSL-ISDLNQNFF-ITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSIS--SGNE--EGIFAINSSTGILTLAKALDYE--LCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADS-GTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWS-RFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSA-TGSASLLVTLEDINDNGPMLTVSEGE--------VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFV 1919          

HSP 3 Score: 165.236 bits (417), Expect = 2.021e-40
Identity = 196/738 (26.56%), Postives = 325/738 (44.04%), Query Frame = 1
Query:  271 LLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI------DYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDL--DELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAE-FNRF-CWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY------------FFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            +LFG     N  N   L+  GE+   + +DR+ ++         + VL  I    + SP  T       + ++NV V+  D ND++P F    Y   I E       +LL  A D D+  N V           + I+  + Q  I   TG+I      D E  ++  +  ++  +D G  E     T + + +TD NDN P F        I      GS V+    +D D G NS + YSLS  +     S KF+++   G +     ++  + +    TF V   D G    + S TV V+ ++  D        Q     EN+P   +V T + + L  + +S      +   +F      +D    +++ +Q  D E   ++  WIE    D   P       L + ++D+NDN P F +  +  EI ENL     +  +SA D D+    +L++ I+  N    F+I+ A G +     +DRE++ ++   ++ +D G  S  +  KV + ILD NDNAP+ + + + H+ EN+ +  +V +++ +D D   N    +   IM  + PF +  S G I++ + L+RE  D Y I    +D G     T +  V+I + DINDN P F     ++ + L  P   +  S+ T +   ATD D   N ++ Y +   + S + +IN+ TGEI+            F  +++      +S   T SD G PSL S
Sbjct:  596 VLFGG----NEDNAFTLSASGELGVTQSLDRETKE---------RFVL-MITATDSGSPALTG------TGTINVIVD--DVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV-----------IRIIGGNSQFTINPSTGQIITSALLDRE--TKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRN-----SEKFHIDPLRGAIMAAGPLNGASEV----TFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTF-----QIDQLTGQVSISQPLDFEKIQKYVVWIEAR--DGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPR-KILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYS--IMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNAPRF----SRTSYYLDCPELTEIGSKVTQVF--ATDPDEGSNGQVFYFIK--SQSEYFRINATTGEIFNKQILKYQNVTGFSNVNI----NRHSFIVTSSDRGKPSLIS 1263          

HSP 4 Score: 156.377 bits (394), Expect = 1.041e-37
Identity = 170/634 (26.81%), Postives = 296/634 (46.69%), Query Frame = 1
Query:  463 NFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLF--ATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL--IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQL------KCDFYRSFGLAIDSVDDGIYRIASTQVF-DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN-KLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
             F   S    + + ++D ND+ P F++  +   I+E+     IL   A+D+DS  NG   Y I N N  N F   I+     +     +D E    ++ H++L   ++D G         + I+I D NDN P F  +  +  + EN  +G  V +   SD+D G+N++ +YS+   S P      F +N +TG + +   ++ E+  DR +   V A DSG    + S  V + V DINDN P      +  +     E   K+   F+ TD DE S  Q+      + +++R      +  +  I +  +   F +   NR  +I +   D   P +     + + I+D NDN PQF ++KY+  + +N+ + T + +++A D  +  +N ++ + I   N+   F +D   G +S+ +++  +  +NF   V   D G   LS+++ V++ + + N + P+ S + M+  I E+  I   V  +S  D D   NG   +     +    F +  S G + L K LD E    + +     D G +VA T   +V++++ D+NDN PVF+             +  ++PS TT+I L ATD D   NA + Y +  +++  F  I+  TG I
Sbjct:  943 GFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSF--SINHATGEIRSVRPLDRE----KVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP------FTINPSTGDIVISRPLNRED-TDR-YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFA-TDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFI-VTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAID-GGWVARTGYCSVTVNVIDVNDNSPVFL------SDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFV-IDPNTGVI 1548          

HSP 5 Score: 150.214 bits (378), Expect = 9.139e-36
Identity = 184/708 (25.99%), Postives = 319/708 (45.06%), Query Frame = 1
Query:  262 NYQLLFGKTSFRNLVNYVQLNNK-GEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG------LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS----FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLI---PFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            +Y+++ G     N+ N   +N+  GEI+++R +DR+         +    VL  I+     SP Q        S SV V +NI+DEND+ P F +  +  ++ E++  PL   +      D D  +N +  YSI    +      I+     + I+  ++ ED+ +  +   + A D G   +   TD+ I +TD NDN P F      ++  E   +GS V Q  A+D D G N  + Y +      KS S  F +N+TTG      +LK  N   + N      +FIV ++D G+  L +  TV + ++D NDN P+ +  +    +T+N   G  ++  +  D  +   N  + +++ S     G      D G   +AS+ + D   N+  +I +   D  +P +     +H+ + + N + P+FSQ+     I E+  I + V  +SA D D +    + +SI   N    F I+ + GIL++   +D E  +     +   D G ++      V V ++DVNDN+P   +   +  + EN     +V  L+ TD D   N    +   + S++S   +    +G I     LD E K  Y +    F V D        + ATV+I ++  N+  P F+     SK    + I   +P  T +  + A+D+DL  + ++ Y +   +     +IN +TG+IY
Sbjct: 1002 DYEIVNG-----NMENSFSINHATGEIRSVRPLDRE---------KVSHYVLT-IKSSDKGSPSQ--------STSVKVMINILDENDNAPRFSQ-IFSAHVPENS--PLGYTVTRVTTSDEDIGINAISRYSI---MDASLPFTINPSTGDIVISRPLNREDTDR--YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFI------KSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNS-EVEYFISNDNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYT--VQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDE----ERCSFATVNIQLKGTNEYVPRFV-----SKLYYFE-ISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIY 1654          

HSP 6 Score: 146.747 bits (369), Expect = 1.035e-34
Identity = 153/576 (26.56%), Postives = 261/576 (45.31%), Query Frame = 1
Query:  766 LFATDDGLNEFKCKTDIFI---HITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAS-------TQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQL-----SNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSN--NSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            + A  D L +     ++FI    + D NDN P F      + + ENI  GS + Q  A D D G N+L+ Y++  +SG       F ++  +G L    ++D E      ++ +V A D  +   S+   + + V D+ND+ P+      +  I E+   G +V     TD D     ++         +  +  +DGI+ +         T++ D E  ++  + +   D           ++  I+D+NDN P FS   Y   + ENLP+ + V   + +D D+   ++L +SI   +    FT+D  NG+L +   +DRE    ++  VQ+ D  Q+     ++ ++V + +LDVNDN P   +    +I ENT ID  V +   TD D   +G  ++ EY + N   + F + T  G++ L   LDRE+   Y +  +  D G   +L+++  V + + DINDN P+F   +Y  E +++ L         + T II + A D D   N ++ Y +   N +   +I+S TG I         K   Y +    +D G+   T      IVL
Sbjct:    5 VVAVGDTLAQPLAAAEVFIVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTI--ISG---ADDSFRIDPESGDLIATRRLDRER--RSKYSLLVRADDGLQ---SSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY-------IVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTT--IRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVD-KNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPD---SGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQ-PSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTL---------TGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVL 547          

HSP 7 Score: 137.117 bits (344), Expect = 8.068e-32
Identity = 169/675 (25.04%), Postives = 302/675 (44.74%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNG---------VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVA-SDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---NYFTIDPANGILSIKTNIDREEIENFHFEVQ---ITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFV-ALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQD-LNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            S +VT+ + D ND+ P F ++ Y ++  E  E    +    A D D   NG           ++ I+     +F   I K     N+TG   + + +     F++ ++D G      +T + I+I D+NDN P F   +    + +N+ VG+ + +  A  DKD G+NS ++Y +S      +   KF L++ TG + + + +  +  +++ F   V A D G   LS+ ATV + V + N + PE    H + +I E+   G IV T S  D D      +K          I +++     +   +  D E  +   + I+ +D           + V +ID+NDN P F    Y+  + EN P  T V  L+A+D D S  N +    +Q    + F IDP  G+++ +  +D E  +++H  V+   + D  + S  + V +++   N+  P+  + + Y  I+E       V ++  +D D   +G   +  +  S    F++  K+G+I +   LDREK++   +  +  + G+   A     TV++ + D ND  P+F   IY  + S+           P  T +  + A D D +   ++ +Y +   N +    IN +TG+I     +D    P +Y++     D+GTPS T      + L   N
Sbjct: 1153 STDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQ---NVTG---FSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN----DNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDAD-SGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCS-FATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISE---------GVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLP-IYNLSVLAVDSGTPSATGSASLLVTLEDIN 1802          

HSP 8 Score: 77.7962 bits (190), Expect = 1.108e-13
Identity = 95/364 (26.10%), Postives = 160/364 (43.96%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLL--FATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFY--------RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENL 1542
              V + +   N+ +P F    Y   I E+     I+    A DRD   +G  HY I  N+    F   I+K+   + ++G +D E   +     L   F +  G +  +   ++   + DAND  P F     +++I E + +G+ V    A D DS + S  ++S     G  + +  F +N  TG + +  ++D E     I+   V+A DSG    + SA+++V + DINDN P L V +   + EN+  G +V+T   TD D L  NQ    +Y          F L+   V      +++T+  D E     ++ +   D+  P +     +H+ +ID NDN  Q    + +     NL
Sbjct: 1580 ATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF--QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNV--TVLDANDP-PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDS-IPSWSRFSY--FIGSGNENGAFSINPQTGQITVTAELDRETL--PIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGE-VMENKRPGTLVMTLQSTDPD-LPPNQGPFTYYLLSTGPATSYFSLSTAGV------LSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNL 1925          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 213.386 bits (542), Expect = 2.354e-55
Identity = 187/676 (27.66%), Postives = 325/676 (48.08%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK--AIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRL---HLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQL--SNKSKVYVKILDVNDNAPQ-STTLMTYHIAEN-TQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPS-LTSWMEFFIVLSQAN 2430
            ++  D  QS    +N+TV+  D ND  P F +  Y  +I E +  P  L+    A D DS VNG   Y I N  +   I +++    + N+T  +DYE    + ++ L    +DG  +F     ++ +I D NDN P F     +  ++EN+ VGS V  F  +D D G+NS + YS++        S   +     G+LK++  +D E+     +  +V   D  ++     +++A V + ++D+NDN P  +  +   I EN P   +V     TD D    + ++       G   +I ++ DG  R+  T   D E      + +   D   P +     + V ++DINDN P F+QA Y  EI EN    T++ Q+ A+D D     ++ + I+  N    F ID   G +++   +DRE+   +H  VQ TD G    ++ S V + +LD+ND  P    +  + ++ EN   + +++ Q+   D+D+  N   ++  +  + ++ F L+ SG++ + + LDRE K+ +++     D G+  ALT T T+++ + D+NDN P F      +       I  D+P+ T ++ + A+D D ++NA +  R+   N S FT IN  TG+I    +        Y++    SD G+P  L+S     + ++  N
Sbjct: 1814 VRADDGLQSSDMRINITVS--DVNDHTPKFSRPVYSFDIPE-DTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFFLNPITGVFNLTRLLDYE---VQQYYILTVRAEDGGGQFTT-IRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIA-----SGDSLGQFTVDKNGVLKVLKALDRES--QSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI-DGEVRL--TGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGS-PALTGTGTINVIVDDVNDNVPTF------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIGGN-SQFT-INPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVN 2460          

HSP 2 Score: 204.527 bits (519), Expect = 1.448e-52
Identity = 201/665 (30.23%), Postives = 320/665 (48.12%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVD-DGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA-SSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            ++   V + + D ND+ P F     D+ + E+  +   I+   A+D D   N +  Y+I +  ++ F   ID ++  L  T ++D E   +R  + LL   DDGL     +  I I ++D ND+ P F     + +I E+   GS+V   +A+D DSGVN  I Y    +         F+LN  TG+  L   +DYE  + + +   V A D G     T+  V   ++D+NDN P   ++  + S+ EN P G  VL F+ TD D+   +QL         L   +VD +G+ ++   +  D E   F  + +   D    P  +      V II  D+NDN P F   K  + I EN PI T V++  A+D D+   + + ++++    N F+I   +G + +   +DREE+ N+   V  TD GQ  LS+ ++V V +LD+NDN P  +  L    I ENT     + Q+   D D+  NG   +     + N  F++ + +G I + K LDREK   Y +     D G+    T T+TVSI + DIND  PVF    E S + +  P    +  R TI+ + A D D   N+KL+Y L   N  ++FT   S +GE+     +D   K   + +  T +D+G+P+LT      +++   N
Sbjct: 1721 TQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSF--RIDPESGDLIATRRLDRE---RRSKYSLLVRADDGLQSSDMR--INITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY----IVNEDDEDGIFFLNPITGVFNLTRLLDYE--VQQYYILTVRAEDGGGQF--TTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKV--LKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGS-TPRTDTSTVSIVLLDINDFVPVF----ELSPYSVNVPENLGTLPR-TILQVVARDDDRGSNSKLSYVLFGGNEDNAFTL--SASGELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVN 2358          

HSP 3 Score: 183.726 bits (465), Expect = 3.996e-46
Identity = 173/627 (27.59%), Postives = 300/627 (47.85%), Query Frame = 1
Query:  430 EINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP-LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDF---YRSFGLAIDSVDDGIYRIASTQVFDAE--FNR-----FCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL 2250
            E +F  ++ + +  +++    V + + D ND+ P F ++   +N++E+ +    I   KA+D D  VNG+  YS+  N  NLF   I+++   +++ G +D    S   +   + A+D G+ +      + +++ D NDN P FD     + + E+  V S  ++  ASDKDSG N  I Y+++   G    +   + +   G L + +++D E   DR +  +V+A+D     LS +  V V + D+NDN P L    N +    E + +G  V   S  D D     +++  F      F L   S +     I +T  FD E    R     F +  I         +K    +HV + DINDN P+F +  Y   I E+    T V ++SASD+D  +   +++SII+ N    F ID  +G +++   +D E    +   +Q  D+G   L++   + + ILD NDN P    + +   + EN +I + V+ ++ TD+D  +N    +     +N+  F ++  +G I L K LD E + LY +     D G     ++T +V IH++D NDN P F          + K I  + P  T++I++ A D D + N +L+Y +
Sbjct:  858 EQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFA--INEKNGTISLLGPLDVHAGS---YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIA--EGNTGDAFGIFPD---GQLYIKSELDRE-LQDR-YVLMVVASDRAVEPLSATVNVTVILEDVNDNRP-LFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGE-----ITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGR-PPRSSTMSVVIHVRDFNDNPPSF------PPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTI 1459          

HSP 4 Score: 175.252 bits (443), Expect = 1.972e-43
Identity = 177/645 (27.44%), Postives = 289/645 (44.81%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYS---IDNNYNNLFIVYI----DKQAPILNIT--GKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL------IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ------LKCDFYRSFGLAIDSVDD-GIYRIASTQVFDAEFNRFCWIEINCLDN--ASP-----IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKT--NIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIA--ENTQIDQSVAQLSFTDNDKLENGTFTFK-EYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V V + D ND+ P F      +   E S+    ++L  A D D   NGV H S   I  N    F + I      +   L++   G +D E + Q  +  L+   D G  + +    + + + D NDN P F        + E+  VGS V Q  A+D D G N+ I+Y L      +   T F ++  TGL+ +   +D+E    R ++  V A D G   L+  A  +++++D+NDN P +         +  S+ EN   G +V   + TD D  + N       L  +  R F +    V +  + ++AS    D E      + ++  DN  A P         +  L + + DIND+ P FSQ  Y   + E  P  + V  +SA+D D+     L +SI+  N   +F I   +G+++  +   +DRE        +   D G     S  ++ V +LDVND  P  +    Y ++  EN      +  L  TD D  +NGT  F  +   ++   F+L   SG++  +  LDRE++  Y +  +  D G+    ++ A +++ + DINDN PVF YP +   H     I  + P  + I T+ ATD DL  N  + Y +   + S F ++N+++G I
Sbjct:  121 VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQ--YQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRL------QDEGTPFQMDPETGLITVREPLDFE--ARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVAS--ALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGS-PPQSSMARINVSLLDINDNSPVF-YPVQYFAH-----IKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRF-QVNAQSGVI 745          

HSP 5 Score: 166.392 bits (420), Expect = 1.057e-40
Identity = 181/680 (26.62%), Postives = 306/680 (45.00%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDR----IFTFIVIATDSGRLH-LSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDE-----LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKE-YIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTA--TVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSR---TTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFP 2436
            +S SV +TV + D ND+ P F +  Y++ + ES          +A D+DS  NG   Y+I + N  + F ++ D Q   L I  ++D E   Q  +  ++ A+D  +       ++ + + D NDN P F+    T    E    GS V +  A DKD G N  ++YS       + +   F L++ +G +   ++ D E+ + R    +F+F VIATD G    L   ATV V + DINDN P+ +      +I+E+  +   VL  S +D+DE     +  + +K +  R F  AIDS    +  I      D E      + I  +D+ +  +     L++ I+D NDN P F ++  + ++ EN+ I   V  ++A+D D+ D   L +SI   N    F+I P  G + +   +D E    +   +   D G+    S   V + + D NDN P       +  I EN  I  SV  ++  D D   NG  ++     M   + F + +  G I     +DRE  +L+ +     D    +     A   V+I + D+NDN P+FI     S++ L        PS    + + T+ A D D   N ++ Y +   +  +F  ++  +G++      ++P   +Y++  + +D G     S  E  I+L   + P
Sbjct:  976 LSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQ---LYIKSELDRE--LQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSF------EMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQF--AIDSTSGQVTLIGK---LDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI-----SQNALAA-----DPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFI-VDRYSGDLRVASA-LVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGP 1627          

HSP 6 Score: 164.851 bits (416), Expect = 3.023e-40
Identity = 182/673 (27.04%), Postives = 310/673 (46.06%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFP--LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTN-ASSFTKINS----------ETGEIYFFYIDMIPK----PGMYS---IKATVSD-NGTPSLTSWMEFFI 2412
            VT+NI+D ND+ P F KSKY   + ++ +    LI +    D+D  +N    Y I N+ N+L    +D     +++   +   D +Q  F   + A D G      +  + I +T+ N + P F     +  I E+ S+GSIV    A D+D+ +N LIKYS+S  SG +     F +NS+TG+L L   +DYE  + +     + A D G +  +   +V V V+D+NDN P  +      ++ EN PSG  V+  + TD D    N +     +S    +  +D     I +    D E  +   + +   +           +++ +   N+  P+F    YYFEI E  P  T V ++ ASD D   + +V+ L F   +   F I+   G + +   +DRE+ E    +V   + G +     ++  V V +LD ND    +  + +  I+E   I   V  +S  D+D + + +  F  +I S N     +   ++G+I +   LDRE   +Y +  +  D G   A T +A++ + ++DINDN P+    + +        +  +    T ++TL++TD DL  N    TY L  T  A+S+  +++          +  +I  FY+ ++ K    P M S   +  TV D N  PS +  +E F+
Sbjct: 2969 VTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISND-NHLGKFKLDNDTGWISVASSL-ISDLNQNFF-ITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSIS--SGNE--EGIFAINSSTGILTLAKALDYE--LCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADS-GTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWS-RFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSA-TGSASLLVTLEDINDNGPMLTVSEGE--------VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFV 3621          

HSP 7 Score: 163.696 bits (413), Expect = 6.039e-40
Identity = 194/736 (26.36%), Postives = 323/736 (43.89%), Query Frame = 1
Query:  271 LLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI------DYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDL--DELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY------------FFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            +LFG     N  N   L+  GE+   + +DR+ ++         + VL  I    + SP  T       + ++NV V+  D ND++P F    Y   I E       +LL  A D D+  N V           + I+  + Q  I   TG+I      D E  ++  +  ++  +D G  E     T + + +TD NDN P F        I      GS V+    +D D G NS + YSLS  +     S KF+++   G +     ++  + +    TF V   D G    + S TV V+ ++  D        Q     EN+P   +V T + + L  + +S      +   +F      +D    +++ +Q  D E  +   + I   D   P       L + ++D+NDN P F +  +  EI ENL     +  +SA D D+    +L++ I+  N    F+I+ A G +     +DRE++ ++   ++ +D G  S  +  KV + ILD NDNAP+ + + + H+ EN+ +  +V +++ +D D   N    +   IM  + PF +  S G I++ + L+RE  D Y I    +D G     T +  V+I + DINDN P F     ++ + L  P   +  S+ T +   ATD D   N ++ Y +   + S + +IN+ TGEI+            F  +++      +S   T SD G PSL S
Sbjct: 2298 VLFGG----NEDNAFTLSASGELGVTQSLDRETKE---------RFVL-MITATDSGSPALTG------TGTINVIVD--DVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV-----------IRIIGGNSQFTINPSTGQIITSALLDRE--TKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRN-----SEKFHIDPLRGAIMAAGPLNGASEV----TFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTF-----QIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPR-KILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYS--IMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNAPRF----SRTSYYLDCPELTEIGSKVTQVF--ATDPDEGSNGQVFYFI--KSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNI----NRHSFIVTSSDRGKPSLIS 2965          

HSP 8 Score: 155.221 bits (391), Expect = 2.601e-37
Identity = 170/634 (26.81%), Postives = 296/634 (46.69%), Query Frame = 1
Query:  463 NFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLF--ATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL--IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQL------KCDFYRSFGLAIDSVDDGIYRIASTQVF-DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN-KLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
             F   S    + + ++D ND+ P F++  +   I+E+     IL   A+D+DS  NG   Y I N N  N F   I+     +     +D E    ++ H++L   ++D G         + I+I D NDN P F  +  +  + EN  +G  V +   SD+D G+N++ +YS+   S P      F +N +TG + +   ++ E+  DR +   V A DSG    + S  V + V DINDN P      +  +     E   K+   F+ TD DE S  Q+      + +++R      +  +  I +  +   F +   NR  +I +   D   P +     + + I+D NDN PQF ++KY+  + +N+ + T + +++A D  +  +N ++ + I   N+   F +D   G +S+ +++  +  +NF   V   D G   LS+++ V++ + + N + P+ S + M+  I E+  I   V  +S  D D   NG   +     +    F +  S G + L K LD E    + +     D G +VA T   +V++++ D+NDN PVF+             +  ++PS TT+I L ATD D   NA + Y +  +++  F  I+  TG I
Sbjct: 2645 GFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSF--SINHATGEIRSVRPLDRE----KVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP------FTINPSTGDIVISRPLNRED-TDR-YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFA-TDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFI-VTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAID-GGWVARTGYCSVTVNVIDVNDNSPVFL------SDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFV-IDPNTGVI 3250          

HSP 9 Score: 154.836 bits (390), Expect = 3.817e-37
Identity = 168/635 (26.46%), Postives = 273/635 (42.99%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFK-----EKTIEILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTT----GLLKLVNKVDYENFIDRIFTFIV-----IATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD--GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC----NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            VNVTV   D ND+ P F  S Y   + E       +L   A D D   N    Y + +         +D +  ++ +   +D+E  ++R +   + A D G+     + +  I + D NDN P   F+      +   + EN  VG++V     +D DS   N  I   +  L G +     F + S+      L+K+ + +D E       T  V         +     S+ A++++ V DIND+ P     V++ N ++E  P G  V   S TD D      L+       GL    + +  G+    S+   D E      + I+  D           L V ++D+ND  P FSQ + Y   + EN P  T +  L A+D D  D   + FS+ +       F +DP +G LS  +++DREE   +   V  TD G    S+ +++ V +LD+NDN+P    +  + HI EN      +  +S TD D   NGT  +      + S F++  +SG I     LDRE+K  Y +  +  D GN  +    A V+I + D  DN PVF     +  +  +  +F +      + ++ A+  DLN N  ++Y +   +      IN  TG++
Sbjct:  236 VNVTVQ--DINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPF---QMDPETGLITVREPLDFE--ARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQI--LGGNE--QRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVN-LSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYS-ISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQS-PNQAIVTITVLDTQDNPPVF----SQVAYSFV--VFENVALGYHVGSVSASTMDLNSN--ISYLITTGDQKGMFAINQVTGQL 848          

HSP 10 Score: 150.984 bits (380), Expect = 4.912e-36
Identity = 152/605 (25.12%), Postives = 270/605 (44.63%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFF-QKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGL-AIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHI--AENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF------IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLD 2253
              + V ++D ND  P F Q   YD++++E+      +L+ +A D D   NG   +S+     +     +D  +  L+    +D E+  Q  +  L+ ATD G         I + + D NDN P F   +    I EN   GS +    A+D D G N  +KYS+S  +G +S   +F +N+ +G++     +D E      +   ++ATD G L     A V + V+D  DN P    V  +  + EN   G  V + S + +D  S            G+ AI+ V     ++ +  V D E   F  +++     +   +     +++ + D+NDN P F QA     + EN     +++Q  A D D      + +S+ Q   N F I+  NG +S+   +D     ++  E+  +D G  QLS+   + V + DVNDN+P    L +Y +  +E+  ++    ++  +D D   NG   +     +    F +   G++ +   LDRE +D Y++  +  D      L+ T  V++ ++D+NDN+P+F       Y +E+ + G            + +  + A D+D   N ++ Y  +
Sbjct:  566 AQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREE--QAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSIS--AGDRS---RFQVNAQSGVISTRMALDREE--KTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTG---QLTTANVIDREEQSFYQLKVVA---SGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHA-GSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQL-SYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRA-VEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAG------------SFVGKVSAVDKDFGPNGEVRYSFE 1140          

HSP 11 Score: 149.058 bits (375), Expect = 2.105e-35
Identity = 182/696 (26.15%), Postives = 313/696 (44.97%), Query Frame = 1
Query:  298 NLVNYVQLNNK-GEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG------LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS----FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLI---PFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            N+ N   +N+  GEI+++R +DR+         +    VL  I+     SP Q        S SV V +NI+DEND+ P F +  +  ++ E++  PL   +      D D  +N +  YSI    +      I+     + I+  ++ ED+ +  +   + A D G   +   TD+ I +TD NDN P F      ++  E   +GS V Q  A+D D G N  + Y +      KS S  F +N+TTG      +LK  N   + N      +FIV ++D G+  L +  TV + ++D NDN P+ +  +    +T+N   G  ++  +  D  +   N  + +++ S     G      D G   +AS+ + D   N+  +I +   D  +P +     +H+ + + N + P+FSQ+     I E+  I + V  +SA D D +    + +SI   N    F I+ + GIL++   +D E  +     +   D G ++      V V ++DVNDN+P   +   +  + EN     +V  L+ TD D   N    +   + S++S   +    +G I     LD E K  Y +    F V D        + ATV+I ++  N+  P F+     SK    + I   +P  T +  + A+D+DL  + ++ Y +   +     +IN +TG+IY
Sbjct: 2711 NMENSFSINHATGEIRSVRPLDRE---------KVSHYVLT-IKSSDKGSPSQ--------STSVKVMINILDENDNAPRFSQ-IFSAHVPENS--PLGYTVTRVTTSDEDIGINAISRYSI---MDASLPFTINPSTGDIVISRPLNREDTDR--YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFI------KSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNS-EVEYFISNDNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYT--VQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDE----ERCSFATVNIQLKGTNEYVPRFV-----SKLYYFE-ISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIY 3356          

HSP 12 Score: 145.206 bits (365), Expect = 3.545e-34
Identity = 193/731 (26.40%), Postives = 308/731 (42.13%), Query Frame = 1
Query:  184 SFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNN-KGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNF-QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLH---VPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI-AENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--------SGKIILMKHLDREKKD-LYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            +F   +  +A +F+G +   +K+   N ++ +   SF  +    +L+   GEI    + DR+             ++  +     +F+ I T     Q +     V V + D ND+ P F K  Y   I ES      +L   A D D   NG+ HYSI   N    F   ID  +  + + GK+DYE  +   +  ++ A D G         + I I D NDN P+F      +++LEN+ +G +V    A+D DSG N+ + YS   ++G  +  T F ++  TG + L  K+D+E     ++   + A D GR   S++ +V++ V D NDN P         SI EN P G  V++ +  D D     QL         R     ID V   IY  A     D EF     + +   D A PI  + + L    + + D+NDN P F  ++     + +  I + +  + A+D D     ++ + II    + F +D  +G L + + +   ++  ++  V  TD G    KS   + I+    + P  T      I  E   I  +V  +        E      + YI+S     K           +G I     LDRE+   LYL+     +       T  A V I +QDINDN PVF  P +     + + I   S     I+ L A D D   NA +TY +      SF +I+ E+G++
Sbjct: 1106 TFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRY---SFEMVQPDFELHAISGEITNTHQFDRE------------SLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFA--IDSTSGQVTLIGKLDYE--ATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYS---ITGTNNHGT-FSISPNTGSIFLAKKLDFET--QSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAE---IDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI-SQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDLRVASALVPSQLI-YNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSE---APVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVF--PTDMLDLTVEENIGDGS----KIMQLTAMDADEGANALVTYTIISGADDSF-RIDPESGDL 1796          

HSP 13 Score: 143.28 bits (360), Expect = 1.136e-33
Identity = 140/543 (25.78%), Postives = 244/543 (44.94%), Query Frame = 1
Query:  814 IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLD-------ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTS 2394
            + I + D ND+ P F  +   + + E    GS V    A+D DSG+N+ ++YS+   +G       F+++  +GL+   +    +  +       + A D G     + A ++V ++D+ND  P     +    S+ EN P+G  +L    TD D         S  + + D  RSF L  D V     R+++    D E   F  + +   D  SP    +  ++V ++DINDN P F   +Y+  I+EN P  + +  +SA+D D      + +SI   +   F ++  +G++S +  +DREE   +  ++  TD G L   N++ V + +LD  DN P  S    ++ + EN  +   V  +S +  D   N   ++          F + + +G++     +DRE++  Y +  +V   G    +T    V+I ++D+NDN P F+   E         +  +  +  +I   +A D D   N  + Y L K N  +   IN + G I     +D+    G Y I+   SD G P L+S
Sbjct:  461 LVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNG----LGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETD-RRSFRL--DPVSG---RLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL--NSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLK-VVASGG---TVTGDTMVNITVKDLNDNSPHFLQAIESVN------VVENWQAGHSIFQAKAVDPDEGVNGMVLYSL-KQNPKNLFAINEKNGTISLLGPLDV--HAGSYQIEILASDMGVPQLSS 978          

HSP 14 Score: 140.969 bits (354), Expect = 6.373e-33
Identity = 178/679 (26.22%), Postives = 296/679 (43.59%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDRE----KKDLYLIPF--IVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF-YIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN-----FPKSS 2445
            S    + V+++D ND+ P F   +Y  +I E+      I    A D D   NG   YSI     + F   ++ Q+ +++    +D E+ +   +   + ATD G  +   +  + I + D  DN P F     +  + EN+++G  V    AS  D  +NS I Y ++  +G +     F +N  TG L   N +D E   ++ F  + +    G +   T   + VK  D+NDN P  +   ++ ++ EN  +G  +      D DE     +     ++     AI+  +  I  +    V    +     IEI   D   P +     L V + D+NDN P F Q  Y   + E+ P+ +  +++ ASD D+    ++ ++I + N    F I P +G L IK+ +DRE  + +   V  +D     LS    V V + DVNDN P  ++T  T++  E  +    V ++S  D D   NG   +   ++  +  F+L   SG+I      DRE    ++   +  F  I  D G    L   ATV ++++DINDN P F+      K      I   + + T ++ + A+D D   N  + Y + K N      I+S +G++     +D    P  YS+     D+GT  L S     I +   N     FPKS+
Sbjct:  670 SSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRF--QVNAQSGVISTRMALDREEKTA--YQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMD--LNSNISYLIT--TGDQ--KGMFAINQVTGQLTTANVIDRE---EQSFYQLKVVASGGTVTGDTMVNITVK--DLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQ----IEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFP-DGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD--FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFL------KDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPA-YSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKST 1319          

HSP 15 Score: 136.346 bits (342), Expect = 1.855e-31
Identity = 169/675 (25.04%), Postives = 302/675 (44.74%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNG---------VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVA-SDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---NYFTIDPANGILSIKTNIDREEIENFHFEVQ---ITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFV-ALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQD-LNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            S +VT+ + D ND+ P F ++ Y ++  E  E    +    A D D   NG           ++ I+     +F   I K     N+TG   + + +     F++ ++D G      +T + I+I D+NDN P F   +    + +N+ VG+ + +  A  DKD G+NS ++Y +S      +   KF L++ TG + + + +  +  +++ F   V A D G   LS+ ATV + V + N + PE    H + +I E+   G IV T S  D D      +K          I +++     +   +  D E  +   + I+ +D           + V +ID+NDN P F    Y+  + EN P  T V  L+A+D D S  N +    +Q    + F IDP  G+++ +  +D E  +++H  V+   + D  + S  + V +++   N+  P+  + + Y  I+E       V ++  +D D   +G   +  +  S    F++  K+G+I +   LDREK++   +  +  + G+   A     TV++ + D ND  P+F   IY  + S+           P  T +  + A D D +   ++ +Y +   N +    IN +TG+I     +D    P +Y++     D+GTPS T      + L   N
Sbjct: 2855 STDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQ---NVTG---FSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN----DNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDAD-SGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCS-FATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISE---------GVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLP-IYNLSVLAVDSGTPSATGSASLLVTLEDIN 3504          

HSP 16 Score: 134.42 bits (337), Expect = 6.190e-31
Identity = 159/646 (24.61%), Postives = 286/646 (44.27%), Query Frame = 1
Query:  448 IQTIDNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-----RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDS--VD--DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-IQC------NYFTIDPANGILSIKTNIDREEIENFH----FEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIF-YDSPSRTT----IITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            IQ +D+    ++ +  + ++I+DEND+ P F KS   ++++E+     L+    A D DS  N   +YSI    NN     I      + +  K+D+E  +Q L+   + A D G         + IH+ D NDN P+F   +    I+ENI +G+ V    A D D+ +N  + Y++     P+     F ++   G +    ++D E     +F   V A D       R +   + T++V   D+NDNVP  I     +   +   G ++ T    D DE +  +++   Y       D+  VD   G  R+AS  V     ++  +  I    +  P  +K     + II    + P F+Q KY   ++E  PI TNV  + A+    S+     + + ++C        FTI    GI+     +DRE+    +    + ++ +     + +++V + + D+NDN P   T ++   + EN      + QL+  D D+  N   T+   I   +  F++  +SG +I  + LDRE++  Y +  +  D G     ++   ++I + D+ND+ P F            +P++ +D P  T     +  + ATD D   N ++TY +++ +      +N  TG
Sbjct: 1285 IQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSI-TGTNNHGTFSISPNTGSIFLAKKLDFE--TQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTII-QQMPRG--NHFTIDEVKGTIYTNAEIDRE--FANLFELTVKANDQAVPIETRRYALKNVTILV--TDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIE---YEIINGDTDTFIVDRYSGDLRVASALVP----SQLIYNLIVSATDLGPERRK-STTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYT-IISGADDSFRIDPESGDLIATRRLDRERRSKYSL-LVRADDG---LQSSDMRINITVSDVNDHTPKF-----------SRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITG 1896          

HSP 17 Score: 119.013 bits (297), Expect = 3.526e-26
Identity = 119/465 (25.59%), Postives = 203/465 (43.66%), Query Frame = 1
Query: 1012 FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSIT----ENEPSGKIVLTFSFTDLDELSKNQLKCDFYR--------SFGLAI---DSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ------STTLMTYHIAENTQIDQSVAQLSFTDNDK-LENGTFTFKEYIMSNNSPFKLTKS-----GKIILMKHLDREKKDLYLIPFIVYDH-----GNFV-ALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            F +NS+TG L   + +D E+    +   +V+++       +    V V V D+NDN P   V  + SI     E+  SG+ V+  + TD D +  N +    YR         F L I    S +     + S    D E      + +   D   P  +    ++V + DINDN P F  + Y   + E+  + ++V Q++A+D D      + + +  +   F +DP  G+++++  +D E    +   VQ  D G   L+ +++  +++LDVNDN P         T     + EN Q+   VA L+ TD D    NG  + +    +    F++  S       I +   LDRE+   Y +   V D+     G  V A ++ A++ I + DIND+ PVF      S+      +  ++P  + +  + ATD D   NA L Y +   N   +  I+  +G
Sbjct:   81 FAINSSTGALYTTSTIDRESLPSDVINLVVLSSAP-----TYPTEVRVLVRDLNDNAP---VFPDPSIVVTFKEDSSSGRQVILDTATDSD-IGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVF------SQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSG 530          

HSP 18 Score: 113.62 bits (283), Expect = 1.389e-24
Identity = 135/575 (23.48%), Postives = 240/575 (41.74%), Query Frame = 1
Query:  808 TDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNST------TGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP-----QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNK-LNFSIIQCN---YFTID----PANGILSIKTNIDREEIENFHFEVQITD------TGQLSNKSKVYVKIL---DVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKLTKSGKIILM---KHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLD--KTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            T++ + + D NDN P F      +   E+ S G  V    A+D D G N +   S   + G +  + +F L+ T         L LV+K   +  +   +  +V   D G         V V V DINDN P     H    + E+   G  VL  +  D DE +   ++   YR         +D     I   +  D E  R   + +  +D   P +       + ++D+NDN P      F     Y  ++EN  + T V  L+ +D D+   N  ++  I+  N   +F +     P   ++ + + +DRE I +++  V ++D         +  +S V   ++   D+ND+ P  S  +   +++E       V+ +S TD D   N    +   I+S N    F +++   ++       LDRE     ++     D G    + + A + + + D+ND KPVF  P+     G    +  ++P+ T ++ LRATD DL +N  + + L   +T+  SF +++  +G +         +   YS+    +D G+P  +S     + L
Sbjct:  119 TEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNE--AGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIR---YRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYS--IVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKV-SYAQLVVTLLDVNDEKPVFSQPE-----GYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSF-RLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSL 679          

HSP 19 Score: 77.411 bits (189), Expect = 1.521e-13
Identity = 95/362 (26.24%), Postives = 160/362 (44.20%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLL--FATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFY--------RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENL 1542
            V + +   N+ +P F    Y   I E+     I+    A DRD   +G  HY I  N+    F   I+K+   + ++G +D E   +     L   F +  G +  +   ++   + DAND  P F     +++I E + +G+ V    A D DS + S  ++S     G  + +  F +N  TG + +  ++D E     I+   V+A DSG    + SA+++V + DINDN P L V +   + EN+  G +V+T   TD D L  NQ    +Y          F L+   V      +++T+  D E     ++ +   D+  P +     +H+ +ID NDN  Q    + +     NL
Sbjct: 3284 VNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF--QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNV--TVLDANDP-PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDS-IPSWSRFSY--FIGSGNENGAFSINPQTGQITVTAELDRETL--PIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGE-VMENKRPGTLVMTLQSTDPD-LPPNQGPFTYYLLSTGPATSYFSLSTAGV------LSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNL 3627          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 207.994 bits (528), Expect = 2.442e-54
Identity = 209/788 (26.52%), Postives = 361/788 (45.81%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ I + I  N  IG+         IP         ++L++ KT    L+   +  + GEI T     R D + +C  +   +   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP A+D D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + +TD NDN+P F   E  + I EN  VG+ V Q  A+D D G N+ I +S S L    +I+ + F+LN+TTGL+ +   +D E   +     +V+A+D G   +   A V+V V D+NDNVP +    IV+  N    ++EN P    +   + TD D     ++ C         +  V    + + +    D E  +   I++   D   P + +   L + + D NDN P F+Q+     I EN      + ++SA+D D+    ++N+ +       F++D   G+L++   +DRE+ + + F +   D G   L++   V+V I+D NDN+P  T     +++ EN     +V  ++ TD D  +N   T    I+  N  F + +++G I      DREK++ Y   ++  + G  V+ +++A V+I++ D+NDNKPVFI P     + L+ P    +   T +  + A D D   NA++ Y +   N      I+ ETG I       +   G++ +    +D G P
Sbjct:   36 LSGTYIFAVLLVCVVFHSGA---QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVY-KTGDVPLIRIEE--DTGEIFTTGA--RIDREKLCAGIP--RDEHCFYEVEVAILP-------DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS--NIARRLFHLNATTGLITIKEPLDREETPNH--KLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS--ILDENDDFTIDSQTGVIRPNISFDREKQESYTF-YVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP---STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 117.472 bits (293), Expect = 5.063e-26
Identity = 107/392 (27.30%), Postives = 174/392 (44.39%), Query Frame = 1
Query: 1315 FGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-------STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFT-FKEYIMSNNSPFKLTK--SGKIIL--MKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            FGL +    +G  + ++   +  D E      +++   D   P       L V + D NDN+P F + +    I EN P+ T+V QL A+D D  +  K++FS       I    F ++   G+++IK  +DREE  N    V  +D G +  ++ V V + DVNDN P        +    T  ++EN  ++  +A ++ TD D   NG  T F ++ +    PF+L    S + +L    +LD E    Y I  +  D G    L  +A + I ++D NDN PVF      ++  +   I  ++     ++ + ATD D   NA++ Y L       F+ ++  TG +         K   Y       DNG P LTS +  F+ +   N
Sbjct:  217 FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI----PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFS-LDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQN 596          

HSP 3 Score: 105.916 bits (263), Expect = 1.880e-22
Identity = 142/565 (25.13%), Postives = 238/565 (42.12%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYV-----QLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIY---TNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQST 1806
            +I +N    T +  +  T+ +  EN ++ F   SF NLV+ +      LN    + TI++ +DR++  N           L  +  +    P + +           V VN+ D ND++P     +Y +N +       ++L + I  ++ +  +     D ++N     + D + P           +L     +DYE  S + +   L A D G         +FI + D NDN P F     T+ I EN S G  + +  A+D DSG N+ I Y L P + P     +F L+  TG+L +V K+D E   +  + F ++A D+G   L+++ TV V ++D NDN P +  H      + EN P    V   + TD D    + +       +    IDS   G+ R   +  FD E        +   D           + + ++D+NDN P F    Y +  E  LP     T V+Q+ A D D     ++ +SI+  N    F ID   G +++    D  ++      V+  D GQ  +   V +  L VN++   +T
Sbjct:  289 SIPENAPVGTSVTQLHATDADIGENAKIHF---SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHK---------LLVLASDGGLMPARAM-----------VLVNVTDVNDNVPSID-IRYIVNPVNDT----VVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYE--STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPP-----EFSLDRRTGMLTVVKKLDREK--EDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-VFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS-QTGVIRPNIS--FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT 812          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 207.994 bits (528), Expect = 2.756e-54
Identity = 210/789 (26.62%), Postives = 363/789 (46.01%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ I + I  N  IG+         IP         ++L++ KT    L+   +  + GEI  T  +IDR+    +C  +   +   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP A+D D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + +TD NDN+P F   E  + I EN  VG+ V Q  A+D D G N+ I +S S L    +I+ + F+LN+TTGL+ +   +D E   +     +V+A+D G   +   A V+V V D+NDNVP +    IV+  N    ++EN P    +   + TD D     ++ C         +  V    + + +    D E  +   I++   D   P + +   L + + D NDN P F+Q+     I EN      + ++SA+D D+    ++N+ +       F++D   G+L++   +DRE+ + + F +   D G   L++   V+V I+D NDN+P  T     +++ EN     +V  ++ TD D  +N   T    I+  N  F + +++G I      DREK++ Y   ++  + G  V+ +++A V+I++ D+NDNKPVFI P     + L+ P    +   T +  + A D D   NA++ Y +   N      I+ ETG I       +   G++ +    +D G P
Sbjct:   36 LSGTYIFAVLLVCVVFHSGA---QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVY-KTGDVPLIRIEE--DTGEIFTTGARIDRE---KLCAGIP--RDEHCFYEVEVAILP-------DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS--NIARRLFHLNATTGLITIKEPLDREETPNH--KLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS--ILDENDDFTIDSQTGVIRPNISFDREKQESYTF-YVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP---STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 117.472 bits (293), Expect = 5.260e-26
Identity = 107/392 (27.30%), Postives = 174/392 (44.39%), Query Frame = 1
Query: 1315 FGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-------STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFT-FKEYIMSNNSPFKLTK--SGKIIL--MKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            FGL +    +G  + ++   +  D E      +++   D   P       L V + D NDN+P F + +    I EN P+ T+V QL A+D D  +  K++FS       I    F ++   G+++IK  +DREE  N    V  +D G +  ++ V V + DVNDN P        +    T  ++EN  ++  +A ++ TD D   NG  T F ++ +    PF+L    S + +L    +LD E    Y I  +  D G    L  +A + I ++D NDN PVF      ++  +   I  ++     ++ + ATD D   NA++ Y L       F+ ++  TG +         K   Y       DNG P LTS +  F+ +   N
Sbjct:  217 FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI----PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFS-LDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQN 596          

HSP 3 Score: 105.916 bits (263), Expect = 1.826e-22
Identity = 142/565 (25.13%), Postives = 238/565 (42.12%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYV-----QLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIY---TNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQST 1806
            +I +N    T +  +  T+ +  EN ++ F   SF NLV+ +      LN    + TI++ +DR++  N           L  +  +    P + +           V VN+ D ND++P     +Y +N +       ++L + I  ++ +  +     D ++N     + D + P           +L     +DYE  S + +   L A D G         +FI + D NDN P F     T+ I EN S G  + +  A+D DSG N+ I Y L P + P     +F L+  TG+L +V K+D E   +  + F ++A D+G   L+++ TV V ++D NDN P +  H      + EN P    V   + TD D    + +       +    IDS   G+ R   +  FD E        +   D           + + ++D+NDN P F    Y +  E  LP     T V+Q+ A D D     ++ +SI+  N    F ID   G +++    D  ++      V+  D GQ  +   V +  L VN++   +T
Sbjct:  289 SIPENAPVGTSVTQLHATDADIGENAKIHF---SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHK---------LLVLASDGGLMPARAM-----------VLVNVTDVNDNVPSID-IRYIVNPVNDT----VVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYE--STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPP-----EFSLDRRTGMLTVVKKLDREK--EDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-VFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS-QTGVIRPNIS--FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT 812          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 207.608 bits (527), Expect = 3.168e-54
Identity = 210/789 (26.62%), Postives = 363/789 (46.01%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ I + I  N  IG+         IP         ++L++ KT    L+   +  + GEI  T  +IDR+    +C  +   +   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP A+D D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + +TD NDN+P F   E  + I EN  VG+ V Q  A+D D G N+ I +S S L    +I+ + F+LN+TTGL+ +   +D E   +     +V+A+D G   +   A V+V V D+NDNVP +    IV+  N    ++EN P    +   + TD D     ++ C         +  V    + + +    D E  +   I++   D   P + +   L + + D NDN P F+Q+     I EN      + ++SA+D D+    ++N+ +       F++D   G+L++   +DRE+ + + F +   D G   L++   V+V I+D NDN+P  T     +++ EN     +V  ++ TD D  +N   T    I+  N  F + +++G I      DREK++ Y   ++  + G  V+ +++A V+I++ D+NDNKPVFI P     + L+ P    +   T +  + A D D   NA++ Y +   N      I+ ETG I       +   G++ +    +D G P
Sbjct:   25 LSGTYIFAVLLVCVVFHSGA---QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVY-KTGDVPLIRIEE--DTGEIFTTGARIDRE---KLCAGIP--RDEHCFYEVEVAILP-------DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVS--NIARRLFHLNATTGLITIKEPLDREETPNH--KLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS--ILDENDDFTIDSQTGVIRPNISFDREKQESYTF-YVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP---STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 780          

HSP 2 Score: 117.472 bits (293), Expect = 5.163e-26
Identity = 106/386 (27.46%), Postives = 171/386 (44.30%), Query Frame = 1
Query: 1315 FGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLM-------TYHIAENTQIDQSVAQLSFTDNDKLENGTFT-FKEYIMSNNSPFKLTK--SGKIIL--MKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            FGL +    +G  + ++   +  D E      +++   D   P       L V + D NDN+P F + +    I EN P+ T+V QL A+D D  +  K++FS       I    F ++   G+++IK  +DREE  N    V  +D G +  ++ V V + DVNDN P             T  ++EN  ++  +A ++ TD D   NG  T F ++ +    PF+L    S + +L    +LD E    Y I  +  D G    L  +A + I ++D NDN PVF      ++  +   I  ++     ++ + ATD D   NA++ Y L       F+ ++  TG +         K   Y       DNG P LTS +  F+
Sbjct:  206 FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI----PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFS-LDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFV 579          

HSP 3 Score: 105.916 bits (263), Expect = 1.972e-22
Identity = 142/565 (25.13%), Postives = 238/565 (42.12%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYV-----QLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIY---TNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQST 1806
            +I +N    T +  +  T+ +  EN ++ F   SF NLV+ +      LN    + TI++ +DR++  N           L  +  +    P + +           V VN+ D ND++P     +Y +N +       ++L + I  ++ +  +     D ++N     + D + P           +L     +DYE  S + +   L A D G         +FI + D NDN P F     T+ I EN S G  + +  A+D DSG N+ I Y L P + P     +F L+  TG+L +V K+D E   +  + F ++A D+G   L+++ TV V ++D NDN P +  H      + EN P    V   + TD D    + +       +    IDS   G+ R   +  FD E        +   D           + + ++D+NDN P F    Y +  E  LP     T V+Q+ A D D     ++ +SI+  N    F ID   G +++    D  ++      V+  D GQ  +   V +  L VN++   +T
Sbjct:  278 SIPENAPVGTSVTQLHATDADIGENAKIHF---SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHK---------LLVLASDGGLMPARAM-----------VLVNVTDVNDNVPSID-IRYIVNPVNDT----VVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYE--STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPP-----EFSLDRRTGMLTVVKKLDREK--EDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-VFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS-QTGVIRPNIS--FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT 801          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 196.823 bits (499), Expect = 1.080e-50
Identity = 169/599 (28.21%), Postives = 296/599 (49.42%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIM--SNNSP----FKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL 2250
            V + ++D ND+ P F    Y++ I+E+   P ++   KA D D   NG  HYS+ ++ + +  + ID     + +  +ID ++S       ++ A D           + I++ D ND+ P     +K I + EN+++G  V +  A D+DSG N +IKYS+         S  F ++  +GL+K    +D E      ++  V A D G   L+TS T+ V + DINDN P     + N +I+E  P G  ++T    D DE  K   + +   R     +D  D G     S ++   +      +EI+  D     ++    ++V I D+N + P F+   +  +I E+ PI   V  L A D D  D  ++ +SI    +F IDP++G +S+ +++DRE+   F   V  +D     L+  +++ V + D+NDN+PQ +++     I+E+  +  S  Q+S  D D   NG     +Y +  S++SP    F+L + SG + +   LDRE+  + ++P    D G   +L+  + +++ + D+NDN P F    E+  + L   I  +SP  +T+ T+ A D D  +NA +++R+
Sbjct:  361 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-SGIGGLTIDYSTGEVTLRERIDAKNSP---ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-------SEDFIIDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHK--VRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV---DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAASEITLTLSDVNDNAPTF----EQLSYDLY--IAENSPVGSTVGTIVARDADEGDNADISFRI 931          

HSP 2 Score: 182.57 bits (462), Expect = 3.290e-46
Identity = 175/665 (26.32%), Postives = 299/665 (44.96%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY-----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNAS---SFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +IS S  V V+++D  D+ P F+K  Y   I E       +L   A D DS  NG   YS+ + N  NL    I+ ++ ++     +D E  S  L    + A+D G  + +    + I + D NDN P F      + ILENI++ +++    A+D+D G N  + YS++  SG   ++  +    +TG + L  ++D +N      T ++ A D  +  LS++  + + V+DIND+ P LI  Q   ++ EN   G+ V      D D      +K     S    ID  D G+  I +T++ D E      +++   D  +P +     + V + DINDN P F + +Y   I E +P  + +  L A  +DN +  K+ + I + +        I     ILS+   + R++      E+  TD G L  +  V V I DVN     +    +  I E++ I   V  L   D+D+ +N       Y + ++  F++   SG I +   LDRE +  + +     DH +   L T+  + + + DINDN P F      +       I  D P  T+ + + A D D+  N  + Y L+++++S      +++  +G +         +  +  +     D GTPSL++  E  + LS  N
Sbjct:  249 TISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLA--INAKSGVIQTAAPLDRETLS--LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY----STGEVTLRERIDAKN---SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-DSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKA--VDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV---YSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHAS-PPLNTSTQIEVILDDINDNSPQF------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVN 886          

HSP 3 Score: 155.606 bits (392), Expect = 6.404e-38
Identity = 155/640 (24.22%), Postives = 273/640 (42.66%), Query Frame = 1
Query:  535 FQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSI----DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            FQ+ KY   + E  + P+  +  ++      +   +YS+    D+   NLF   +D  +  + +   +D E   + +     +   D        T + +H+ D  DN P F+      EI E+  +G+ V    A D DSG N  I+YSL   +G   ++    +N+ +G+++    +D E     +    VIA+D G     ++A V + V+D+NDN P       N +I EN     ++ T   TD D  +  ++      S G+   ++D     +   +  DA+ +    + I   D A P +     L + +IDIND+ P    A+    +EEN+ I   V ++ A D D+     + +S+     F ID  +G++     +DRE    +  +V   D G   L+  + + V + D+NDNAP          I+E       +  L   DND+ +  T+  +E      S   +   G I+ +    + +     +     D G    L     V++ I D+N + P F      + H     I   SP    +ITL+A D D  +NA++ Y +D   +S F +I+  +G+I             +S+  T SD+ +P L +  +  ++L   N
Sbjct:  165 FQQEKYVKELPE--DTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFT--LDTMSGEIRLAKSMDREVLDKHILKVTAYERVD--PTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLA----INAKSGVIQTAAPLDRETL--SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG---GLQGRCVVNVFIDDVN-SAPYF------NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDIN 778          

HSP 4 Score: 146.362 bits (368), Expect = 4.284e-35
Identity = 173/691 (25.04%), Postives = 303/691 (43.85%), Query Frame = 1
Query:  145 IGISNDATIYSHKSFNIS--DNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTI----DNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIE----SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGS--IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQL-----KCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNF------SIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSG------KIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF 2115
            + ++++A +++  S+N++  +NI     I  +  T+++   N ++ +   S   +       + GE+ T+R  +R D KN                     SPI  +    D  Q ++S +V +T+N+ID ND  P    ++  I + E      E   +    AID DS  NG+  YS++ + +  FI  ID+ + ++  T  +D E +++  +   + A D G       T I + + D NDN P FD KE  + I E +  GS  I  + V +D+D  +   I+ +   +     I  +  + S +G LK   + D++  ++      + ATD G L       V +   D+N + P    H  +  I E+ P G  V+T    D D     ++        F+R        +D     I+ +   D E      + +   D+ASP +     + V + DINDN PQF+ + Y   I E++P+ T+  Q+SA D D      +++      S      F +D  +G L + + +DRE+       +   D G   LS  S++ + + DVNDNAP    L    +IAEN+ +  +V  +   D D+ +N   +F+ +  ++   F + +        +I+     D E K      F      +   L++T  V IH+ D+NDNKP  
Sbjct:  366 VDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEV-TLR--ERIDAKN---------------------SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDEDSGPNGIIKYSMEGSED--FI--IDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK---RQDHKVRVE------ISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--------IDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAK---ANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 1000          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 196.438 bits (498), Expect = 1.380e-50
Identity = 169/599 (28.21%), Postives = 296/599 (49.42%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIM--SNNSP----FKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL 2250
            V + ++D ND+ P F    Y++ I+E+   P ++   KA D D   NG  HYS+ ++ + +  + ID     + +  +ID ++S       ++ A D           + I++ D ND+ P     +K I + EN+++G  V +  A D+DSG N +IKYS+         S  F ++  +GL+K    +D E      ++  V A D G   L+TS T+ V + DINDN P     + N +I+E  P G  ++T    D DE  K   + +   R     +D  D G     S ++   +      +EI+  D     ++    ++V I D+N + P F+   +  +I E+ PI   V  L A D D  D  ++ +SI    +F IDP++G +S+ +++DRE+   F   V  +D     L+  +++ V + D+NDN+PQ +++     I+E+  +  S  Q+S  D D   NG     +Y +  S++SP    F+L + SG + +   LDRE+  + ++P    D G   +L+  + +++ + D+NDN P F    E+  + L   I  +SP  +T+ T+ A D D  +NA +++R+
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-SGIGGLTIDYSTGEVTLRERIDAKNSP---ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-------SEDFIIDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHK--VRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIV---DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT-PSLSAASEITLTLSDVNDNAPTF----EQLSYDLY--IAENSPVGSTVGTIVARDADEGDNADISFRI 572          

HSP 2 Score: 154.066 bits (388), Expect = 1.882e-37
Identity = 142/549 (25.87%), Postives = 247/549 (44.99%), Query Frame = 1
Query:  814 IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY-----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNAS---SFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            + I + D NDN P F      + ILENI++ +++    A+D+D G N  + YS++  SG   ++  +    +TG + L  ++D +N      T ++ A D  +  LS++  + + V+DIND+ P LI  Q   ++ EN   G+ V      D D      +K     S    ID  D G+  I +T++ D E      +++   D  +P +     + V + DINDN P F + +Y   I E +P  + +  L A  +DN +  K+ + I + +        I     ILS+   + R++      E+  TD G L  +  V V I DVN     +    +  I E++ I   V  L   D+D+ +N       Y + ++  F++   SG I +   LDRE +  + +     DH +   L T+  + + + DINDN P F      +       I  D P  T+ + + A D D+  N  + Y L+++++S      +++  +G +         +  +  +     D GTPSL++  E  + LS  N
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY----STGEVTLRERIDAKN---SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-DSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKA--VDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIV---YSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHAS-PPLNTSTQIEVILDDINDNSPQF------TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVN 527          

HSP 3 Score: 146.362 bits (368), Expect = 4.899e-35
Identity = 173/691 (25.04%), Postives = 303/691 (43.85%), Query Frame = 1
Query:  145 IGISNDATIYSHKSFNIS--DNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTI----DNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIE----SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGS--IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQL-----KCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNF------SIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSG------KIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF 2115
            + ++++A +++  S+N++  +NI     I  +  T+++   N ++ +   S   +       + GE+ T+R  +R D KN                     SPI  +    D  Q ++S +V +T+N+ID ND  P    ++  I + E      E   +    AID DS  NG+  YS++ + +  FI  ID+ + ++  T  +D E +++  +   + A D G       T I + + D NDN P FD KE  + I E +  GS  I  + V +D+D  +   I+ +   +     I  +  + S +G LK   + D++  ++      + ATD G L       V +   D+N + P    H  +  I E+ P G  V+T    D D     ++        F+R        +D     I+ +   D E      + +   D+ASP +     + V + DINDN PQF+ + Y   I E++P+ T+  Q+SA D D      +++      S      F +D  +G L + + +DRE+       +   D G   LS  S++ + + DVNDNAP    L    +IAEN+ +  +V  +   D D+ +N   +F+ +  ++   F + +        +I+     D E K      F      +   L++T  V IH+ D+NDNKP  
Sbjct:    7 VDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEV-TLR--ERIDAKN---------------------SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDEDSGPNGIIKYSMEGSED--FI--IDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELK---RQDHKVRVE------ISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--------IDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAK---ANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 641          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 146.747 bits (369), Expect = 3.379e-35
Identity = 161/615 (26.18%), Postives = 280/615 (45.53%), Query Frame = 1
Query:  490 NVTVNII--DENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNL-FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKE-KTIEILENISVGSIVYQFVASDKDSG-VNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFID-RIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITEN-EP---SGKIVLTFSFTDLDELSKNQLKCDF--YRSF---GLAIDSVDDGIYRIASTQVFDAEFN--RFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD-NSDVNKLNFSIIQCN---YFTIDPAN-----GILSIKTNIDREEI---ENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP---FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY--DSP-SRTTIITLRATDQDLNE 2226
            NV V I+  D ND+ P F++ KY   + ES  E   ++  KA D D   N +R++ I      + F V  D  +  + +   +D+E S Q  +H +L A+D   N     T+++IHI D NDN P F+ ++  T  I E++ +  +++   A+D D    +S I Y L      +     F +   +G ++LV  +D +       + F+V A D     L   A V V V DINDN P         I EN EP    G   +     D D+ +      ++   R+    G ++  +D    +I + +  D E +  R   IE+   D   P  +   ++ + + D+NDN P F + +Y   +EE  PI   V   SA D D  +  N   + + + +   Y T D  +     G+L +K  +D E++   + FH  ++++D G+   ++ V+V ++D ND+AP       + + E+     S+ + + TD D  +   F     I   + P   F + + G + +   LDRE   +Y +    YD+ N +       V++++QD+NDN P          + + +P  +  ++P ++     +RATD+D  E
Sbjct: 1318 NVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN-LRYHLIGAGGGRIPFGVRTD--SGTIFVKEPLDFEASDQ--YHLVLIASDGRHN---ATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE----GQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-GRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARF----RINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIG---RQMVAVYLQDVNDNGP--------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAE 1904          

HSP 2 Score: 118.242 bits (295), Expect = 2.122e-26
Identity = 147/581 (25.30%), Postives = 256/581 (44.06%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESN-EFPLILL---PKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQ-RLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYP-----NFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSL--SPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKN-----QLKCD---FYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCW-IEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN--KLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI-AENTQIDQ-SVAQLSFTDNDKLENG---------TFTFKEY--IMSNNSPFKLTKSGKIILMKHLDREK---KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDN 2103
            + NV ++I D ND+ P F++ KY   +IE + + P +L        D+D   + + +       + +F   I K +  + +   +D +  +    ++F++ A DD  N      D+ +++ D NDN P      F + E+  E + +  V  +  Q    D  +  N+ I+Y +  + L   +S+   F ++  TG +  +  +D E   +R F   V A D G       A V +KV D+NDN P  E   ++  S+ E  P G  V++FS  D DE +K+     QL  +   FY +          G+ R+     ++    R  + + I   D           +HV ++D ND+ P    A  +  + E++P  T++ + +A+D D  D    ++N        FTID  +G L +   +DRE+I  ++  ++  D      +  V V + DVNDN P+  T+    I  ENT ++Q    ++  TD D  E G         +F + +Y  ++ N +      S  I  ++  DRE      +  IP I+ D          A+V + I D+NDN
Sbjct: 1419 TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVF--RIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESV---FRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYE-GSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADR---AGRRNEASVHVIIGDLNDN 1985          

HSP 3 Score: 115.161 bits (287), Expect = 1.826e-25
Identity = 174/714 (24.37%), Postives = 315/714 (44.12%), Query Frame = 1
Query:  496 TVNIIDENDSLPFFQKSKYDINI--IESNEFPLILLPKAIDRDSLVNGVRHYSID-------NNYNNL-FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFK---EKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSIST-------KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-----NNSITENE----PSGKIVLTFSFTDLD-ELSKNQLKCDFYRSFGLAIDS------VDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPII-------KKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ--STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGT-FTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIP---FIVY---DHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLI----KPIFYDSPSRTTIITLRATDQD--LNENAKLTYRLDKT---NASSFTKINSETGEIYFFY-IDM-IPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +V ++D ND+ P F++  Y+ ++   E+    +I +  A D D+  N    YS++        + N+L F   +++++  + +   I  +  +Q+ F F + A D+G+ E  +    + +++ D     P +      +  I + EN+ +  ++ +  A       NS + Y L+   GP + +        KF   +    + ++  +DYE   +  +T  + ATD     ++++ T +V+V D+ND VP+  V       +  +T NE     +GK ++T    D D +  +N++    YR  G A         +D+    I   + FD E      + +   D +   +       K    + + I D+NDN P F + KY   ++E+     +V  + A DLD    + L + +I        F +   +G + +K  +D E  + +H  V I   G+ +  + VY+ I DVNDNAPQ       T  I E+  I + +  +  TD D+ E  +   ++      +  F++ K SG I L+K LDR+      +P   F+V    D GN   L   A V ++++DINDN P+F     +   G I    +PI  D       + ++A D D    ENA + Y + +    N  S  +I+  TG+I+    +D  I     + I+   +D G PS   +    I ++  N
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITV-FAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNN--YTLTLTATDMTS-RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEV---HYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKH--SNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHL-VLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPP--AGVPSWNFVVQAIDDDGN--GLVGYADVQVNVRDINDNSPIF----PERLFGYIEENREPIHSDG---VYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMN 1655          

HSP 4 Score: 97.8265 bits (242), Expect = 3.419e-20
Identity = 126/506 (24.90%), Postives = 209/506 (41.30%), Query Frame = 1
Query:  448 IQTIDN-FQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL----------------------ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKD-SGVNSLIKYSLSPLSGPKSIST-KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLK----CDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPI-YTNVYQLSASDLDNSDVN-----KLNFSIIQCNYFTI------DPANGILSIK--TNIDREE-IENFHFEVQ--ITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI 1827
            +Q ID+    +    +V VN+ D ND+ P F +  +    IE N  P+                        +   I R+ L+NG   + ID N   +F +              +D E SS+R F   + A D G+   +   ++ I +TD NDN P F+       + E   +G+ V  F A D D    +++  Y LS  S    ++T K    S+ G+L++   +DYE+   R    + I    GR      A V V ++D ND+ P +     + + E+ P G  +  ++ TD D     + +     D  R F   ID   DG  R+A T   D E      + I   DN++ I +++  ++  + D+NDN P+           EN P+      ++ A+D D ++       +++ S     Y  +      D  NG ++I      DRE  +     E+   + D     N++ V+V I D+NDN       MT H+
Sbjct: 1516 VQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLF--GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR------------SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR--HDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQF--TIDQ--DGTLRVAHT--LDREDIAVYNLIIEAYDNSNNIGRQMVAVY--LQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDNT-MHDGRMTIHV 1996          

HSP 5 Score: 91.6633 bits (226), Expect = 2.685e-18
Identity = 153/610 (25.08%), Postives = 258/610 (42.30%), Query Frame = 1
Query:  784 GLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILE----NISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSI----STKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDI-NDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYR--IASTQVFDAEFNRFCWIEIN----------CLDNASPIIKKLFHLHVP---------------IIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFH----FEVQITDTGQ---LSNKSKVYVKILDVNDNAP--QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLE--------NGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVAL-----TTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY--DSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTK--INSETGEI-----YFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            GL   + +T I IH+ D  D  P+F      + +L     N ++G IVYQFVA D+    +S + Y        K+I    +  F ++  +G+++      YE      +     A D      +TS    V +++I  D  P     Q   +T +E +   ++ +S  D        +K   +RSF       +DG  +  I  +   D   +   W  I+           LD   P + KL  L V                I D+NDN P F++  Y  ++ E++P+   + +++A D D  D +++ +S+   N F+I+ +NG +S K  +D +++   H    F V   D G+   LS+ + ++++  + ND +     T+  T  +AE+ Q    V Q+   D D+ E        NG  T K  + S +    L K    +    L   +  + L   IV D G+         T+ AT+ I I+D+N+NKP F    + S    I    Y  D P   TI+ + ATD D + N  + Y L  T + S     I+ +TG +       F  +  P+  + ++KAT  D G   L  + +F +
Sbjct:  400 GLQSTRTQT-IRIHVADI-DEPPSF--VNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLY--------KTIDVIPAGSFIVDPKSGVVR-TGWSKYER--GDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDN---LVDYSVVD--------VKAQSFRSF-------EDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-FSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLT-VIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP---TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDV-TVKAT--DRGDRPLIGFCQFSV 967          

HSP 6 Score: 87.4261 bits (215), Expect = 5.727e-17
Identity = 135/584 (23.12%), Postives = 244/584 (41.78%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESN--EFPLILLPKAIDR---DSLVNGVRHYSI--DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDR--IFTFIVIATDSGR-LHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-----SVDD--GIYR----IASTQVFDAE----FNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVY--------QLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNI--DREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--------FKLT--KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF 2115
            P F K +Y++ + E N  ++ ++ +     R   D    G   YS+  D   +      ID    I+++T  +D++D +    H L     +   E     D+ I I D NDN P F     T ++ E+I +   + +  A DKD+G NS I YS+         +  F +NS  G +    ++D +   +R  ++ F V A D G  + LS+SA + ++  + ND     +     +  + E+   G  V+     D D   ++++   F    G +       S+D+  G+ +    +++  + +AE           + +C    S        L + I D+N+N P+F     Y +I +   I    Y        ++ A+D D+S    + +S+          F ID   G+L+   ++  DRE        V+ TD G   L    +  V+++D+NDN+PQ         ++    +  SV  +   DND   N   T+   I +            F+L   +SG+I L+K +   K   ++   I  D+G   AL ++A V++++ D     P +
Sbjct:  528 PQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRE--SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD--------NHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK---IMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW 1093          

HSP 7 Score: 74.7146 bits (182), Expect = 3.908e-13
Identity = 152/688 (22.09%), Postives = 278/688 (40.41%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQR--LFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDF---KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDR--IFTFIVIATDSG-------RLHLSTSATVIVKVMDINDNVPEL--------IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS-----FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-----------QCNYFT-IDPANGILSIKTNIDREEIENFHFEVQITDTG---QLSNKSKVYVKILDVNDNAPQSTTLMTYH----IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSG--------------KIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF------------IYPKEKSKHGLIKPIFYDSPSRTTIITLRA--TDQDLNENAKLTYRLDKTNASSFTK---INSETGEIY 2307
            V++T+ I D ND++P F +  Y   + E  + PL   IL   A+D+D+  N    YS+DN+    F +  + +   ++   ++D +  ++R  ++ F + A D G       +   IHI   N N  +  F    + T  + E+   G+ V Q  A D D      + YS    +G  +     F ++  TGL+KL + V   +  +        VI  D G       + H S  AT+++ + D+N+N PE         I        + +P    ++    TD D  +   +    Y +         ID    G+   +   VFD E      + +   D     +       V ++DINDN PQF +  Y   +     + T+V  + A D D +   ++ +S+              ++F  ++  +G +++   I   + + F F V   D G    L + ++V + +LD    AP+  T         + EN ++++ + +     +    N    +K  + ++  P    +S               ++++M+ LD E+ + Y +     D  + VA  +T T  + ++D+ND  P F            + P E  +    KP          I+T++A  TD D  +N ++ YR+        TK   I+  TGEI+
Sbjct:  626 VDLTIRIDDVNDNVPTFTRPLYTAQVRE--DIPLNQTILKVTAVDKDTGDNSRITYSVDNHN---FSINSNGE---ISAKVRLDADQLNERHFVYRFNVTARDHG-EPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSY-ATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP--TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDR-QTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYK--LTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVA--STKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKP----------IVTVKAIDTDSDGPQN-EVHYRIVGEANGEETKHFRIDELTGEIF 1281          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 146.747 bits (369), Expect = 3.379e-35
Identity = 161/615 (26.18%), Postives = 280/615 (45.53%), Query Frame = 1
Query:  490 NVTVNII--DENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNL-FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKE-KTIEILENISVGSIVYQFVASDKDSG-VNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFID-RIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITEN-EP---SGKIVLTFSFTDLDELSKNQLKCDF--YRSF---GLAIDSVDDGIYRIASTQVFDAEFN--RFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD-NSDVNKLNFSIIQCN---YFTIDPAN-----GILSIKTNIDREEI---ENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP---FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY--DSP-SRTTIITLRATDQDLNE 2226
            NV V I+  D ND+ P F++ KY   + ES  E   ++  KA D D   N +R++ I      + F V  D  +  + +   +D+E S Q  +H +L A+D   N     T+++IHI D NDN P F+ ++  T  I E++ +  +++   A+D D    +S I Y L      +     F +   +G ++LV  +D +       + F+V A D     L   A V V V DINDN P         I EN EP    G   +     D D+ +      ++   R+    G ++  +D    +I + +  D E +  R   IE+   D   P  +   ++ + + D+NDN P F + +Y   +EE  PI   V   SA D D  +  N   + + + +   Y T D  +     G+L +K  +D E++   + FH  ++++D G+   ++ V+V ++D ND+AP       + + E+     S+ + + TD D  +   F     I   + P   F + + G + +   LDRE   +Y +    YD+ N +       V++++QD+NDN P          + + +P  +  ++P ++     +RATD+D  E
Sbjct: 1318 NVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN-LRYHLIGAGGGRIPFGVRTD--SGTIFVKEPLDFEASDQ--YHLVLIASDGRHN---ATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLE----GQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-GRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARF----RINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIG---RQMVAVYLQDVNDNGP--------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAE 1904          

HSP 2 Score: 118.242 bits (295), Expect = 2.122e-26
Identity = 147/581 (25.30%), Postives = 256/581 (44.06%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESN-EFPLILL---PKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQ-RLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYP-----NFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSL--SPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKN-----QLKCD---FYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCW-IEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN--KLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI-AENTQIDQ-SVAQLSFTDNDKLENG---------TFTFKEY--IMSNNSPFKLTKSGKIILMKHLDREK---KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDN 2103
            + NV ++I D ND+ P F++ KY   +IE + + P +L        D+D   + + +       + +F   I K +  + +   +D +  +    ++F++ A DD  N      D+ +++ D NDN P      F + E+  E + +  V  +  Q    D  +  N+ I+Y +  + L   +S+   F ++  TG +  +  +D E   +R F   V A D G       A V +KV D+NDN P  E   ++  S+ E  P G  V++FS  D DE +K+     QL  +   FY +          G+ R+     ++    R  + + I   D           +HV ++D ND+ P    A  +  + E++P  T++ + +A+D D  D    ++N        FTID  +G L +   +DRE+I  ++  ++  D      +  V V + DVNDN P+  T+    I  ENT ++Q    ++  TD D  E G         +F + +Y  ++ N +      S  I  ++  DRE      +  IP I+ D          A+V + I D+NDN
Sbjct: 1419 TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVF--RIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESV---FRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYE-GSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTID-QDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADR---AGRRNEASVHVIIGDLNDN 1985          

HSP 3 Score: 115.161 bits (287), Expect = 1.826e-25
Identity = 174/714 (24.37%), Postives = 315/714 (44.12%), Query Frame = 1
Query:  496 TVNIIDENDSLPFFQKSKYDINI--IESNEFPLILLPKAIDRDSLVNGVRHYSID-------NNYNNL-FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFK---EKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSIST-------KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-----NNSITENE----PSGKIVLTFSFTDLD-ELSKNQLKCDFYRSFGLAIDS------VDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPII-------KKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ--STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGT-FTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIP---FIVY---DHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLI----KPIFYDSPSRTTIITLRATDQD--LNENAKLTYRLDKT---NASSFTKINSETGEIYFFY-IDM-IPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +V ++D ND+ P F++  Y+ ++   E+    +I +  A D D+  N    YS++        + N+L F   +++++  + +   I  +  +Q+ F F + A D+G+ E  +    + +++ D     P +      +  I + EN+ +  ++ +  A       NS + Y L+   GP + +        KF   +    + ++  +DYE   +  +T  + ATD     ++++ T +V+V D+ND VP+  V       +  +T NE     +GK ++T    D D +  +N++    YR  G A         +D+    I   + FD E      + +   D +   +       K    + + I D+NDN P F + KY   ++E+     +V  + A DLD    + L + +I        F +   +G + +K  +D E  + +H  V I   G+ +  + VY+ I DVNDNAPQ       T  I E+  I + +  +  TD D+ E  +   ++      +  F++ K SG I L+K LDR+      +P   F+V    D GN   L   A V ++++DINDN P+F     +   G I    +PI  D       + ++A D D    ENA + Y + +    N  S  +I+  TG+I+    +D  I     + I+   +D G PS   +    I ++  N
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITV-FAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNN--YTLTLTATDMTS-RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEV---HYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKH--SNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHL-VLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPP--AGVPSWNFVVQAIDDDGN--GLVGYADVQVNVRDINDNSPIF----PERLFGYIEENREPIHSDG---VYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMN 1655          

HSP 4 Score: 97.8265 bits (242), Expect = 3.419e-20
Identity = 126/506 (24.90%), Postives = 209/506 (41.30%), Query Frame = 1
Query:  448 IQTIDN-FQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL----------------------ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKD-SGVNSLIKYSLSPLSGPKSIST-KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLK----CDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPI-YTNVYQLSASDLDNSDVN-----KLNFSIIQCNYFTI------DPANGILSIK--TNIDREE-IENFHFEVQ--ITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI 1827
            +Q ID+    +    +V VN+ D ND+ P F +  +    IE N  P+                        +   I R+ L+NG   + ID N   +F +              +D E SS+R F   + A D G+   +   ++ I +TD NDN P F+       + E   +G+ V  F A D D    +++  Y LS  S    ++T K    S+ G+L++   +DYE+   R    + I    GR      A V V ++D ND+ P +     + + E+ P G  +  ++ TD D     + +     D  R F   ID   DG  R+A T   D E      + I   DN++ I +++  ++  + D+NDN P+           EN P+      ++ A+D D ++       +++ S     Y  +      D  NG ++I      DRE  +     E+   + D     N++ V+V I D+NDN       MT H+
Sbjct: 1516 VQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLF--GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMR------------SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR--HDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQF--TIDQ--DGTLRVAHT--LDREDIAVYNLIIEAYDNSNNIGRQMVAVY--LQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDNT-MHDGRMTIHV 1996          

HSP 5 Score: 91.6633 bits (226), Expect = 2.685e-18
Identity = 153/610 (25.08%), Postives = 258/610 (42.30%), Query Frame = 1
Query:  784 GLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILE----NISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSI----STKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDI-NDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYR--IASTQVFDAEFNRFCWIEIN----------CLDNASPIIKKLFHLHVP---------------IIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFH----FEVQITDTGQ---LSNKSKVYVKILDVNDNAP--QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLE--------NGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVAL-----TTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY--DSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTK--INSETGEI-----YFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            GL   + +T I IH+ D  D  P+F      + +L     N ++G IVYQFVA D+    +S + Y        K+I    +  F ++  +G+++      YE      +     A D      +TS    V +++I  D  P     Q   +T +E +   ++ +S  D        +K   +RSF       +DG  +  I  +   D   +   W  I+           LD   P + KL  L V                I D+NDN P F++  Y  ++ E++P+   + +++A D D  D +++ +S+   N F+I+ +NG +S K  +D +++   H    F V   D G+   LS+ + ++++  + ND +     T+  T  +AE+ Q    V Q+   D D+ E        NG  T K  + S +    L K    +    L   +  + L   IV D G+         T+ AT+ I I+D+N+NKP F    + S    I    Y  D P   TI+ + ATD D + N  + Y L  T + S     I+ +TG +       F  +  P+  + ++KAT  D G   L  + +F +
Sbjct:  400 GLQSTRTQT-IRIHVADI-DEPPSF--VNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLY--------KTIDVIPAGSFIVDPKSGVVR-TGWSKYER--GDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDN---LVDYSVVD--------VKAQSFRSF-------EDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-FSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLT-VIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP---TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDV-TVKAT--DRGDRPLIGFCQFSV 967          

HSP 6 Score: 87.4261 bits (215), Expect = 5.727e-17
Identity = 135/584 (23.12%), Postives = 244/584 (41.78%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESN--EFPLILLPKAIDR---DSLVNGVRHYSI--DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDR--IFTFIVIATDSGR-LHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-----SVDD--GIYR----IASTQVFDAE----FNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVY--------QLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNI--DREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--------FKLT--KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF 2115
            P F K +Y++ + E N  ++ ++ +     R   D    G   YS+  D   +      ID    I+++T  +D++D +    H L     +   E     D+ I I D NDN P F     T ++ E+I +   + +  A DKD+G NS I YS+         +  F +NS  G +    ++D +   +R  ++ F V A D G  + LS+SA + ++  + ND     +     +  + E+   G  V+     D D   ++++   F    G +       S+D+  G+ +    +++  + +AE           + +C    S        L + I D+N+N P+F     Y +I +   I    Y        ++ A+D D+S    + +S+          F ID   G+L+   ++  DRE        V+ TD G   L    +  V+++D+NDN+PQ         ++    +  SV  +   DND   N   T+   I +            F+L   +SG+I L+K +   K   ++   I  D+G   AL ++A V++++ D     P +
Sbjct:  528 PQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRE--SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD--------NHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK---IMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW 1093          

HSP 7 Score: 74.7146 bits (182), Expect = 3.908e-13
Identity = 152/688 (22.09%), Postives = 278/688 (40.41%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQR--LFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDF---KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDR--IFTFIVIATDSG-------RLHLSTSATVIVKVMDINDNVPEL--------IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS-----FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-----------QCNYFT-IDPANGILSIKTNIDREEIENFHFEVQITDTG---QLSNKSKVYVKILDVNDNAPQSTTLMTYH----IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSG--------------KIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF------------IYPKEKSKHGLIKPIFYDSPSRTTIITLRA--TDQDLNENAKLTYRLDKTNASSFTK---INSETGEIY 2307
            V++T+ I D ND++P F +  Y   + E  + PL   IL   A+D+D+  N    YS+DN+    F +  + +   ++   ++D +  ++R  ++ F + A D G       +   IHI   N N  +  F    + T  + E+   G+ V Q  A D D      + YS    +G  +     F ++  TGL+KL + V   +  +        VI  D G       + H S  AT+++ + D+N+N PE         I        + +P    ++    TD D  +   +    Y +         ID    G+   +   VFD E      + +   D     +       V ++DINDN PQF +  Y   +     + T+V  + A D D +   ++ +S+              ++F  ++  +G +++   I   + + F F V   D G    L + ++V + +LD    AP+  T         + EN ++++ + +     +    N    +K  + ++  P    +S               ++++M+ LD E+ + Y +     D  + VA  +T T  + ++D+ND  P F            + P E  +    KP          I+T++A  TD D  +N ++ YR+        TK   I+  TGEI+
Sbjct:  626 VDLTIRIDDVNDNVPTFTRPLYTAQVRE--DIPLNQTILKVTAVDKDTGDNSRITYSVDNHN---FSINSNGE---ISAKVRLDADQLNERHFVYRFNVTARDHG-EPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSY-ATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP--TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDR-QTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYK--LTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVA--STKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKP----------IVTVKAIDTDSDGPQN-EVHYRIVGEANGEETKHFRIDELTGEIF 1281          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 129.798 bits (325), Expect = 5.839e-30
Identity = 185/736 (25.14%), Postives = 300/736 (40.76%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKE-ALENYQLLFGKTSFRNLVNYVQLNNK-GEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDK-----QAPILNITGKIDYEDSSQRLFHFLLFATDDG----LNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPK----SISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDG-IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPS-RTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            F + ++ Q  T IG I    +E A   Y ++F          +++++ + GEI TI  +D +             IV  +++                   ++++ V + DEND+ P F      + I E  +      LP   D D     V  + I   N NN+F +   K     QA ++ + G++D E   +  +  L+ A D G    + + +C     I I DANDN P F     T  +  NIS+GS +    A+D D G NS I Y +   S P     +IS    + +T  LL                  IV+A+D G   LS+SA V + V+    + P L    +V  N++ + EN   G IV   S            K     S  L     D   +Y +    + D E      ++   L+    II +   L + I DINDN PQ+  ++ +  +            L+A D D      + +S++     +ID   G + +   ID        F V+  D G   LS   +V   +LD     PQ    L    I E+T I   + ++   +N +  N       Y + N        T SG + + K  D EK+  Y    I     N  + T+T+ +SI ++D+NDN P+F YP E   H  ++    + P     ++ + A+D D     +++Y +  + +SSF+ IN  TGE++
Sbjct:   29 FTVPESAQIGTRIGWISGKREESAAPKYFVVFPD---EQTSKFLKVDERSGEISTIAHLDYEKRSKF-------DIVAVKVE---------------ESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLV-VNGQLDREFRDK--YELLIEAQDGGKPAKIGQLRCS----IEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPA-----------STHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQ----QYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKF-LLEKDGQIIIEHPQL-LTIGDINDNAPQWHSSQIHISLNRT---QGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKV-VANNSQCGNSKRI--RYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIAT---NANSETSTSLISIRLKDVNDNWPIF-YPNE--YHLTVR----EGPKPEEPLLVVSASDMDSGTFGEVSYHI-LSESSSFS-INPVTGEVF 697          

HSP 2 Score: 114.39 bits (285), Expect = 3.216e-25
Identity = 127/531 (23.92%), Postives = 233/531 (43.88%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESN--EFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQR-LFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD---FKEKTIE-ILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSF-----TDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHG 2040
            +++ + D ND+ P F  ++Y + + E    E PL+++  A D DS   G   Y I +  ++  I           +TG++  +    R  FH ++ A D G    +   +I I + D +   P F    ++ +T E IL  I++GS+           G  S +KYS+   SG +     F ++  TG + +   +D  +  D +   I     SG    S    V++ + D NDN P+     ++S+ E      + L   F     +D D+    +++     S   +   +D    ++++  + D E  R   + +   D   P       L + ++D+NDN P+F ++ Y  E+ EN P  T V ++ A D D+ +  ++ + I   + YF ID   G +  K +IDRE I +    +   D G    S+ +   + +LDVNDN P   ++    +   + +  ++  +   D DK  NG+  ++  + S  S F +  +G + L + L+   +    +  IV D G
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVV-SASDMDSGTFGEVSYHILSESSSFSIN---------PVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-----------GAMSKVKYSI--YSGDQ--DHNFSIDEDTGKIYVTRYLD-ADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPPQF----SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS--SLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQG 1122          

HSP 3 Score: 105.145 bits (261), Expect = 1.893e-22
Identity = 129/502 (25.70%), Postives = 232/502 (46.22%), Query Frame = 1
Query: 1003 STKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKN-----QLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCW-IEINCLDNASPIIKKLFHLHVPI-IDINDNYPQ--------FSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK------SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPG-MYSIKATVSDNGTPSLTSWMEFFIVLSQA 2427
            + KF +NSTTG + ++  +D E   + +   I+I TD G  +   S TV V V D NDN P+L     +   I E+   G ++  F  +D+D + +N     +L  D   S  L  ++ D  + R++S Q          W I++  +D+  P       L+V   ++I++  PQ        F +  Y   I+E LP    + +L        ++  L +SI++ N    F++D + G++     +DRE +E +  +V  T +GQ    ++V V++ ++NDN P         + EN ++   VA +   D D L       + +++S++S    T       +G I L   LD E    + +     D G+F   T    ++I + DINDN P F  P  ++    + P  + SP +      +    DL+    LTY L + ++S F ++  E+G +   ++ ++P  G  Y +  T +DNG PS ++ +   +++ +A
Sbjct: 1670 APKFSINSTTGSISVL-PLDREASQEHLL--IIILTDGGSRN--DSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMD-IGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQ---------SWKIKLRVVDHGVP------GLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL------QPELAGLTYSIVEGNIDSAFSVD-SEGVIRTNLELDREILERYSLKVIGTGSGQQIG-TRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLA----PLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFT---NLTIFVSDINDNAPTFSKPLYQTT---VSPATF-SPGQP---FAKIEAHDLDARGALTYSLGQGSSSIF-RVAPESGAL---FMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEA 2123          

HSP 4 Score: 91.2781 bits (225), Expect = 3.264e-18
Identity = 112/432 (25.93%), Postives = 181/432 (41.90%), Query Frame = 1
Query:  469 QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRH--YSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR-SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG 1737
            QS   S N+ + +ID++   P F +SKY+I   E      IL   AI     ++ V++  YS D ++N      ID+    + +T  +D +     L +          N+    T + I I D NDN P F      I I E++ +    Y   ASDKD   N  ++YS+   S P S      ++  TG L   + +DYE    R +   V ATD G    S++ T+ + V+D+NDN PE         + EN P   IV      D D L   Q+    YR + G     +D+ +  + + +  D E      I I   D   P         + ++D+NDN P          +    P+ T +  + A D D      LN S+     +Q + F +  +NG + ++  ++  +  +    V ++D G
Sbjct:  719 QSSENSANIHITVIDKDTKTPQFSRSKYEIRTTED-----ILPGIAIGSVGAMSKVKYSIYSGDQDHN----FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQ----TQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS-SHPGS---SIEIDQFTGQLSTGSLLDYE--ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQI---VYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV-VPAGSPLSTAIGTIVAMDPDKG----LNGSVLYRAQLQSSLFVVK-SNGDVYLRRQLNASDERHQRLSVIVSDQG 1122          

HSP 5 Score: 90.8929 bits (224), Expect = 4.136e-18
Identity = 144/607 (23.72%), Postives = 258/607 (42.50%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF--PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYE--NFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDE------LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPI------IDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKII-LMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR 2247
            S    V + I D ND+ P F  S  +I+I E  +   P  ++ +A D+D   NG   YSI +++    I  ID+    L+    +DYE  + R +   + ATD G+        +FIH+ D NDN P F+    T+E+LEN    +IV + VA DKDS  N  I Y ++      + S  F ++   G +     +D E  + +D      ++A D G    S++A+  + V+D+NDN P  +      +    P    + T    D D+      L + QL+   +      + S  D   R    +  +A   R   + +   D   P  +K    HVP+       DI    P     + Y EI ++ P    +  L+A+ + +  +     S    N+F I    G+L + ++     I    + + I  + +   +  + +++L   + A +  T+    I+++  I   + +L     +K  +G+F F  +    + P +L ++G ++ L   L R     +   F  ++  +  A      V + I     +KP F      + H  +  I  D+P+ + I T+ AT  D +  + ++YR
Sbjct:  818 SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVV-QASDKDKKKNGEVRYSIISSHPGSSI-EIDQFTGQLSTGSLLDYE--ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRIT------NGSEYFGIDEKLGNVYTKRSIDREVISHVD----ISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLF-----VVKSNGDVYLR----RQLNASDERHQRLSVIVSDQGVP--RKSVVCHVPVRISKGSADIQIQEP----FQKYIEIPKSCPTGCRLTTLNATGVSSWLIQSSEIS----NHFAI--REGVLFMISH----PIHRPPYSLVIVLSDKNDRQKSIQLRVLASGEAANKEETI---RISDSNSIGTKIGRL----GEKSADGSF-FYRFSSEESCPLELDQTGGLLYLADGLRRGDTHNFSCFFEKFNTTDGSA--EEMRVDLEISRTKSDKPRF-----DTGHLRVN-IREDTPTGSIITTVNATVSD-DSASPISYR 1368          

HSP 6 Score: 86.6557 bits (213), Expect = 7.905e-17
Identity = 158/681 (23.20%), Postives = 276/681 (40.53%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQA--P---------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFY-LNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIY------RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTA-----TVSIHIQDINDNKPVF------IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            S+S S  VT+ ++    S P        I ++ESN   L+      +  +L + V   SI   Y +  +  I   A  P         +L + G +D E +S+    FLL    DG  +   +    + I D NDN P +   +  I I  N + G       A D D G N  I+YS+        + T+   ++  TG + + N +D    I     F V A D G   LST   V+  ++D     P+         I E+ P G        T L ++  N  +C   +    ++ + D+ +        +   + FD E  +     +   +  S     L  +   + D+NDN+P F   +Y+  + E       +  +SASD+D+    ++++ I+ + + F+I+P  G +  +  + R     FH  V   D G  S  N + +++ ++D +   PQ +    Y I     I   +A  S     K++     +  Y    +  F + + +GKI + ++LD +  D  L+        N  A   +       V I I+D NDN P F      I  +E  K  L +P FY          ++A+D+D  +N ++ Y +  ++  S  +I+  TG++    +        Y ++   +D G P  +S M  FI
Sbjct:  316 SLSSSAVVTITVLGSTLSSPPLDI----IWLVESNSAHLM------ENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLL--EKDG--QIIIEHPQLLTIGDINDNAPQWHSSQ--IHISLNRTQGG-SRTLTAKDPDLGQNGWIRYSV--------LDTELVSIDKETGRIFVPNTIDCN--IGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIG--------TCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIR--LKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARG---RFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSR-SKYEIRTTEDILPGIAIGSVGAMSKVK-----YSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLL--------NIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLK--LHEP-FY---------VVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFI 930          

HSP 7 Score: 66.6254 bits (161), Expect = 1.131e-10
Identity = 153/651 (23.50%), Postives = 268/651 (41.17%), Query Frame = 1
Query:  469 QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVY-IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKL-VNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLT---FSFTDLDE----LSKNQLKCDFYRSFGLAIDSVD-------DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKL-FHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDRE--EIENFHFE--VQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGT--FTFKEYIMSNNSPFKL---TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYF 2310
            Q I   V+V VN +  ND++P F  SK             +    A D D+L   +R++ + ++       + ID+    +++T  +D+E   +   H L     DG   F   T++ I ++D NDN P F     + T+      S G    +  A D D+     + YSL    G  SI   F +   +G L + V     E ++       V ATD+G    STS  V V                   I E EP+ K       F F  ++     L    L  +  R F   I   +       D   R+      D E       ++  +DN     +K+    HV ++D NDN P F+   YY  +++++     + Q+ ASD D+ +  ++++ I+     N  T++P  G + +    D +  E  N  ++  V+  D G  +     K +V +K+   + +AP    L  Y  H+ E+T +   + ++  ++   + N    ++ KE+        KL    K+G++ L  HLD E + +  +   V D GN    +    + I ++ +++  PVF     KS + L  PI   +P+  ++  ++A D+D   +  + Y +  ++  S  KI   TG I  
Sbjct: 1907 QQIGTRVDVRVNNL--NDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAP-LRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPE---HTLTIKATDG--SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVS-PATFSPGQPFAKIEAHDLDA--RGALTYSLG--QGSSSI---FRVAPESGALFMKVLPPAGERYL-----VTVTATDNGVPSFSTSVPVSVI------------------IGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVE-IDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAP-FFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEH------QGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSD-GN--GRSAVVPLKIVVEPVDEFAPVFT----KSSYTLQIPI--STPAGESVGQMQAIDEDGGVHGVVKYSI--SDRQSTVKIEEHTGIIRL 2499          

HSP 8 Score: 54.299 bits (129), Expect = 5.639e-7
Identity = 111/474 (23.42%), Postives = 208/474 (43.88%), Query Frame = 1
Query:  454 TIDNFQSISRSVNVTVNIIDENDSL--PFFQKSKYDINIIESNEFPLIL--LPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGL---NEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPK-SISTKFYLNSTTGLLKL--VNKVDYENFIDRIFTFIVIATDSGRLHLSTSAT----VIVKVMDINDNVPELI-----VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG-LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-QCNYFTIDPANGILSI-KTNIDREEIENFHFEVQITDTGQLSNKSKVYVKI--LDVNDNAPQ 1800
            T +   S S SV V+V II E +    P F+K+++   ++E+++  L +  L     R+       HY I D   + +F   IDK   +  + G ID E   QR  H      D+ +    + +CK  + +   D NDN P F      + + ++++ G  + Q +ASD+DSG N  + Y +  LSG   +I T   LN  TG ++L   N    + F +  +  +V A D G  H + +A     V +K+   + + P  +     VH    + E+   G ++     ++   +  + L        G L ID V  G   + +   +++E     ++ ++  +  S ++     L + +  +++  P F+++ Y  +I  + P   +V Q+ A D D      + +SI  + +   I+   GI+ + K  + R  +      V    +    +K+ VY++I   DV  + P+
Sbjct: 2103 TDNGVPSFSTSVPVSV-IIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREF------HYRIQDPEASKIF--SIDKFGRLF-VAGPIDRE---QRATHEFQVEIDNEMMTSQKVQCKCHVIV--LDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI--LSGNDLNIVT---LNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHG--HPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVH----VLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGID-VKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVP----LKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPK 2545          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 210.69 bits (535), Expect = 7.913e-55
Identity = 187/665 (28.12%), Postives = 305/665 (45.86%), Query Frame = 1
Query:  481 RSVNVTVNIIDENDSLPFFQKSKYDINIIESN--EFPLILLPKAIDRD-SLVNGVRHYSIDNNYNNLF----------IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIV-----HQNNSITENEPSGKIVLTFSFTDLDELSK-NQLKCDFYRSFG-LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-----CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENG--TFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNG 2376
            R++ V V + DEND+ P F ++   I   E+   E    LLP A D D    N  R+  +  N N+ F          ++Y+D     L I+G +D E +    +  L+ A D G    +    + I I D NDN P F+       + EN +VG+ V Q  ASD D+  N L++Y+++     K     F ++  TG + +   +D+E     +   +V+A D G   L T+A V ++V D+NDN P + V       +  I+E+   G+ V   S  D D  ++   +        G  A+ + D+ IY +      D E      + +   D  +P +     + + I D+NDN P+F Q  Y+  + E     T+V Q+ A D D    + L +S+ +       +F IDP  G+++ +++ID E        V   D G   LS+ + V V I DVNDN P    +     +AEN  + + + ++S +D D   N    +T  E           + SG+I +   LD E++  Y  P +  D G    L+TTA + + + D+NDN+PVF YP+E        P      S T I+ + ATD D     +++YR+   N +   +I+  TGEI+    DM+    +P M+ +  + +D G
Sbjct:  156 RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLD-----LQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFET--KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQP-MHMLNISATDGG 803          

HSP 2 Score: 190.274 bits (482), Expect = 1.656e-48
Identity = 185/693 (26.70%), Postives = 302/693 (43.58%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-----DNNYNNLFIVYIDKQAPILNITGKI----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLP----------------IYTNVYQLSASDLDNS-DVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK----VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK--EYIMSNN-------SPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVA--LTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRT--TIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF-----YIDMIPKPGMYSIKATVSDNGTP 2382
            S+S ++ + V++ D ND+ P F+K +Y +N+ ES      I+   A D D+  N    Y I     DN  N++    + +   I   +G I      +  ++  +   + ATD+G      KT + + + DANDN P F   +    I EN+  GS+V    ASD D G N+ I+YSL P      I++ F ++  TG +     +D E  +  ++  +V A D G    S    V + V D+NDN PE+   Q +  S+ E +P G  V+     D D      +     +   S G  + S+D     I +  V D E      + +   D  +P  + +  L V ++D+NDN P F+ +   F + E+                  +  N  + S  DL  +  +N L   +I+   F ID  +G L +   +DRE    F  E++  DT   +N       V +++ DVNDNAP+     +   ++E T +   +   + TD D   NG   ++   Y    N       S F++ + +G + L   LD E    YL+     D  + V   L T+ TV + I D ND+ P F+ P   S  G    +F    +R    +  + A D+D  +N +LTY +   N     +INS+TG I          + + K G +++     D+G P
Sbjct: 1015 SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRE--LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA-FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP--NSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 3 Score: 166.007 bits (419), Expect = 6.650e-41
Identity = 163/673 (24.22%), Postives = 292/673 (43.39%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNL----FIVYIDKQAPILNI---TGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTD--IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---------------NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDK---TNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            +S +  + + + D ND+ P F   +Y +++ ES        PKA  + S    V   + D +Y N     + +    +A I  I   TG+I     D      +  H L  +  DG N  +   D  +F+ I DA    P F+       + E+I  G++V   +A+  D    S ++YS+   SG       F + + +G +++   +D+E    +    + I    G   +     V ++V D+NDN PE        S+ E+   G  +      D D  S  Q+     +  G  + ++D     +  +Q  D E ++   + +   D   P +     + V + D+NDN P F + +Y   + E+  I   + Q++ASDLD  +  ++ + I+                  +F I P +G + ++  +DRE  + +   V  TD G  +   K++V V++LD NDN P+   +   + I EN +    V  ++ +D D  EN    +   ++  NS F++   +G+I   + LDRE ++LY +     D G  V  +    V IH+ D+NDN P    P+E      +  +  + P  T ++ +RA D+D  +NA +TY + K   ++      I+  +G I    +    +  +Y +    SD G P
Sbjct:  695 LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES--------PKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI--YSGDPD--GYFSIETNSGNIRIAKPLDHEA---KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYS--LLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQED-----VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP 1343          

HSP 4 Score: 151.369 bits (381), Expect = 2.083e-36
Identity = 174/721 (24.13%), Postives = 306/721 (42.44%), Query Frame = 1
Query:  418 QIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI--------DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLN---EFKCKTDIFIHITDANDNYPNF------DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKV-----DYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDN------ASPIIKK-----------------LFHLHVPIIDINDNYPQFSQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS---KVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF-IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA--SSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            Q +F +    + T  +    S ++ V + + D ND+ P + +   D+ + E+     I+    A D D+  NG   Y +        ++    + +  +D     L++   +D+E   + L   ++ A D   N     +    + + I DAND+ P+F        K  ++ I +   +G +V   VA D+DSG N  + Y ++  +G      +F +NS TG+++LV  +     D E      F  I+ A D G+     S+  +  ++  + N P   +      +I EN PSG  VL  +   L       L  +        +  VD     I +   FD E      + +   D       +S  ++K                 +  +++ + D+NDN P+F     Y   + EN      ++ + ASDLD      L +SI   N    F+ID ++G LS +  +DRE+   +  ++Q +D GQ  ++     + + + D NDNAP+   +  T  + E+  +  SV Q+S  D D   N       Y ++N + ++     +SG I  +  LDRE +  Y    +  D G +   + T  V I++ DINDN+P+F  YP       LI+P         T++ ++A D DL  NA++ Y L+  N+  S+  +IN  TG +            +  ++    D G P  +S
Sbjct: 1446 QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLL--IVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEK--GGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLV---YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQP-------GQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 5 Score: 144.821 bits (364), Expect = 1.772e-34
Identity = 165/679 (24.30%), Postives = 296/679 (43.59%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGS-----IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTK-------SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTII-TLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +S +  V V I D ND+ P F +S Y++++ E+      IL   A D D  VN + +Y+I   + +L    +   +  + I G++D+E  S   + F + ATD G         I + +TD NDN P F  +E  + + E+    S      +   VA+D D G    + Y +  ++G +  +  F ++ +TG + +V           +    + ATD G L  +  A V + ++D     P       N  + E+ P G +V +      D   ++ ++   Y        S++     I   +  D E      + I       P+      +++ + D+NDN P+F  +     + E+  +   +Y   A D D+    ++ +S+++ +    F ID  +G L +  ++D E  +     V  TD G   LS    + V + DVNDN P       + +++E+  I+  + Q++ +D D   N   T++      + + ++ S   +++       SG I L   LDRE +D Y +  +  D+G   A   T  + + + D NDN P F    +KSK+        ++  R +++  + A+D DL ENA + Y L   N SSF +++  TGEI            +Y +     D GTP  ++ +   I +S  N
Sbjct:  591 LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI--VAGNE--AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKF----QKSKYEF---RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN-SSF-QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVN 1250          

HSP 6 Score: 138.272 bits (347), Expect = 1.822e-32
Identity = 154/631 (24.41%), Postives = 266/631 (42.16%), Query Frame = 1
Query:  619 SLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ---NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDA---EFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPI-----YTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANG-ILSIKTNIDREEIENFH-FEVQITDTGQLSNKSK--VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPF-------IVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +L  G  H+++    N++++V +    P+       D E  S   +   + ATD G         IF+ ITD NDN P F+       ++E    G+ V Q +A D+D G+NS + YSL+    P++ +  F ++  TGL+   + +D E   + +    V+A D G   LS++ATV+V + D+NDN P  I  Q   N S+ ENEP G+ +L  S +D D      +      + G     + +   R AS ++  A   +F R    E   L      +     + + + D+NDN P F   +Y   + E+         T +  + A+D D  +  ++++ I+  N    F ID + G I  ++ ++     +  H   +  TD G L + +   V++ I+D     P        Y++ E+      V  +     D        +  Y    +  F + T SG I + K LD E K   L+          VY H           V+I ++D+NDN P F    E S   +  P    +     +    A D+D   + ++TY L K +      I++ +G +             +++  T +D G PSL++ +   + +   N
Sbjct:  436 TLNGGDGHFALTTRDNSIYLVIV--HLPL-------DREIVSN--YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA--ETPETHAQWFQIDPQTGLITTRSHIDCET--EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP--IFDQSFYNVSVAENEPVGRCILKVSASDPD----CGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH---------TQVNIEVEDVNDNAPEF----EASMVRISVP--ESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVN 1030          

HSP 7 Score: 134.035 bits (336), Expect = 3.531e-31
Identity = 160/677 (23.63%), Postives = 279/677 (41.21%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVY---------------IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNS-----LIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR---LHLSTSATVIVKVMDINDNVPELIVHQNNS-------ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAS-TQVFD------------AEFNRFCWIEINCLDNASPIIKKL-FHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITD-------------------------TGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V ++D ND+ P F  S     + E      ++     I+R + V  VR+ S++ ++ +L + Y               ID+ +  L +   +D E  S+         T    N       + I + D NDN P +      +++ E   VG+I++ F A+D D+G N      LI+Y        +   + F ++S TG L L   +D+E   +  +  IV A D        L TS TV ++++D ND+ P  +   ++        I++    G++V      D D     QL  +     G       +G +RI S T + +             +  RF  I I   D+  P  KK   +LH+ +   ++N P+F QA Y   I EN+P  + V Q++A  L  ++   L++ I   +  + F +D   GI++ +   DRE   ++   V + D                          GQ  + + +Y+ + DVNDN+P+      Y   + EN++    +  +  +D D+  N    +     +  + F +  S   +  + LDRE+   Y +     D G   +      ++I ++D NDN P F   K          +  D+P  T+++ + A D DL  NA+L Y L       F  I+ ++G I
Sbjct: 1353 VEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADV--VRN-SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE--YLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG-------EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI-IGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE-PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGS------VQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFA-IDGQSGLI 2008          

HSP 8 Score: 114.775 bits (286), Expect = 3.071e-25
Identity = 138/550 (25.09%), Postives = 235/550 (42.73%), Query Frame = 1
Query:  865 KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR-----SFGLAIDSVDDGIY--RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLM-----TYHIAENTQIDQSVAQLSFTDND-KLENGTFTFKEYIMSNNSPFKLTKSGK----IILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKT--NASSFTKINSETGEIYF-FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +E+ +E+ E ++V    YQ        G++S   Y +   +G   + T   ++  TG ++   K+D E    R    +V    SGR     +  V+V V D NDN P       +    EN P           DLD    N  + +        +F L+     DG+    +  +   D E      + I  LD  +P ++    +++ I D+NDN P F+Q++Y+  + EN  + T+V Q+ ASD D  +   + ++I      +   F IDP  G + I   +D E  E     V   D G+  L   + V +++ DVNDN P    +      +  I+E+ Q  + VA++S  D D K E         +   +  F LT        +I+   LDRE    Y +  +  D G    L  + ++ + I D+NDN P F   ++   H  +  +   +   T+++ + A D+D   N+ LTY L +T    + + +I+ +TG I    +ID   +P +  +     D G P L+S     + +   N
Sbjct:   80 RERKLEVFEGVAVD---YQIGYIGDFGGIDSGPPYIIVAEAG---VETDLAIDRATGEIRTKVKLDRET---RASYSLVAIPLSGR-----NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVT--LNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEV---ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEP-VPQLTVVARDGGVPPLSSTATVLVTIHDVN 605          

HSP 9 Score: 114.005 bits (284), Expect = 5.192e-25
Identity = 128/529 (24.20%), Postives = 243/529 (45.94%), Query Frame = 1
Query:  811 DIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF---GLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF--SQAKYYF-------EIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--FTIDPANGILSIKTNIDREEIE---NFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMT----YHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNN--SPFKLTKSGKIILMKHLDREKKDLYLIPFIV-YDHG----NFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRA--TDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            ++ I + D NDN P F  K+    + E  + G+ V Q  A D D+G N+ ++Y +   +   +   +    + +G+++    +D E  I  I+   +IATD G   ++ +AT+ V+++D+NDN P    +   +++E    G ++ + S  D+D       +     +     ++I ++D    ++   +  D E  +   +++   D A    +    L V + D NDN P F   Q   YF       EI E+L +  ++  ++A+D D+   N     II+     F++ P+NG++S+  +  +  +    ++   +   D G+ + KS   +++   NDN    +  +       I+E   +   V QL     D L+         I++ N  S F+L +S  I+L+K LDRE+ DLY +  ++ + HG    + +  ++  +V I I D NDN P+F   +       I  +   +P R +I  L+A   DQ+   N+++ Y +   N      I+  TG ++
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE---PAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV-QANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDALDQSL-----AIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--DRSAKYEAEISEL---APLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF 2813          

HSP 10 Score: 102.449 bits (254), Expect = 1.828e-21
Identity = 151/673 (22.44%), Postives = 271/673 (40.27%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILN--ITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN----------NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRF---------CWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQIT--------DTGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREK-KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-----DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG 2376
            + + + DEND+ P F + ++   + E +N+   +    A D D+  N  +R++ +D N++N F++      P  +  +   I  +   + ++   + ATD+G+ +      I + I D NDN P F      + + E   +G+++    A+D D+      +         +++S  F L+  +G L L  ++DYE  + + +   VIA+D+          + V+V D NDN P  +  Q           + I+E+      +LT + TD D    N             I+   +G     S  V     +R           ++ I   D   P +K    L V   D      QF Q +Y  +I E  P+ + V QL    LD S       +II  N    F +  +  I+ +K  +DRE  + +   + ++         +   S+   V + ILD NDN P       Y   I+E   +  S+AQL   D D+           I S N     T    +G + +   LD +     Y +     D  +   L +     + + D NDN+P F  P  +  H L +    + P  +++    A+D D     +L Y +     D+++   F +++SE+G +   ++    +   Y ++   SD G
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI-----EPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI-FALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNS-------KVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAE----NEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF-RVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 11 Score: 100.138 bits (248), Expect = 1.000e-20
Identity = 96/363 (26.45%), Postives = 164/363 (45.18%), Query Frame = 1
Query: 1432 SPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPA-NGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTT---IITLRATDQDLN-ENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQ 2469
            +P +     L + + D NDN P+FSQ ++   + E     T V Q+ A D D     +L + I+  N+   F I+PA +GI+     +DRE  + +  ++  TD G  Q++  + + V+I+DVNDN P         ++E T++   +  +S  D D     T+         + N S F L + SGK++L + LD E +  Y +  I  D     A      +++ + D NDN PVF+  +  +   ++  I   S S +    ++T+ ATD D    N+K+ Y ++   A     ++   G +      + P     G Y ++    D G P+L S     ++  QAN   S  +  L  Q
Sbjct: 2299 APFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP--AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST---LLRVQANDNGSGRSQFLQNQ 2652          

HSP 12 Score: 99.3673 bits (246), Expect = 1.476e-20
Identity = 163/682 (23.90%), Postives = 279/682 (40.91%), Query Frame = 1
Query:  448 IQTIDNFQSISR----SVNVTVNIIDENDSLPFFQK------SKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIH--ITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH-LSTS----------------------ATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG------LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK---VYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP----FKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            +Q +D   +++     SV V + I+D ND  P F            + I ++     ++    A+D DS  NG   Y I    N      I+ Q  I+ +   +     D E   +  F+ ++ A D G  E K K+ + +H  +  +++N P F        ILEN+  GS V Q  A       N+ + Y +     P  ++   F+++   G++    + D E+     +   V   D+ R   LS+S                      AT+ + V D+NDN PE         S+ EN   G ++ T   +DLDE     L    Y   G       +IDS    +    S +  D E +    ++I   D   P  ++  H ++ I   D NDN P+F  +KY   ++E+ P+ T+V Q+SA D D     +L +S+       F ID  +G+++    +DRE   +++F V  TD G+   +S    V + +LD+NDN P          +    Q  Q++ ++   D D   N    +   + + NS     F++  S G +   + L  E   L  +  +  D GN    ++   + + I +     PV  +  E  +  L +    +SPS T ++ + A   D     K+ +     N      ++S +GEI
Sbjct: 1569 VQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-NGEGRFRINSQTGIIELVKSLPPATEDVEKGGR--FNLIIGAKDHGQPEPK-KSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRES--QASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADL---IYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS--LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGN-PPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE----NSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEI 2222          

HSP 13 Score: 96.2857 bits (238), Expect = 1.375e-19
Identity = 156/674 (23.15%), Postives = 282/674 (41.84%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQK-SKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFK---CKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHL-STSATVIVKVMDINDNVPELIVHQNNSITENEPS----GKIVLTFSFTDLDELSKNQL--KCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP--QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFIVLSQANFPKSSSNNLLT 2463
            + + + D ND+ P F+  S Y +++ E++E  +I    A D D   N    YSI   N  N F   ID  +  L+    +D E  S+  +   + A+D G  + +   C   IF+   D NDN P F   + T  + E+  +G+ V Q  A D D GVN+ + YSL+          +F ++  +GL+  V K+D E  +   + F+V+ATD GR  + S +  V + V+DINDN P   + +        P+    G+ +L     D D  +  ++    +   S   A   ++     ++++Q   +E  +   +E+   D  +P    L  + + I +     P  +F    Y   ++EN P  T + Q+ A   D     K+ FS      F     +GILS         +++   E+++       NK      +LD +  +  S + ++   A + + +   +     +N        T   + ++N+ P ++    +++L+             PF          L + A + I ++D NDN P F      S+   +  +   +   T +  + A D D   NA+L Y + D  + ++F    + +G +    +       +Y +K   +D G P +  T+ +   IV    N P    NNL+T
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKF--SIDSSSGELS-ARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP---IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR-QKVQFS------FGAGNEDGILS---------LDSLSGEIRV-------NKP----HLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEI----RVVLVARTADA-------PF----------LASYAELVIELEDENDNSPKF------SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVT 2435          

HSP 14 Score: 91.2781 bits (225), Expect = 4.993e-18
Identity = 150/660 (22.73%), Postives = 279/660 (42.27%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYN--NLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTI---------EILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIV--IATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP------IIKKLFHLHVPIIDINDNYPQFSQ-AKYYFEIEENLPIYTNVYQLSASDLD--NSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREE-IENFHFEVQITDTGQ---LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIM----SNNSPFKL----TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            I T +    ++ +  + V I+D ND+ P F  +   + + E+ E   ++    A D D+          ++  +  N+ I  +D+ +  L +  ++DYE   Q+ +   + A+D      + +T + + + D NDN P F  ++            EI E++SV   +    A+D DS G NS + Y + P          F ++ + G++  VN    +  +     + V  IA D+G+  L +S  + V+  D      + + +Q  + I+E  P G +VL      LD+ S   +  +   +F L           I   +  D E N    + +       P             + + I+D NDN+P F + AKY  EI E  P+  ++ QL A D D  N+  +++ + I   N    FTID   G+L +   +D +   +++   ++  D+     L +     +++ D NDN P+   T   + +AEN  +  SV +   +D DK   G F    Y +    S+ S +K+    ++SG +      D E++  Y +  +  D G   A   +  V + I+  ++  P F     +  +  + P     P    +  + ATD D   + ++ Y+L   +  S  K+N  +G +
Sbjct: 2399 IATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP------AQEGFSVHPSNGVVS-VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ-SLAIIAGNEESAFELLQSKA------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK---GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA---SVAVRVEIESRDEFTPQFT----ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH--SHFKVNRSSGAV 3026          

HSP 15 Score: 70.4774 bits (171), Expect = 1.102e-11
Identity = 121/537 (22.53%), Postives = 228/537 (42.46%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFF---QKSKY--------DINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-----RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ-------LKCDFYRSFGLAIDSVD--DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQI----DQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK 1980
            +R+V +TV + DEND+ P F   Q   Y        +I+   S +F L+ +  A D DS  N  +   I       F V+       +N++ ++    SS   +   + A D G    K  T + +   D       F   +   +I E   +GS+V Q        G ++L + SL+ ++G +  + +   +    L+K +++   + +  R+    V++   G      L+ S+  +VI+ ++D NDN P   +   ++  E E S    L +S   L  +  +Q       +  D        + ++D   G+  + +   +D+    +  I   C  +    +  L    + + D NDN P+F   +Y   + EN P+ ++V++  ASDLD     +LN+SI            F +D  +G+++     D E+ + +  E+  +D G       V V+I   ++  PQ T   TY       +       V Q++ TD+D   +G   ++  + + +S FK+ +S   +L+K
Sbjct: 2514 ARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTV-NATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS-RLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-------GQDALDQ-SLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRL----VLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTE-RTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQ--LSAPHSHFKVNRSSGAVLIK 3029          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 210.69 bits (535), Expect = 7.913e-55
Identity = 187/665 (28.12%), Postives = 305/665 (45.86%), Query Frame = 1
Query:  481 RSVNVTVNIIDENDSLPFFQKSKYDINIIESN--EFPLILLPKAIDRD-SLVNGVRHYSIDNNYNNLF----------IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIV-----HQNNSITENEPSGKIVLTFSFTDLDELSK-NQLKCDFYRSFG-LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-----CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENG--TFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNG 2376
            R++ V V + DEND+ P F ++   I   E+   E    LLP A D D    N  R+  +  N N+ F          ++Y+D     L I+G +D E +    +  L+ A D G    +    + I I D NDN P F+       + EN +VG+ V Q  ASD D+  N L++Y+++     K     F ++  TG + +   +D+E     +   +V+A D G   L T+A V ++V D+NDN P + V       +  I+E+   G+ V   S  D D  ++   +        G  A+ + D+ IY +      D E      + +   D  +P +     + + I D+NDN P+F Q  Y+  + E     T+V Q+ A D D    + L +S+ +       +F IDP  G+++ +++ID E        V   D G   LS+ + V V I DVNDN P    +     +AEN  + + + ++S +D D   N    +T  E           + SG+I +   LD E++  Y  P +  D G    L+TTA + + + D+NDN+PVF YP+E        P      S T I+ + ATD D     +++YR+   N +   +I+  TGEI+    DM+    +P M+ +  + +D G
Sbjct:  156 RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLD-----LQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFET--KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQP-MHMLNISATDGG 803          

HSP 2 Score: 190.274 bits (482), Expect = 1.656e-48
Identity = 185/693 (26.70%), Postives = 302/693 (43.58%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-----DNNYNNLFIVYIDKQAPILNITGKI----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLP----------------IYTNVYQLSASDLDNS-DVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK----VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK--EYIMSNN-------SPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVA--LTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRT--TIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF-----YIDMIPKPGMYSIKATVSDNGTP 2382
            S+S ++ + V++ D ND+ P F+K +Y +N+ ES      I+   A D D+  N    Y I     DN  N++    + +   I   +G I      +  ++  +   + ATD+G      KT + + + DANDN P F   +    I EN+  GS+V    ASD D G N+ I+YSL P      I++ F ++  TG +     +D E  +  ++  +V A D G    S    V + V D+NDN PE+   Q +  S+ E +P G  V+     D D      +     +   S G  + S+D     I +  V D E      + +   D  +P  + +  L V ++D+NDN P F+ +   F + E+                  +  N  + S  DL  +  +N L   +I+   F ID  +G L +   +DRE    F  E++  DT   +N       V +++ DVNDNAP+     +   ++E T +   +   + TD D   NG   ++   Y    N       S F++ + +G + L   LD E    YL+     D  + V   L T+ TV + I D ND+ P F+ P   S  G    +F    +R    +  + A D+D  +N +LTY +   N     +INS+TG I          + + K G +++     D+G P
Sbjct: 1015 SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRE--LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA-FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP--NSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 3 Score: 166.007 bits (419), Expect = 6.650e-41
Identity = 163/673 (24.22%), Postives = 292/673 (43.39%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNL----FIVYIDKQAPILNI---TGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTD--IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---------------NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDK---TNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            +S +  + + + D ND+ P F   +Y +++ ES        PKA  + S    V   + D +Y N     + +    +A I  I   TG+I     D      +  H L  +  DG N  +   D  +F+ I DA    P F+       + E+I  G++V   +A+  D    S ++YS+   SG       F + + +G +++   +D+E    +    + I    G   +     V ++V D+NDN PE        S+ E+   G  +      D D  S  Q+     +  G  + ++D     +  +Q  D E ++   + +   D   P +     + V + D+NDN P F + +Y   + E+  I   + Q++ASDLD  +  ++ + I+                  +F I P +G + ++  +DRE  + +   V  TD G  +   K++V V++LD NDN P+   +   + I EN +    V  ++ +D D  EN    +   ++  NS F++   +G+I   + LDRE ++LY +     D G  V  +    V IH+ D+NDN P    P+E      +  +  + P  T ++ +RA D+D  +NA +TY + K   ++      I+  +G I    +    +  +Y +    SD G P
Sbjct:  695 LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES--------PKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI--YSGDPD--GYFSIETNSGNIRIAKPLDHEA---KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYS--LLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQED-----VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP 1343          

HSP 4 Score: 151.369 bits (381), Expect = 2.083e-36
Identity = 174/721 (24.13%), Postives = 306/721 (42.44%), Query Frame = 1
Query:  418 QIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI--------DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLN---EFKCKTDIFIHITDANDNYPNF------DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKV-----DYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDN------ASPIIKK-----------------LFHLHVPIIDINDNYPQFSQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS---KVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF-IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA--SSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            Q +F +    + T  +    S ++ V + + D ND+ P + +   D+ + E+     I+    A D D+  NG   Y +        ++    + +  +D     L++   +D+E   + L   ++ A D   N     +    + + I DAND+ P+F        K  ++ I +   +G +V   VA D+DSG N  + Y ++  +G      +F +NS TG+++LV  +     D E      F  I+ A D G+     S+  +  ++  + N P   +      +I EN PSG  VL  +   L       L  +        +  VD     I +   FD E      + +   D       +S  ++K                 +  +++ + D+NDN P+F     Y   + EN      ++ + ASDLD      L +SI   N    F+ID ++G LS +  +DRE+   +  ++Q +D GQ  ++     + + + D NDNAP+   +  T  + E+  +  SV Q+S  D D   N       Y ++N + ++     +SG I  +  LDRE +  Y    +  D G +   + T  V I++ DINDN+P+F  YP       LI+P         T++ ++A D DL  NA++ Y L+  N+  S+  +IN  TG +            +  ++    D G P  +S
Sbjct: 1446 QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLL--IVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEK--GGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLV---YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQP-------GQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 5 Score: 144.821 bits (364), Expect = 1.772e-34
Identity = 165/679 (24.30%), Postives = 296/679 (43.59%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGS-----IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTK-------SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTII-TLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +S +  V V I D ND+ P F +S Y++++ E+      IL   A D D  VN + +Y+I   + +L    +   +  + I G++D+E  S   + F + ATD G         I + +TD NDN P F  +E  + + E+    S      +   VA+D D G    + Y +  ++G +  +  F ++ +TG + +V           +    + ATD G L  +  A V + ++D     P       N  + E+ P G +V +      D   ++ ++   Y        S++     I   +  D E      + I       P+      +++ + D+NDN P+F  +     + E+  +   +Y   A D D+    ++ +S+++ +    F ID  +G L +  ++D E  +     V  TD G   LS    + V + DVNDN P       + +++E+  I+  + Q++ +D D   N   T++      + + ++ S   +++       SG I L   LDRE +D Y +  +  D+G   A   T  + + + D NDN P F    +KSK+        ++  R +++  + A+D DL ENA + Y L   N SSF +++  TGEI            +Y +     D GTP  ++ +   I +S  N
Sbjct:  591 LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI--VAGNE--AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKF----QKSKYEF---RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN-SSF-QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVN 1250          

HSP 6 Score: 138.272 bits (347), Expect = 1.822e-32
Identity = 154/631 (24.41%), Postives = 266/631 (42.16%), Query Frame = 1
Query:  619 SLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ---NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDA---EFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPI-----YTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANG-ILSIKTNIDREEIENFH-FEVQITDTGQLSNKSK--VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPF-------IVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +L  G  H+++    N++++V +    P+       D E  S   +   + ATD G         IF+ ITD NDN P F+       ++E    G+ V Q +A D+D G+NS + YSL+    P++ +  F ++  TGL+   + +D E   + +    V+A D G   LS++ATV+V + D+NDN P  I  Q   N S+ ENEP G+ +L  S +D D      +      + G     + +   R AS ++  A   +F R    E   L      +     + + + D+NDN P F   +Y   + E+         T +  + A+D D  +  ++++ I+  N    F ID + G I  ++ ++     +  H   +  TD G L + +   V++ I+D     P        Y++ E+      V  +     D        +  Y    +  F + T SG I + K LD E K   L+          VY H           V+I ++D+NDN P F    E S   +  P    +     +    A D+D   + ++TY L K +      I++ +G +             +++  T +D G PSL++ +   + +   N
Sbjct:  436 TLNGGDGHFALTTRDNSIYLVIV--HLPL-------DREIVSN--YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA--ETPETHAQWFQIDPQTGLITTRSHIDCET--EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP--IFDQSFYNVSVAENEPVGRCILKVSASDPD----CGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH---------TQVNIEVEDVNDNAPEF----EASMVRISVP--ESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVN 1030          

HSP 7 Score: 134.035 bits (336), Expect = 3.531e-31
Identity = 160/677 (23.63%), Postives = 279/677 (41.21%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVY---------------IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNS-----LIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR---LHLSTSATVIVKVMDINDNVPELIVHQNNS-------ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAS-TQVFD------------AEFNRFCWIEINCLDNASPIIKKL-FHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITD-------------------------TGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V ++D ND+ P F  S     + E      ++     I+R + V  VR+ S++ ++ +L + Y               ID+ +  L +   +D E  S+         T    N       + I + D NDN P +      +++ E   VG+I++ F A+D D+G N      LI+Y        +   + F ++S TG L L   +D+E   +  +  IV A D        L TS TV ++++D ND+ P  +   ++        I++    G++V      D D     QL  +     G       +G +RI S T + +             +  RF  I I   D+  P  KK   +LH+ +   ++N P+F QA Y   I EN+P  + V Q++A  L  ++   L++ I   +  + F +D   GI++ +   DRE   ++   V + D                          GQ  + + +Y+ + DVNDN+P+      Y   + EN++    +  +  +D D+  N    +     +  + F +  S   +  + LDRE+   Y +     D G   +      ++I ++D NDN P F   K          +  D+P  T+++ + A D DL  NA+L Y L       F  I+ ++G I
Sbjct: 1353 VEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADV--VRN-SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE--YLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG-------EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI-IGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE-PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGS------VQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFA-IDGQSGLI 2008          

HSP 8 Score: 114.775 bits (286), Expect = 3.071e-25
Identity = 138/550 (25.09%), Postives = 235/550 (42.73%), Query Frame = 1
Query:  865 KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR-----SFGLAIDSVDDGIY--RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLM-----TYHIAENTQIDQSVAQLSFTDND-KLENGTFTFKEYIMSNNSPFKLTKSGK----IILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKT--NASSFTKINSETGEIYF-FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +E+ +E+ E ++V    YQ        G++S   Y +   +G   + T   ++  TG ++   K+D E    R    +V    SGR     +  V+V V D NDN P       +    EN P           DLD    N  + +        +F L+     DG+    +  +   D E      + I  LD  +P ++    +++ I D+NDN P F+Q++Y+  + EN  + T+V Q+ ASD D  +   + ++I      +   F IDP  G + I   +D E  E     V   D G+  L   + V +++ DVNDN P    +      +  I+E+ Q  + VA++S  D D K E         +   +  F LT        +I+   LDRE    Y +  +  D G    L  + ++ + I D+NDN P F   ++   H  +  +   +   T+++ + A D+D   N+ LTY L +T    + + +I+ +TG I    +ID   +P +  +     D G P L+S     + +   N
Sbjct:   80 RERKLEVFEGVAVD---YQIGYIGDFGGIDSGPPYIIVAEAG---VETDLAIDRATGEIRTKVKLDRET---RASYSLVAIPLSGR-----NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVT--LNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEV---ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEP-VPQLTVVARDGGVPPLSSTATVLVTIHDVN 605          

HSP 9 Score: 114.005 bits (284), Expect = 5.192e-25
Identity = 128/529 (24.20%), Postives = 243/529 (45.94%), Query Frame = 1
Query:  811 DIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF---GLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF--SQAKYYF-------EIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--FTIDPANGILSIKTNIDREEIE---NFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMT----YHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNN--SPFKLTKSGKIILMKHLDREKKDLYLIPFIV-YDHG----NFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRA--TDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            ++ I + D NDN P F  K+    + E  + G+ V Q  A D D+G N+ ++Y +   +   +   +    + +G+++    +D E  I  I+   +IATD G   ++ +AT+ V+++D+NDN P    +   +++E    G ++ + S  D+D       +     +     ++I ++D    ++   +  D E  +   +++   D A    +    L V + D NDN P F   Q   YF       EI E+L +  ++  ++A+D D+   N     II+     F++ P+NG++S+  +  +  +    ++   +   D G+ + KS   +++   NDN    +  +       I+E   +   V QL     D L+         I++ N  S F+L +S  I+L+K LDRE+ DLY +  ++ + HG    + +  ++  +V I I D NDN P+F   +       I  +   +P R +I  L+A   DQ+   N+++ Y +   N      I+  TG ++
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE---PAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV-QANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDALDQSL-----AIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--DRSAKYEAEISEL---APLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF 2813          

HSP 10 Score: 102.449 bits (254), Expect = 1.828e-21
Identity = 151/673 (22.44%), Postives = 271/673 (40.27%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILN--ITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN----------NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRF---------CWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQIT--------DTGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREK-KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-----DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG 2376
            + + + DEND+ P F + ++   + E +N+   +    A D D+  N  +R++ +D N++N F++      P  +  +   I  +   + ++   + ATD+G+ +      I + I D NDN P F      + + E   +G+++    A+D D+      +         +++S  F L+  +G L L  ++DYE  + + +   VIA+D+          + V+V D NDN P  +  Q           + I+E+      +LT + TD D    N             I+   +G     S  V     +R           ++ I   D   P +K    L V   D      QF Q +Y  +I E  P+ + V QL    LD S       +II  N    F +  +  I+ +K  +DRE  + +   + ++         +   S+   V + ILD NDN P       Y   I+E   +  S+AQL   D D+           I S N     T    +G + +   LD +     Y +     D  +   L +     + + D NDN+P F  P  +  H L +    + P  +++    A+D D     +L Y +     D+++   F +++SE+G +   ++    +   Y ++   SD G
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI-----EPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI-FALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNS-------KVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAE----NEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF-RVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2947          

HSP 11 Score: 100.138 bits (248), Expect = 1.000e-20
Identity = 96/363 (26.45%), Postives = 164/363 (45.18%), Query Frame = 1
Query: 1432 SPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPA-NGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTT---IITLRATDQDLN-ENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQ 2469
            +P +     L + + D NDN P+FSQ ++   + E     T V Q+ A D D     +L + I+  N+   F I+PA +GI+     +DRE  + +  ++  TD G  Q++  + + V+I+DVNDN P         ++E T++   +  +S  D D     T+         + N S F L + SGK++L + LD E +  Y +  I  D     A      +++ + D NDN PVF+  +  +   ++  I   S S +    ++T+ ATD D    N+K+ Y ++   A     ++   G +      + P     G Y ++    D G P+L S     ++  QAN   S  +  L  Q
Sbjct: 2299 APFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP--AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST---LLRVQANDNGSGRSQFLQNQ 2652          

HSP 12 Score: 99.3673 bits (246), Expect = 1.476e-20
Identity = 163/682 (23.90%), Postives = 279/682 (40.91%), Query Frame = 1
Query:  448 IQTIDNFQSISR----SVNVTVNIIDENDSLPFFQK------SKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIH--ITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH-LSTS----------------------ATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG------LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK---VYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP----FKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            +Q +D   +++     SV V + I+D ND  P F            + I ++     ++    A+D DS  NG   Y I    N      I+ Q  I+ +   +     D E   +  F+ ++ A D G  E K K+ + +H  +  +++N P F        ILEN+  GS V Q  A       N+ + Y +     P  ++   F+++   G++    + D E+     +   V   D+ R   LS+S                      AT+ + V D+NDN PE         S+ EN   G ++ T   +DLDE     L    Y   G       +IDS    +    S +  D E +    ++I   D   P  ++  H ++ I   D NDN P+F  +KY   ++E+ P+ T+V Q+SA D D     +L +S+       F ID  +G+++    +DRE   +++F V  TD G+   +S    V + +LD+NDN P          +    Q  Q++ ++   D D   N    +   + + NS     F++  S G +   + L  E   L  +  +  D GN    ++   + + I +     PV  +  E  +  L +    +SPS T ++ + A   D     K+ +     N      ++S +GEI
Sbjct: 1569 VQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-NGEGRFRINSQTGIIELVKSLPPATEDVEKGGR--FNLIIGAKDHGQPEPK-KSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRES--QASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADL---IYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS--LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGN-PPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE----NSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEI 2222          

HSP 13 Score: 96.2857 bits (238), Expect = 1.375e-19
Identity = 156/674 (23.15%), Postives = 282/674 (41.84%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQK-SKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFK---CKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHL-STSATVIVKVMDINDNVPELIVHQNNSITENEPS----GKIVLTFSFTDLDELSKNQL--KCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP--QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFIVLSQANFPKSSSNNLLT 2463
            + + + D ND+ P F+  S Y +++ E++E  +I    A D D   N    YSI   N  N F   ID  +  L+    +D E  S+  +   + A+D G  + +   C   IF+   D NDN P F   + T  + E+  +G+ V Q  A D D GVN+ + YSL+          +F ++  +GL+  V K+D E  +   + F+V+ATD GR  + S +  V + V+DINDN P   + +        P+    G+ +L     D D  +  ++    +   S   A   ++     ++++Q   +E  +   +E+   D  +P    L  + + I +     P  +F    Y   ++EN P  T + Q+ A   D     K+ FS      F     +GILS         +++   E+++       NK      +LD +  +  S + ++   A + + +   +     +N        T   + ++N+ P ++    +++L+             PF          L + A + I ++D NDN P F      S+   +  +   +   T +  + A D D   NA+L Y + D  + ++F    + +G +    +       +Y +K   +D G P +  T+ +   IV    N P    NNL+T
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKF--SIDSSSGELS-ARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP---IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR-QKVQFS------FGAGNEDGILS---------LDSLSGEIRV-------NKP----HLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEI----RVVLVARTADA-------PF----------LASYAELVIELEDENDNSPKF------SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVT 2435          

HSP 14 Score: 91.2781 bits (225), Expect = 4.993e-18
Identity = 150/660 (22.73%), Postives = 279/660 (42.27%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYN--NLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTI---------EILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIV--IATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP------IIKKLFHLHVPIIDINDNYPQFSQ-AKYYFEIEENLPIYTNVYQLSASDLD--NSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREE-IENFHFEVQITDTGQ---LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIM----SNNSPFKL----TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            I T +    ++ +  + V I+D ND+ P F  +   + + E+ E   ++    A D D+          ++  +  N+ I  +D+ +  L +  ++DYE   Q+ +   + A+D      + +T + + + D NDN P F  ++            EI E++SV   +    A+D DS G NS + Y + P          F ++ + G++  VN    +  +     + V  IA D+G+  L +S  + V+  D      + + +Q  + I+E  P G +VL      LD+ S   +  +   +F L           I   +  D E N    + +       P             + + I+D NDN+P F + AKY  EI E  P+  ++ QL A D D  N+  +++ + I   N    FTID   G+L +   +D +   +++   ++  D+     L +     +++ D NDN P+   T   + +AEN  +  SV +   +D DK   G F    Y +    S+ S +K+    ++SG +      D E++  Y +  +  D G   A   +  V + I+  ++  P F     +  +  + P     P    +  + ATD D   + ++ Y+L   +  S  K+N  +G +
Sbjct: 2399 IATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP------AQEGFSVHPSNGVVS-VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ-SLAIIAGNEESAFELLQSKA------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK---GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA---SVAVRVEIESRDEFTPQFT----ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH--SHFKVNRSSGAV 3026          

HSP 15 Score: 70.4774 bits (171), Expect = 1.102e-11
Identity = 121/537 (22.53%), Postives = 228/537 (42.46%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFF---QKSKY--------DINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-----RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ-------LKCDFYRSFGLAIDSVD--DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQI----DQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK 1980
            +R+V +TV + DEND+ P F   Q   Y        +I+   S +F L+ +  A D DS  N  +   I       F V+       +N++ ++    SS   +   + A D G    K  T + +   D       F   +   +I E   +GS+V Q        G ++L + SL+ ++G +  + +   +    L+K +++   + +  R+    V++   G      L+ S+  +VI+ ++D NDN P   +   ++  E E S    L +S   L  +  +Q       +  D        + ++D   G+  + +   +D+    +  I   C  +    +  L    + + D NDN P+F   +Y   + EN P+ ++V++  ASDLD     +LN+SI            F +D  +G+++     D E+ + +  E+  +D G       V V+I   ++  PQ T   TY       +       V Q++ TD+D   +G   ++  + + +S FK+ +S   +L+K
Sbjct: 2514 ARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTV-NATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS-RLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-------GQDALDQ-SLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRL----VLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTE-RTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQ--LSAPHSHFKVNRSSGAVLIK 3029          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 196.438 bits (498), Expect = 1.848e-50
Identity = 184/701 (26.25%), Postives = 322/701 (45.93%), Query Frame = 1
Query:  439 FSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSID--------NNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKT---DIFIHITDANDNYPNFDFKEKTIEILENISVGS---IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPAN--GILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVN------DNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYI--MSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            F  + T D+F   S +  + VN++D ND  P F+  +++ +I E       ++  +A D+D   N    Y I+             + I  ID ++ +++    +D E S    +H L+ A D    + + +T    + + + D NDNYP F  +  T+++ E+   G+    V    A+D D G N+ I+Y++  + G  +  ++F ++S +G + LV  +DYE+   R +  ++ A D G    S +  ++V V+D NDN P     Q   S+ EN P G  ++     D DE +  ++         +F LA+D     +  I        E  RF + ++   D   P       + + + D+NDN P F+   Y   + E+ P  T V  ++A+D D    ++L++ I   N    F I   N  G+++I  ++D ++ + F   V  TD+G  S+ + V++ I D N      +NAP S ++      E+  +  +V  +S TD+D   N   T+   +E I  + +  PF +  ++G I+    LDRE    YL+     D GN  +L+ T  V I + D+NDN P F  P  ++       I  D+   T++I + A+D D+  N ++ Y L D+        I+  +G I            ++ + A   D G+P L+S +E  I L   N
Sbjct:  432 FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDS--YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI--IGG--NTQSQFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLD--REEQGRFAF-QVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVF-----EDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGN-PSLSDTTDVEIGVTDVNDNAPAFKSPLYQAS------ILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 2 Score: 185.652 bits (470), Expect = 5.504e-47
Identity = 173/633 (27.33%), Postives = 291/633 (45.97%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESN----EFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--------FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSN----NSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL---DKTNASSF-TKINSETGEI 2304
            + +V V ++D+ND+ P F +  Y + + E      E   +   +A D D   N  +R+  I  N  + F   ID  +  +++   +DYE  S R +  ++ A D G       T + +++ DANDN P F   +    +LEN+ VG  + +  A D D G N+ I YS+S     +  +    ++  TG ++ +  +D E      F F V+A D G    S S++V++ V D+NDN P     +   ++ E++P G  V T + TD DE S+   +     + G    +  +G   I   Q  D +  +   + +   D+          +H+ I D N+  P F  A Y   + E+ P+ T V  +SA+D D     ++ +S+ + +         F+I+P  G +     +DRE    +   V   D G   LS+ + V + + DVNDNAP   + L    I E+  +  SV Q++ +D D   NG     +Y++S+    +  F +   SG I   K LDRE   ++ +  I  D G+   L++T  V I ++D+ND+ P F       K  L  P   +SP  + +  + A D D   NA + Y +   D +NA S  T+  SE  ++
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF--SIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI---KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTF----ASDKITLYVP--ENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQL 1174          

HSP 3 Score: 169.474 bits (428), Expect = 4.732e-42
Identity = 168/663 (25.34%), Postives = 298/663 (44.95%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEF-PLILLPKAID-RDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-----FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH---LSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSG---KIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS---GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFT-----KINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            P+F+++ Y  +++E       +   +A D  DS V       +D+   +LF V  D +  ++  +  +D E     + +F + ATDD        T + +++ D ND+ P F+ ++    I E  +VGS V    A+D+D G N+ I+Y +  ++    ++       F ++S +G++   + +D E      +  +V A D         + +A+V VKV+D NDN P+         + E++  G     V     TD D+ +   ++         +  S+D     ++  +  D E  R   + I   D  SP       L V +ID NDN P+F  +++   + EN+P+  N+ ++ A D D     ++ +SI + +      +DP  G +     +DREE   F F+V   D G    S  S V + + DVNDN P  +      ++ E+      V  ++ TD D  E+    ++    +    F +T     G I + + LD +++  +L+     D G     + TATV I+I D N+  P+F    E + +     +F D+P  TT++ + ATD D+  NA++TY L++ + +         IN +TG I     +D     G Y +  T  D G PSL+   +  I ++  N
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKV--DSRTGVVTTSASLDRE--LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIF----ENAPYS--ASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVN 1001          

HSP 4 Score: 163.696 bits (413), Expect = 3.408e-40
Identity = 168/661 (25.42%), Postives = 291/661 (44.02%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN----SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF--GLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-----TKSGKIILMKHLDRE--KKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSD 2370
            S S +  + VN+ID ND+ P F  S++  +++E+   P+   I+  +A D D   N    YSI    +N F + +D +   +     +D E+  Q  F F + A D G+      + + I + D NDN P F+ K     + E+   G+ V    A+D D   +S + Y ++      +   +F + S  G  L+ +   +DY+   ++ F   V ATDSG    S +ATV + + D N+  P   + +N     S+ E+ P G  VL  S TD D     Q+          GL      S++     I +    D E      + +   D  +P +     + + + D+NDN P F    Y   I E+  + T+V Q++ASD D     ++ + +    I+   F IDP +G +     +DRE +  FH      D G   LS+  +V +++ DVND+ P  ++  +T ++ EN+ +   V ++   D D+  N    +      +++ F L     ++  +++ M  LD E  +K   L+            L   A + I + D+NDN PV           +I   F D      I  + A D D+++  KL YR+   N ++  ++NS +G +          P   +++ +VSD
Sbjct:  668 SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--VPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITT----GNTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSG--GRSDTATVHINITDANNFAP---IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV-----RAASPPLRNDAHIEILVTDVNDNAPVL------RDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 196.438 bits (498), Expect = 1.848e-50
Identity = 184/701 (26.25%), Postives = 322/701 (45.93%), Query Frame = 1
Query:  439 FSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSID--------NNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKT---DIFIHITDANDNYPNFDFKEKTIEILENISVGS---IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPAN--GILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVN------DNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYI--MSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            F  + T D+F   S +  + VN++D ND  P F+  +++ +I E       ++  +A D+D   N    Y I+             + I  ID ++ +++    +D E S    +H L+ A D    + + +T    + + + D NDNYP F  +  T+++ E+   G+    V    A+D D G N+ I+Y++  + G  +  ++F ++S +G + LV  +DYE+   R +  ++ A D G    S +  ++V V+D NDN P     Q   S+ EN P G  ++     D DE +  ++         +F LA+D     +  I        E  RF + ++   D   P       + + + D+NDN P F+   Y   + E+ P  T V  ++A+D D    ++L++ I   N    F I   N  G+++I  ++D ++ + F   V  TD+G  S+ + V++ I D N      +NAP S ++      E+  +  +V  +S TD+D   N   T+   +E I  + +  PF +  ++G I+    LDRE    YL+     D GN  +L+ T  V I + D+NDN P F  P  ++       I  D+   T++I + A+D D+  N ++ Y L D+        I+  +G I            ++ + A   D G+P L+S +E  I L   N
Sbjct:  432 FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDS--YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI--IGG--NTQSQFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLD--REEQGRFAF-QVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVF-----EDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGN-PSLSDTTDVEIGVTDVNDNAPAFKSPLYQAS------ILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 2 Score: 185.652 bits (470), Expect = 5.504e-47
Identity = 173/633 (27.33%), Postives = 291/633 (45.97%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESN----EFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--------FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSN----NSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL---DKTNASSF-TKINSETGEI 2304
            + +V V ++D+ND+ P F +  Y + + E      E   +   +A D D   N  +R+  I  N  + F   ID  +  +++   +DYE  S R +  ++ A D G       T + +++ DANDN P F   +    +LEN+ VG  + +  A D D G N+ I YS+S     +  +    ++  TG ++ +  +D E      F F V+A D G    S S++V++ V D+NDN P     +   ++ E++P G  V T + TD DE S+   +     + G    +  +G   I   Q  D +  +   + +   D+          +H+ I D N+  P F  A Y   + E+ P+ T V  +SA+D D     ++ +S+ + +         F+I+P  G +     +DRE    +   V   D G   LS+ + V + + DVNDNAP   + L    I E+  +  SV Q++ +D D   NG     +Y++S+    +  F +   SG I   K LDRE   ++ +  I  D G+   L++T  V I ++D+ND+ P F       K  L  P   +SP  + +  + A D D   NA + Y +   D +NA S  T+  SE  ++
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF--SIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI---KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTF----ASDKITLYVP--ENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQL 1174          

HSP 3 Score: 169.474 bits (428), Expect = 4.732e-42
Identity = 168/663 (25.34%), Postives = 298/663 (44.95%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEF-PLILLPKAID-RDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-----FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH---LSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSG---KIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS---GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFT-----KINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            P+F+++ Y  +++E       +   +A D  DS V       +D+   +LF V  D +  ++  +  +D E     + +F + ATDD        T + +++ D ND+ P F+ ++    I E  +VGS V    A+D+D G N+ I+Y +  ++    ++       F ++S +G++   + +D E      +  +V A D         + +A+V VKV+D NDN P+         + E++  G     V     TD D+ +   ++         +  S+D     ++  +  D E  R   + I   D  SP       L V +ID NDN P+F  +++   + EN+P+  N+ ++ A D D     ++ +SI + +      +DP  G +     +DREE   F F+V   D G    S  S V + + DVNDN P  +      ++ E+      V  ++ TD D  E+    ++    +    F +T     G I + + LD +++  +L+     D G     + TATV I+I D N+  P+F    E + +     +F D+P  TT++ + ATD D+  NA++TY L++ + +         IN +TG I     +D     G Y +  T  D G PSL+   +  I ++  N
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKV--DSRTGVVTTSASLDRE--LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIF----ENAPYS--ASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVN 1001          

HSP 4 Score: 163.696 bits (413), Expect = 3.408e-40
Identity = 168/661 (25.42%), Postives = 291/661 (44.02%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN----SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF--GLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-----TKSGKIILMKHLDRE--KKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSD 2370
            S S +  + VN+ID ND+ P F  S++  +++E+   P+   I+  +A D D   N    YSI    +N F + +D +   +     +D E+  Q  F F + A D G+      + + I + D NDN P F+ K     + E+   G+ V    A+D D   +S + Y ++      +   +F + S  G  L+ +   +DY+   ++ F   V ATDSG    S +ATV + + D N+  P   + +N     S+ E+ P G  VL  S TD D     Q+          GL      S++     I +    D E      + +   D  +P +     + + + D+NDN P F    Y   I E+  + T+V Q++ASD D     ++ + +    I+   F IDP +G +     +DRE +  FH      D G   LS+  +V +++ DVND+ P  ++  +T ++ EN+ +   V ++   D D+  N    +      +++ F L     ++  +++ M  LD E  +K   L+            L   A + I + D+NDN PV           +I   F D      I  + A D D+++  KL YR+   N ++  ++NS +G +          P   +++ +VSD
Sbjct:  668 SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--VPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITT----GNTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSG--GRSDTATVHINITDANNFAP---IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV-----RAASPPLRNDAHIEILVTDVNDNAPVL------RDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 196.438 bits (498), Expect = 1.948e-50
Identity = 184/701 (26.25%), Postives = 322/701 (45.93%), Query Frame = 1
Query:  439 FSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSID--------NNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKT---DIFIHITDANDNYPNFDFKEKTIEILENISVGS---IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPAN--GILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVN------DNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYI--MSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            F  + T D+F   S +  + VN++D ND  P F+  +++ +I E       ++  +A D+D   N    Y I+             + I  ID ++ +++    +D E S    +H L+ A D    + + +T    + + + D NDNYP F  +  T+++ E+   G+    V    A+D D G N+ I+Y++  + G  +  ++F ++S +G + LV  +DYE+   R +  ++ A D G    S +  ++V V+D NDN P     Q   S+ EN P G  ++     D DE +  ++         +F LA+D     +  I        E  RF + ++   D   P       + + + D+NDN P F+   Y   + E+ P  T V  ++A+D D    ++L++ I   N    F I   N  G+++I  ++D ++ + F   V  TD+G  S+ + V++ I D N      +NAP S ++      E+  +  +V  +S TD+D   N   T+   +E I  + +  PF +  ++G I+    LDRE    YL+     D GN  +L+ T  V I + D+NDN P F  P  ++       I  D+   T++I + A+D D+  N ++ Y L D+        I+  +G I            ++ + A   D G+P L+S +E  I L   N
Sbjct:  432 FRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDS--YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI--IGG--NTQSQFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLD--REEQGRFAF-QVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVF-----EDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGN-PSLSDTTDVEIGVTDVNDNAPAFKSPLYQAS------ILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVN 1107          

HSP 2 Score: 185.267 bits (469), Expect = 5.698e-47
Identity = 173/633 (27.33%), Postives = 291/633 (45.97%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESN----EFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--------FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSN----NSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL---DKTNASSF-TKINSETGEI 2304
            + +V V ++D+ND+ P F +  Y + + E      E   +   +A D D   N  +R+  I  N  + F   ID  +  +++   +DYE  S R +  ++ A D G       T + +++ DANDN P F   +    +LEN+ VG  + +  A D D G N+ I YS+S     +  +    ++  TG ++ +  +D E      F F V+A D G    S S++V++ V D+NDN P     +   ++ E++P G  V T + TD DE S+   +     + G    +  +G   I   Q  D +  +   + +   D+          +H+ I D N+  P F  A Y   + E+ P+ T V  +SA+D D     ++ +S+ + +         F+I+P  G +     +DRE    +   V   D G   LS+ + V + + DVNDNAP   + L    I E+  +  SV Q++ +D D   NG     +Y++S+    +  F +   SG I   K LDRE   ++ +  I  D G+   L++T  V I ++D+ND+ P F       K  L  P   +SP  + +  + A D D   NA + Y +   D +NA S  T+  SE  ++
Sbjct:  564 TASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQF--SIDSMSGDVSLVKPLDYE--SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS----ERDDNFPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRI---KYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGS-PPLSSTVEVQIRLEDVNDSPPTF----ASDKITLYVP--ENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQL 1174          

HSP 3 Score: 169.474 bits (428), Expect = 4.898e-42
Identity = 168/663 (25.34%), Postives = 298/663 (44.95%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEF-PLILLPKAID-RDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-----FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH---LSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSG---KIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS---GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFT-----KINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            P+F+++ Y  +++E       +   +A D  DS V       +D+   +LF V  D +  ++  +  +D E     + +F + ATDD        T + +++ D ND+ P F+ ++    I E  +VGS V    A+D+D G N+ I+Y +  ++    ++       F ++S +G++   + +D E      +  +V A D         + +A+V VKV+D NDN P+         + E++  G     V     TD D+ +   ++         +  S+D     ++  +  D E  R   + I   D  SP       L V +ID NDN P+F  +++   + EN+P+  N+ ++ A D D     ++ +SI + +      +DP  G +     +DREE   F F+V   D G    S  S V + + DVNDN P  +      ++ E+      V  ++ TD D  E+    ++    +    F +T     G I + + LD +++  +L+     D G     + TATV I+I D N+  P+F    E + +     +F D+P  TT++ + ATD D+  NA++TY L++ + +         IN +TG I     +D     G Y +  T  D G PSL+   +  I ++  N
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKV--DSRTGVVTTSASLDRE--LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET--SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIF----ENAPYS--ASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSG-YLLTVTAKDGGNPSLSDTTDVEIGVTDVN 1001          

HSP 4 Score: 163.31 bits (412), Expect = 3.619e-40
Identity = 168/661 (25.42%), Postives = 291/661 (44.02%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN----SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF--GLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-----TKSGKIILMKHLDRE--KKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSD 2370
            S S +  + VN+ID ND+ P F  S++  +++E+   P+   I+  +A D D   N    YSI    +N F + +D +   +     +D E+  Q  F F + A D G+      + + I + D NDN P F+ K     + E+   G+ V    A+D D   +S + Y ++      +   +F + S  G  L+ +   +DY+   ++ F   V ATDSG    S +ATV + + D N+  P   + +N     S+ E+ P G  VL  S TD D     Q+          GL      S++     I +    D E      + +   D  +P +     + + + D+NDN P F    Y   I E+  + T+V Q++ASD D     ++ + +    I+   F IDP +G +     +DRE +  FH      D G   LS+  +V +++ DVND+ P  ++  +T ++ EN+ +   V ++   D D+  N    +      +++ F L     ++  +++ M  LD E  +K   L+            L   A + I + D+NDN PV           +I   F D      I  + A D D+++  KL YR+   N ++  ++NS +G +          P   +++ +VSD
Sbjct:  668 SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLEN--VPVGYNIIRVQAYDSDEGANAEITYSISERDDN-FPLAVDPRTGWVQTIKPLDREE--QGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITT----GNTRGRFAITSQNGRGLITIAQSLDYKQ--EKRFLLTVAATDSG--GRSDTATVHINITDANNFAP---IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVV-----RAASPPLRNDAHIEILVTDVNDNAPVL------RDFQVIFNNFRDHFPSGEIGRIPAFDADVSD--KLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 210.69 bits (535), Expect = 1.840e-55
Identity = 216/776 (27.84%), Postives = 346/776 (44.59%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYI----DKQAPILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGI------YRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK-HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKP-GMYSIKATVSDNGTP 2382
            + +++    NT IG   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       +  R +   + I+DEND+ P F      ++I E+     L  +P A DRDS  NG+  Y++       NLF + +    D++ P L + G +D E  DS    +   +   D G    +    + I ITDANDN P F+      E+ EN  VG  V Q  A+D D G N  + YSL   S P  +     ++  TG++ +   VD E     I  F V A D+G    S+ A V + V D NDN P        L+ H++   +I+E+ P G  V     +D DE     + C         + S  +        Y + +T + D E  +   IEI  +D+ +P +     L V + D+NDN P FS   Y  E  EEN P    V  + A+D D+    +L +SI    +    F I+P  G + + + +DRE+++++ F V   D G   L   + V VK+LD NDN P+      ++ + EN      V  ++  D+D+ EN        +  +N  F +      IL     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  + P    SP  T + ++ A D D+  N++L + +   N     +I+SE GEI     +  PK  G++ +   V D GTP
Sbjct:   35 YQVTEEQPPNTLIGS--LASDQGLPDTGHLYKLEVGAP-------YLRVDGKTGDIYTTENSIDRES-------LKDCRNLFEGDPCFLEFEVSITDLMK----GTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDS----YDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP--VMRLLSIDRNTGIIFVKGSVDREEI--SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS--VEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPA-NSSYKFLDP--RTSP-ETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAK-EFTPKHIGLHRLVVKVKDKGTP 772          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 210.69 bits (535), Expect = 2.300e-55
Identity = 216/776 (27.84%), Postives = 346/776 (44.59%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYI----DKQAPILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDG------IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK-HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKP-GMYSIKATVSDNGTP 2382
            + +++    NT IG   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       +  R +   + I+DEND+ P F      ++I E+     L  +P A DRDS  NG+  Y++       NLF + +    D++ P L + G +D E  DS    +   +   D G    +    + I ITDANDN P F+      E+ EN  VG  V Q  A+D D G N  + YSL   S P  +     ++  TG++ +   VD E     I  F V A D+G    S+ A V + V D NDN P        L+ H++   +I+E+ P G  V     +D DE     + C         + S  +        Y + +T + D E  +   IEI  +D+ +P +     L V + D+NDN P FS   Y  E  EEN P    V  + A+D D+    +L +SI    +    F I+P  G + + + +DRE+++++ F V   D G   L   + V VK+LD NDN P+      ++ + EN      V  ++  D+D+ EN        +  +N  F +      IL     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  + P    SP  T + ++ A D D+  N++L + +   N     +I+SE GEI     +  PK  G++ +   V D GTP
Sbjct:   48 YQVTEEQPPNTLIGS--LASDQGLPDTGHLYKLEVGAP-------YLRVDGKTGDIYTTENSIDRES-------LKDCRNLFEGDPCFLEFEVSITDLMK----GTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDS----YDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP--VMRLLSIDRNTGIIFVKGSVDREEI--SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS--VEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPA-NSSYKFLDP--RTSP-ETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAK-EFTPKHIGLHRLVVKVKDKGTP 785          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 210.305 bits (534), Expect = 3.090e-55
Identity = 216/776 (27.84%), Postives = 346/776 (44.59%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYI----DKQAPILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGI------YRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK-HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKP-GMYSIKATVSDNGTP 2382
            + +++    NT IG   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       +  R +   + I+DEND+ P F      ++I E+     L  +P A DRDS  NG+  Y++       NLF + +    D++ P L + G +D E  DS    +   +   D G    +    + I ITDANDN P F+      E+ EN  VG  V Q  A+D D G N  + YSL   S P  +     ++  TG++ +   VD E     I  F V A D+G    S+ A V + V D NDN P        L+ H++   +I+E+ P G  V     +D DE     + C         + S  +        Y + +T + D E  +   IEI  +D+ +P +     L V + D+NDN P FS   Y  E  EEN P    V  + A+D D+    +L +SI    +    F I+P  G + + + +DRE+++++ F V   D G   L   + V VK+LD NDN P+      ++ + EN      V  ++  D+D+ EN        +  +N  F +      IL     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  + P    SP  T + ++ A D D+  N++L + +   N     +I+SE GEI     +  PK  G++ +   V D GTP
Sbjct:   56 YQVTEEQPPNTLIGS--LASDQGLPDTGHLYKLEVGAP-------YLRVDGKTGDIYTTENSIDRES-------LKDCRNLFEGDPCFLEFEVSITDLMK----GTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDS----YDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP--VMRLLSIDRNTGIIFVKGSVDREEI--SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS--VEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPA-NSSYKFLDP--RTSP-ETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAK-EFTPKHIGLHRLVVKVKDKGTP 793          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 210.305 bits (534), Expect = 3.141e-55
Identity = 216/776 (27.84%), Postives = 346/776 (44.59%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYI----DKQAPILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD------GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK-HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKP-GMYSIKATVSDNGTP 2382
            + +++    NT IG   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       +  R +   + I+DEND+ P F      ++I E+     L  +P A DRDS  NG+  Y++       NLF + +    D++ P L + G +D E  DS    +   +   D G    +    + I ITDANDN P F+      E+ EN  VG  V Q  A+D D G N  + YSL   S P  +     ++  TG++ +   VD E     I  F V A D+G    S+ A V + V D NDN P        L+ H++   +I+E+ P G  V     +D DE     + C         + S  +        Y + +T + D E  +   IEI  +D+ +P +     L V + D+NDN P FS   Y  E  EEN P    V  + A+D D+    +L +SI    +    F I+P  G + + + +DRE+++++ F V   D G   L   + V VK+LD NDN P+      ++ + EN      V  ++  D+D+ EN        +  +N  F +      IL     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  + P    SP  T + ++ A D D+  N++L + +   N     +I+SE GEI     +  PK  G++ +   V D GTP
Sbjct:   54 YQVTEEQPPNTLIGS--LASDQGLPDTGHLYKLEVGAP-------YLRVDGKTGDIYTTENSIDRES-------LKDCRNLFEGDPCFLEFEVSITDLMK----GTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDS----YDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP--VMRLLSIDRNTGIIFVKGSVDREEI--SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS--VEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPA-NSSYKFLDP--RTSP-ETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAK-EFTPKHIGLHRLVVKVKDKGTP 791          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 209.92 bits (533), Expect = 4.282e-55
Identity = 216/776 (27.84%), Postives = 346/776 (44.59%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYI----DKQAPILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGI------YRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK-HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKP-GMYSIKATVSDNGTP 2382
            + +++    NT IG   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       +  R +   + I+DEND+ P F      ++I E+     L  +P A DRDS  NG+  Y++       NLF + +    D++ P L + G +D E  DS    +   +   D G    +    + I ITDANDN P F+      E+ EN  VG  V Q  A+D D G N  + YSL   S P  +     ++  TG++ +   VD E     I  F V A D+G    S+ A V + V D NDN P        L+ H++   +I+E+ P G  V     +D DE     + C         + S  +        Y + +T + D E  +   IEI  +D+ +P +     L V + D+NDN P FS   Y  E  EEN P    V  + A+D D+    +L +SI    +    F I+P  G + + + +DRE+++++ F V   D G   L   + V VK+LD NDN P+      ++ + EN      V  ++  D+D+ EN        +  +N  F +      IL     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  + P    SP  T + ++ A D D+  N++L + +   N     +I+SE GEI     +  PK  G++ +   V D GTP
Sbjct:   53 YQVTEEQPPNTLIGS--LASDQGLPDTGHLYKLEVGAP-------YLRVDGKTGDIYTTENSIDRES-------LKDCRNLFEGDPCFLEFEVSITDLMK----GTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDS----YDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP--VMRLLSIDRNTGIIFVKGSVDREEI--SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLS--VEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPA-NSSYKFLDP--RTSP-ETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSE-GEITLAK-EFTPKHIGLHRLVVKVKDKGTP 790          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: FAT4 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:100145590])

HSP 1 Score: 234.572 bits (597), Expect = 4.367e-62
Identity = 193/660 (29.24%), Postives = 319/660 (48.33%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK--AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQ-STTLMTYHIAENTQ-IDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            ++  D  QS    +N+T++  D ND +P F ++ Y  ++ E +  P  ++    A D DS VNG   Y++ D++ + +F  +++    + N+T  +DYE    + ++ L     DG  +  C   ++ +I D NDN P F     +  ++EN+  GS +  F  +D D G NS + Y++S  SG      +   + T  +L+L+++ + ++F   +     +A      + S S  V + ++D+NDN P  I  +   + EN P+  +V     TD D    + ++     S G      + DG  R+  T   D E      + I   D   P +     +++ ++DINDN P FSQ  +  EI E+    T++ QL ASD D      + ++II     N F ID   G+LSI   +DRE   ++  ++Q +D G         V IL  D+ND  P+   +  T  + EN + + + + Q+   D+D+  N   T+     + +  F L+ SG++ L+K LDRE K+ Y +     D G F ALT T T+SI ++DINDNKP F        H  I  I  D+P+ T I+ +  +D D  +N  + Y L+  N S FT IN  TG+I    +        Y++    +D G+P LTS
Sbjct: 1801 VRADDGLQSSDMRINITIS--DVNDHIPKFSRAVYSFDVAE-DTIPGSIVAAILATDDDSGVNGEITYAVSDDDDDGIF--FLNPVTGVFNVTRALDYE---LQQYYVLTVCAQDGGGQDSC-VRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTIS--SGDSMGQFQVSKDGTLSVLQLLDR-ETQSFYSLVVQVHDMAPPPAPRYTS-SVEVSIILLDVNDNPPSFISPKLTYVQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGEVRL--TGELDREDISNYTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRLTYSLASGNEDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDAG-FPALTGTGTISIQVEDINDNKPTFAL-----NHHFIT-IPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGN-SQFT-INPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTS 2436          

HSP 2 Score: 183.341 bits (464), Expect = 5.151e-46
Identity = 172/641 (26.83%), Postives = 295/641 (46.02%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYS---IDNNYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL------IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ------LKCDFYRSFGLAIDSVDD-GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIK-KLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTL-MTYHIA---ENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP-----FKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V + ++D ND+ P F +    ++  E  +    ++L  A D D+  NGV H S   +  N +  F + I      +   L++  +   +  +   ++ L+   D G  +      + + + D NDN P F   +   +I E+  VGS V +  A+D+D G N+ I+Y L+         T F ++  +GL+ +   +DYE+   R +T  + A D G   L+  +  +V+++D+NDN P +         +  S+ EN   G +V   + TD D  + N       L  +  R F +    V +  + ++AS+   D E      + ++  D   P  +  +  L + + DIND+ P F +     EI E+LP  + +  +SASD D      L +SI+  N   +F+I   +G+++  + +DRE        +   D G     S   + V +LDVND  P  T + +  H+    EN+ +   +  L  TD D  +NGT  F  Y  ++N       F+L   SGK+     LDRE++D   +  +  D G    L++TA V + + D+NDN PVF YP +         I  + P  + + T+ A+D DL  N  + Y +   + S F +++ ETG I
Sbjct:  113 VRITVLDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAE-------GTPFQIDPESGLVTIREPLDYES--RRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASS--LDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRF--YFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGT-PPLSSTAKVIVSLLDVNDNSPVF-YPVQ-----YFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKF-QVHPETGAI 732          

HSP 3 Score: 179.489 bits (454), Expect = 8.638e-45
Identity = 178/647 (27.51%), Postives = 314/647 (48.53%), Query Frame = 1
Query:  430 EINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSI---TENEPSGKIVLTFSFTDLDELSKNQLKCDF-YRSFGLAIDSVDDGIYRIASTQVFDAEF---NRFCW---IEINCLDNASP-IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL--DKTNASSFTKINSETGEIY 2307
            E +F  ++ + +  +++    V + + D ND+ P F  +  ++N++E+     +I   KA+D D  VNG   YS+  N  +LF  Y+D+    +++TG +D +  S   +   + A+D G+ +      + I + D NDN P FD     + +LE+  V S  ++  A+DKDSG+N  I YS+  + G  ++   F +    G L + +++D E  +  ++   V A+D     LST+  V + + D+NDN P  + +  N +    E    G  V      D D  S  ++   F        +++V      I ST  FD E     R      +++   D   P  +K    + + I DINDN+P+FS+  Y   I E     T V ++S+SD+D  +   +++SI++ N   +FT+D + G +++   +D E   ++   +Q  D+G   LS  S + +++LD NDN+P      +   + EN ++ + V+ ++ TD+D  +N    +     +N+  F ++  +G I L K LD E + LY +     D GN    ++T +V I ++D NDN P F          + K +  +    T+I+T+ ATD D + N +LTY +   K   + F  I+   G IY
Sbjct:  845 EQDFYQLKVVASGGAVTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQNPQSLF--YVDEVTGAVSLTGPLDVDTGS---YQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSI--IHG--NVGEAFGI-FPDGQLYVKSELDRE--VKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRP--LFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTG---EITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGN-PPRSSTMSVIIKVRDFNDNPPSF------PAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFV-IDEVRGTIY 1466          

HSP 4 Score: 158.688 bits (400), Expect = 2.260e-38
Identity = 159/614 (25.90%), Postives = 281/614 (45.77%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP--LILLPKAIDRDSLVNGVRHYSID-NNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTNASS 2271
            I     V++NI+D ND+ P F  +KY   + ++ +    LI +    D+D  +N    YS+   N +  F   IDK+   + +   +  +    + +   +FA D G      +  + I +T+ N + P F     ++ +LE++SVG+++    A D+D+ +N +I Y++S  SG +  +  F +N++TG L L+  +DYE  + +     + A D G +  +    V + V D+NDN P     +   S+ EN PSG  V+  + TD+D  + N +     +S    +  +D     I +    D E  +   + +   +           + V +   N+  P+F    YYFE+ E  P  T V ++ ASD D   + DV+ L F   +   F ID   G +S+   +DRE+ E    ++   + G +     ++  V + ILD ND    S  +    I+E       V  +S  D+D + + +  F  +I S N         ++G++ +   LDRE   LY +  +  D G+  A T +A + + + DINDN P        +  G +K  +    + T ++TL++TD DL  N    +Y L  T  ++
Sbjct: 2951 IMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKF--QIDKETGWITVASSLMMD--INKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNIS--SGNE--AGLFAINASTGALSLLKNLDYE--LCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDS-APNAVIAYSVQSSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDANDPPVFSLKVYNVQISEGVTPGTHVTFVSAFDSDSVPSWS-RFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTPLYNLTVLAIDSGSPSA-TGSAALLVTLDDINDNGPTL-----STTKGEVKENYR---AGTHVMTLQSTDLDLPPNQGPFSYYLLSTGPAT 3543          

HSP 5 Score: 155.606 bits (392), Expect = 1.841e-37
Identity = 128/461 (27.77%), Postives = 213/461 (46.20%), Query Frame = 1
Query: 1012 FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP-----ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR----------SFGLAIDSVDDGIY-RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ------STTLMTYHIAENTQIDQSVAQLSFTDNDK-LENGTFTFKEYIMSNNSPFKLTKS-----GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            F +NSTTG +   + +D E+ I  +   +V+++       +    V + V+DINDN P      ++V    S  E+   G+ V+  + TD D    N +    YR            G+ ++   +G +  + S    D E N   ++ +   D  +P  K+L HL V +   DINDN P FS ++Y  +IEE+ P+ ++V ++ A+D D      + + + +   F IDP +G+++I+  +D E    +   +Q  D G   L+ +S+  V+++DVNDN P         T     + EN Q+   VA L+ TD D    NG  T      +    F++  S       I +   LDRE+   Y +   V D G+    ++ A++ I++ DIND+ PVF  P  K +      I  D P  + I  + A+D D   NA L Y +   N   +  I+  +G
Sbjct:   73 FSINSTTGSIYTTSNIDRESLISDVINLVVLSS-----QPTYPTEVRITVLDINDNSPVFPEPSIVV----SFKEDTQGGRQVILDTATDSDA-GTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTP--KRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQIDPESGLVTIREPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVE------ISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSG 515          

HSP 6 Score: 154.451 bits (389), Expect = 3.997e-37
Identity = 174/676 (25.74%), Postives = 298/676 (44.08%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDR----IFTFIVIATDSGRLH-LSTSATVIVKVMDINDNVPELI--VHQNNSITENEPSGKIVLTFSFTDLDE-----LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTA--TVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPS---RTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFP 2436
            +T+++ D ND+ P F +  Y++ ++ES           A D+DS +NG   YSI   N    F ++ D Q   L +  ++D E   + L+   + A+D  +       ++ I + D NDN P F+         E  S GS V +  A DKDSG N  I Y+       +++   F LN+ TG +   ++ D E  + +     FT  V +TD G    L   ATV + + DINDN P+    ++Q  SI+E   +   VL  S +D+DE     +S + +K +  + F     ++D    ++A     D E      + I  +D+ +  +     L + ++D NDN P F +A  + ++ EN+ +   V  ++A+D D+ D   +++SI   N    F+I P  G + +   +D E    +   +   D G     S   V +K+ D NDN P       +  + EN  I  S+  ++ TD D   NG  T+   ++    N+      + G I     +DRE  +L+ +     D    +     A   V+I I D+NDN P F+           +  F   PS    + + T+ A D D   N ++ Y +   +  +F  ++  +G++      M+P   +YS+    +D G     +  E  I+L   + P
Sbjct:  969 LTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGIFPDGQ---LYVKSELDRE--VKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAF------ETMQPDFELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQA-SISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHF-----TMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVR-GTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVS----------QNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDTETFI-VDRYSGDLRV-AAPMLPSHLIYSLIVAATDLGAERKATTTELTIILEGQDGP 1614          

HSP 7 Score: 153.68 bits (387), Expect = 7.444e-37
Identity = 140/489 (28.63%), Postives = 234/489 (47.85%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLF-IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITEN-EPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAST------QVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF 1911
            SV V++ ++D ND+ P F   K       +    ++   +A D DS  N    YS+  +  N F I  ID +   + +TG++D ED S   +   + A D G        D+ I + D NDN P+F  +   +EI E+   G+ + Q +ASD D G+N +++Y++  + G  + S +F ++S TG+L +   +D E      +T  + A+D G    S +ATV + + DIND VP+  +     S+ EN E   KI+L     D D+   ++L      ++ LA  + +DG + ++S+      +  D E   +  + I   D   P +     + + + DINDN P F+   ++  I E+ P  T++  ++ SD D      + +S+   N  FTI+P+ G +   + +DRE  +++   V  TD G   L++ + V V I DVNDN P+        HI   T     V  ++ TD D   N    F
Sbjct: 2021 SVEVSIILLDVNDNPPSFISPKLTYVQENTPTDTVVFRAQATDPDSGPNSYIQYSLLGSLGNKFSIGIIDGE---VRLTGELDREDISN--YTLTIIAKDKGEPSLSSSMDMNIIVLDINDNSPHFSQRHFKVEISESTLTGTDLIQLIASDADEGINGMVRYAI--IDG--NPSNEFRIDSVTGVLSIARPLDRER--KSSYTLKIQASDRGSSPRSDTATVSILLSDINDVVPKFELSPYTVSVPENLETLPKIILQVVARDDDQGLNSRL------TYSLASGN-EDGAFTLSSSGQLSLIKSLDREVKEWYSLLITATDAGFPALTGTGTISIQVEDINDNKPTFALNHHFITIPEDAPTGTDILMVNCSDSDAGQNGVIRYSLNGGNSQFTINPSTGQIISSSLLDREAKDHYTLLVIATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHF 2491          

HSP 8 Score: 152.14 bits (383), Expect = 2.310e-36
Identity = 165/628 (26.27%), Postives = 271/628 (43.15%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFK-----EKTIEILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTS-ATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQA---KYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNF-----SIIQC-NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            VNVTV   D ND+ P F  S+Y   I E +     +L  +A DRD   N    Y +           ID ++ ++ I   +DYE  S+R +   + A D G      +++  + + D NDN P   F+      +   + EN  VG++V     +D DS   N  +  ++   +  +    +        L+K+ + +D E      +   V  +D G     +S A++++ V DIND+ P     H    I+E+ P G  +   S +D D      L+        L   S+ +    + ST   D E      + I+  D           L V ++D+ND  P F+      +   + EN  + T +  L A+D D  D   + F     +  QC   F +DP +G LS + ++DRE+ +    ++  TD G   LS+ +KV V +LDVNDN+P    +  + +I EN      VA ++ +D D   NGT  +      + S F++  ++G I     LDRE+K  Y +  +  D G   +    A V+I + D  DN P F     +  +  +  +F +      + T+ AT  DLN N  +TY +   +      I+  TG I
Sbjct:  228 VNVTVQ--DINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTP----FQIDPESGLVTIREPLDYE--SRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPS--YNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSIVSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLGINGTIRYS-IRAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDGGGLQS-HNHAIVTITVLDTQDNPPSF----SQGSYSFV--MFENVAVGYNVGTVVATTIDLNTN--ITYLVTTGDQKGVFTIDRSTGLI 835          

HSP 9 Score: 150.599 bits (379), Expect = 6.150e-36
Identity = 154/551 (27.95%), Postives = 249/551 (45.19%), Query Frame = 1
Query:  814 IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN----SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRI-------ASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKS------KHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTS 2394
            + I++ D ND+ P F      +EI E++  GS +    ASD D+G+N+ ++YS+  +SG K     F ++  +GL+   + +D E  I       + A D G    ++ AT++V ++D+ND  P       N    S+ EN   G  +L    TD D      ++  FY  F     S   G++R+       ++    D E    C ++I   D  +P +     + V ++D+NDN P F   +Y+  I+EN P  + V  ++ASD D      + +SI   +   F + P  G +S K  +DREE   +  +V  TD G L   N + V + +LD  DN P  S    ++ + EN  +  +V  +  T  D   N   T+          F + +S G I+    +DRE++D Y +  +V   G   A+T  A V+I ++D+NDN P F+   E        K G I            I   +A D D   N +++Y L K N  S   ++  TG +     +D+    G Y ++   SD G P L S
Sbjct:  446 LVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYSI--VSGNKL--GWFSISENSGLVTSTSALDRE--IAPQLLLNISARDQGPQPKTSYATLLVNLLDVNDQKPTFTGINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIR--FY--FDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVNDNSPVFYPVQYFANIQENEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGAISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMFENVAVGYNVGTVVATTIDL--NTNITYLVTTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLK-VVASGG---AVTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHI------------IFQAKAVDPDEGVNGRVSYSL-KQNPQSLFYVDEVTGAVSLTGPLDV--DTGSYQVEIIASDMGVPQLAS 965          

HSP 10 Score: 149.443 bits (376), Expect = 1.357e-35
Identity = 181/715 (25.31%), Postives = 305/715 (42.66%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNI---TGKI---DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLD-----ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKL--NFSIIQCNYFTIDPANGILSIKTNIDREEI------ENFHFEVQITDTG---QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVV 2556
            VT+ ++D  D+ P F +  Y   + E+          A+  +  V  V   +ID N N  ++V    Q  +  I   TG I      D  ++ F+ L      G      +  + I + D NDN P+F    + + ++EN   G I++Q  A D D GVN  + YSL     P+S+   FY++  TG + L   +D +      +   +IA+D G   L++S  + + V D+NDN P    +    ++ E+EP          TD D     E++ + +  +   +FG+      DG   + S    D E      ++++  D A   +    ++ + + D+NDN P F+   Y F  EE     + V ++ A D D+    ++   F  +Q + F ++   G ++     DRE +        F  +V  TD G    L +++ V + I D+NDN P+ S  L    I+E       V ++S +D D+  NG  ++   IM  N     T    +G++ L+  LD E    Y +     D G  V L+ T+T+SI + D NDN P F       K  L   +  +      + ++ ATD D  +NA + Y +  TN      I+  TG I+           +Y +  T  D G P                 P+SS+ +++ K R+F  N   F    +F + + + LI   +
Sbjct:  766 VTITVLDTQDNPPSFSQGSYSFVMFEN---------VAVGYN--VGTVVATTIDLNTNITYLVTTGDQKGVFTIDRSTGLIMTASVVDREEQDFYQLKVVASGG--AVTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLK--QNPQSL---FYVDEVTGAVSLTGPLDVDT---GSYQVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGI----FPDGQLYVKSE--LDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPD-FELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYS--IMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSG-AVPLSATSTLSIEVLDENDNSPSF------PKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNP-----------------PRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSI 1426          

HSP 11 Score: 145.591 bits (366), Expect = 2.153e-34
Identity = 184/722 (25.48%), Postives = 307/722 (42.52%), Query Frame = 1
Query:  211 ANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNN-KGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFY----RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLH---VPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSN--------NSPFKLTK-SGKIILMKHLDREK-KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
              +F+G I   +K++  N ++++   +F  +    +LN   GEI +  + DR+      G        L     ++           + +     V + I D ND+ P F K  Y  +I E ++    +L   + D D   NG+  YSI   N    F   +D     + + G++DYE ++   +  ++ A D G       + + I + D NDN P+F      ++++EN+ VG +V    A+D DSG N+ I YS   ++G  +  T F ++  TG + L  K+D+E     ++   + A D G    S++ +VI+KV D NDN P         S+ EN   G  +LT + TD D     QL         R     ID V   IY  A     D EF     + +   D A P+  + + L    + I D+NDN P F  ++  F  + +L I + +  ++A D D     ++ + II  +   F +D  +G L +   +    +  +   V  TD G     +   + I+    + P  S       + E   +  +V  +          GT +  EY + +           F + + +G I     LDRE+   LYL+     +    +  T  A V I +QDINDN PVF  P +     L   +  +    + I+ L ATD D   NA +TY +      SF +I+ E+G++
Sbjct: 1102 GGSFVGRIYAVDKDSGSNGEIMY---AFETMQPDFELNTVTGEITSTHQFDREALMRQRG---AAAFTLKVTSTDLGLP--------KPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFT--MDSSTGQVALVGRLDYEATAS--YSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFVDVVENMRVGELVSSVTATDSDSGDNADIHYS---ITGTNNHGT-FSISPNTGSIFLAKKLDFET--QALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPDADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAE---IDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFV-SQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEYEIISGDTETFIVDRYSGDLRVAAPMLPSHLI-YSLIVAATDLGAERKATTTELTIILEGQDGPVFSQPKYITILKEGEPVGTNVISIEAAS----PRGTDSVVEYFIVSVRCEGRTVGRLFTIGRNTGVIQTAAVLDRERGARLYLVDVYAIEKEASLPKTQRAQVEITLQDINDNPPVF--PTDI----LDLTVEENVGDGSKIMQLTATDADEGPNALVTYTIISGADDSF-RIDPESGDL 1783          

HSP 12 Score: 144.05 bits (362), Expect = 6.901e-34
Identity = 178/679 (26.22%), Postives = 294/679 (43.30%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP--LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENE-PSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAP--QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREK------KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN-----FPKSS 2445
            +S +  V V+++D ND+ P F   +Y  NI E NE P   +    A D D  +NG   YSI     + F V+ +  A    I+ K   +   +  +   + ATD G  +      + I + D  DN P+F     +  + EN++VG  V   VA+  D  +N+ I Y L      K +   F ++ +TGL+   + VD E      +   V+A+      ++  A V + V D+NDN P  +    N        +G I+      D DE    ++     ++   ++  VD+    ++ T   D +   +  +EI   D   P +   F L + + D+NDN P F Q  Y   + E+ P+ +  +++ A+D D+    ++ +SII  N    F I P +G L +K+ +DRE  + +  +V  +D     LS    V + + DVNDN P   ST  + Y   EN+     V ++   D D   NG   +    M  +  F+L T +G+I      DRE          + +     D G    L   ATV I+I+DINDN P F      SK      I   + + T ++ + ++D D   N  ++Y + K N      ++S TG++             YS+     D+G   L++     I +   N     FPK++
Sbjct:  656 LSSTAKVIVSLLDVNDNSPVFYPVQYFANIQE-NEPPASFVATVTASDPDLGINGTIRYSIRAGDTSKFQVHPETGA----ISTKAALDREEKTAYQLQVVATDGGGLQSHNHAIVTITVLDTQDNPPSFSQGSYSFVMFENVAVGYNVGTVVATTID--LNTNITY-LVTTGDQKGV---FTIDRSTGLIMTASVVDREE--QDFYQLKVVASGGA---VTGEAIVNITVKDLNDNSPHFVNAVENVNVVENWKTGHIIFQAKAVDPDEGVNGRVSYSLKQN-PQSLFYVDEVTGAVSLTGPLDVDTGSY-QVEIIASDMGVPQLASSFILTISVHDVNDNPPVFDQLSYEVTLLESEPVNSRFFKVYATDKDSGLNGEITYSIIHGNVGEAFGIFP-DGQLYVKSELDREVKDLYILQVSASDRAVEPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSG-GSFVGRIYAVDKDSGSNGEIMYAFETMQPD--FELNTVTGEITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKF------SKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEKHFTMDSSTGQVALVGRLDYEATASYSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAA 1306          

HSP 13 Score: 135.191 bits (339), Expect = 3.700e-31
Identity = 164/680 (24.12%), Postives = 300/680 (44.12%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNI---TGKI------DYEDSSQR------LFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVA-SDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFV-ALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQD-LNENAKLTYRLDKTNASSFTKINSETGEIYF---FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            S +VT+ + D ND+ P F K  Y ++            P+ +D  S V  V     D   N     +I  Q+ +  I   TG+I       Y++ S           F++ A+D G      +T + I+I D+NDN P F   +    + +N  +G+ + +  A  DKD G+NS + YSLS     ++I  KF ++  TG + + + +  +  I++ +   V A D G   LS+ A V + V + N + PE    H + ++ E+   G ++ T S  D D      +  +        + +++     ++  +  D E  +   + I+ +D           + + + D+NDN P F   +Y+  + EN P  T V +L+A+D+D++    + +S+   +   F IDP  GI++ +  +D E  +++H  V+  +       S   V V++   N+  P+  + + Y  ++E       V ++  +D D   +G   +  +  S    F++  K+GKI +   LDREK++   +  I  + G+   A      V+I I D ND  PVF   +Y  + S+   + P        T +  + A D D +   ++ +Y +   N      IN +TG++        +M P   +Y++     D+G+PS T      + L   N
Sbjct: 2843 STDVTIFVTDVNDNAPRFSKPSYYLD-----------YPETLDIGSKVTQVFATDSDEGLNGHVYYFIKSQSELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLST----ENIHGKFQIDKETGWITVASSLMMD--INKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVKDVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYSVQSSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFVTVTVQLEGANEYVPRFVSKLYYFEVSEAAPKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKISVSGILDREKEERISLKIIAKNVGSIRGADIDEVNVNITILDAND-PPVFSLKVYNVQISEG--VTP-------GTHVTFVSAFDSDSVPSWSRFSYFIGSGNDKGAFAINPQTGQVTVTTELDREMTP---LYNLTVLAIDSGSPSATGSAALLVTLDDIN 3492          

HSP 14 Score: 135.191 bits (339), Expect = 3.732e-31
Identity = 156/581 (26.85%), Postives = 253/581 (43.55%), Query Frame = 1
Query:  469 QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYE----DSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-----LIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN-KLNFSIIQ----CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVK-----ILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKI-----ILMKHLDREKKDLYLIPFIVYDHG-NFVALTTTATVSIHIQDINDNKPVFIYPK 2127
            + +S +VNVT+ + D ND+ P F  + Y     E N     +    A+D+DS  NG   Y+ +    +  +  +  +   +  T + D E          F   + +TD GL +  K +  + I+I D NDN+P F        I E  S  + V +  +SD D G N LI YS+   +  K     F ++S+TG + LV ++DYE      ++ I+ A DSG + LS ++T+ ++V+D NDN P      L V     + EN   G++V + + TD D      +      +      S+      I   +  D E      + I   D  +P       + + + D NDN P F     +  + EN+ I T++  ++A+D D +D+N +L ++IIQ     N+F ID   G +     IDRE    F   V+ +D        K  +K     I D+NDN P   +   +    +  I   ++ ++  D D+  NG   + E I  +   F + + SG +     +L  HL      +Y +     D G    A TT  T+ +  QD     PVF  PK
Sbjct: 1065 EPLSTTVNVTIILEDVNDNRPLFNSTNYVFYFEEENSGGSFVGRIYAVDKDSGSNGEIMYAFETMQPDFELNTVTGE---ITSTHQFDREALMRQRGAAAFTLKVTSTDLGLPKPLKDQATVQIYIRDINDNHPKFSKDLYQASISELASNMTQVLRVSSSDVDEGNNGLISYSIMKGNEEK----HFTMDSSTGQVALVGRLDYEATAS--YSLIIQAVDSGAVPLSATSTLSIEVLDENDNSPSFPKAALFV----DVVENMRVGELVSSVTATDSDSGDNADIHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQALYKLNITAKDKGNPPRSSTMSVIIKVRDFNDNPPSFPAGDIFKSVVENVLIGTSILTVTATDPD-ADINGQLTYTIIQQKPRGNHFVIDEVRGTIYTNAEIDREFANLFELTVRASDLAVPLESRKYALKNVTILISDLNDNVPTFVSQNAFAADPSLAIGSVLSTITAFDPDEGSNGEIEY-EIISGDTETFIVDRYSGDLRVAAPMLPSHL------IYSLIVAATDLGAERKATTTELTIILEGQD----GPVFSQPK 1620          

HSP 15 Score: 134.806 bits (338), Expect = 4.062e-31
Identity = 175/697 (25.11%), Postives = 312/697 (44.76%), Query Frame = 1
Query:  439 FSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL----ILLPKAIDR--DSLVN----GVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKC-KTDIFIHITDANDNYPNF--DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL--IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAS-------TQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG-----QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS---GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +S I    +  +  ++    + II E    P F + KY I I++  E P+    I +  A  R  DS+V      VR          LF   I +   ++     +D E  + RL+   ++A +   +  K  +  + I + D NDN P F  D  + T+E  EN+  GS + Q  A+D D G N+L+ Y++  +SG       F ++  +G L    ++D E      ++ +V A D  +   S+   + + + D+ND++P+    V+  + + E+   G IV     TD D     ++      ++ ++ D  DDGI+ +         T+  D E  ++  + +   D           ++  I+D+NDN P FS+  Y   + ENLP  + +   + +D D+   +KL+++I   +    F +   +G LS+   +DRE    +   VQ+ D       + ++  +V + +LDVNDN P   +    ++ ENT  D  V +   TD D   +G  ++ +Y +  +   K +     G++ L   LDRE    Y +  I  D G   +L+++  ++I + DINDN P F       +H  ++ I   + + T +I L A+D D   N  + Y +   N S+  +I+S TG +         +   Y++K   SD G+   +      I+LS  N
Sbjct: 1584 YSLIVAATDLGAERKATTTELTIILEGQDGPVFSQPKY-ITILKEGE-PVGTNVISIEAASPRGTDSVVEYFIVSVRCEG--RTVGRLFT--IGRNTGVIQTAAVLDRERGA-RLYLVDVYAIEKEASLPKTQRAQVEITLQDINDNPPVFPTDILDLTVE--ENVGDGSKIMQLTATDADEGPNALVTYTI--ISGADD---SFRIDPESGDLIATKRLDRER--RSKYSLLVRADDGLQ---SSDMRINITISDVNDHIPKFSRAVYSFD-VAEDTIPGSIVAAILATDDDSGVNGEI------TYAVSDDD-DDGIFFLNPVTGVFNVTRALDYELQQYYVLTVCAQDGGGQ--DSCVRVYFNILDVNDNPPVFSRNSYSASVMENLPPGSTILTFNVTDADDGFNSKLSYTISSGDSMGQFQVS-KDGTLSVLQLLDRETQSFYSLVVQVHDMAPPPAPRYTSSVEVSIILLDVNDNPPSFISPKLTYVQENTPTDTVVFRAQATDPD---SGPNSYIQYSLLGSLGNKFSIGIIDGEVRLTGELDREDISNYTLTIIAKDKGE-PSLSSSMDMNIIVLDINDNSPHF-----SQRHFKVE-ISESTLTGTDLIQLIASDADEGINGMVRYAIIDGNPSNEFRIDSVTGVLSIARPLDRERKSSYTLKIQASDRGSSPRSDTATVSILLSDIN 2240          

HSP 16 Score: 130.183 bits (326), Expect = 1.101e-29
Identity = 177/677 (26.14%), Postives = 290/677 (42.84%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITE--NEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY-FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKK------DLYLIPFIV--YDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRAT-DQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANF 2433
            I T      ++ + NVTVNI D ND+ P F    Y  +I   +     +      D D   N   H+S+    +  F  +ID     +   G I  E +S+    F +   D GLN     T + +   +  D +P      KT    EN  VG++V     S    G  S    S        +    F+++   G L + N +D+E      +   V A D G    S+   + + V+D+NDN P+    Q+  I E     S + +LT S  D D  S  Q++   +     A  S++     I +T+  D E      + +   D  SP    +  + + ++D NDN P+FSQ    F + EN  +   V Q++ SD D        ++I   +  F I+   G++++   ++RE+ + +   V   D+G  +  + V + + DVNDNAP+ +    Y    E   I   V Q+  TD+D+  NG   +  +I S +  F++ + +G+I   +HL  +        ++    FIV   D G+   ++ T TVSI+I D NDN P F      S      P+  ++   T +I + A  D+D   N+++ Y L   N     +I+ ETG I      M+     Y IK    D G P L+S     I +++ N+
Sbjct: 2425 IATDGGSPPLTSTTNVTVNIRDVNDNPPRFLHHPYVTHIPSPTTAGSFVFAVTVTDEDIGSNAELHFSLKGRNSEKF--HIDPLRGAIRTAGAI--EGASE--ITFSVHVRDGGLNSKTDLTTVTVRFANKAD-FPLIRADRKTFTFPENQEVGTLVSTIFGSSSRGGSLSFYIAS-------GNFGNTFHIDELNGQLYIKNPLDFETMPK--YELWVEARDMGFPPFSSYEKLEITVLDVNDNQPQF--KQDPFIAEIIENLSPRKILTISAEDKDSGSNGQVEYTIFDGNKEAFFSINRVNGEIRNTRQLDREKASQYTLSVKASDKGSPARSSIVKVIIYVLDDNDNAPRFSQIFSAF-VAENAVLGCFVTQVTTSDEDAGANAISRYTIADTSLPFHINLNTGVITVSRPLNREDNDRYIVRVSAHDSG-WTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYY--FIKSQSELFRINSTTGEIFNKQHLKYQNPSVSGNININRHSFIVSASDRGSPPIMSET-TVSINIVDSNDNAPKF------SSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNSEVGYSLSTENIHGKFQIDKETGWITVASSLMMDINKNYMIKVFAKDKGNPPLSSQALVNITVTEENY 3072          

HSP 17 Score: 120.553 bits (301), Expect = 1.063e-26
Identity = 139/569 (24.43%), Postives = 240/569 (42.18%), Query Frame = 1
Query:  808 TDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYL----NSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP-----QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNK-LNFSIIQCN---YFTID----PANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL---DVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNN--SPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNAS---SFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            T++ I + D NDN P F      +   E+   G  V    A+D D+G N +   S   +SG +    K  +    +     L L+++   +   +  +  +V   D G         V V V DINDN P     Q  + I E+ P G  VL    TD DE     ++          ID  + G+  I   +  D E  R   + I   D  +P +       V +ID+NDN P      F     Y  ++EN  + T V  L+ +D D+   N  +  +I+  N   +F +     P   ++ + +++DRE I +++  V ++D G    +S V   ++   D+ND+ P          I+E+      +  +S +D D   N    +   I+S N    F +++ SG +     LDRE     L+     D G     T+ AT+ +++ D+ND KP F      + +G +  +  +S   T ++ L+ATD DL +N  + +  D  N S      +++  +G++         +    +++   +D GTP L+S  +  + L   N
Sbjct:  111 TEVRITVLDINDNSPVFPEPSIVVSFKEDTQGGRQVILDTATDSDAGTNGVDHRSYRIVSGNQDGRFKLGITVNPSGEGAFLHLMSQGPLDRETNPCYYLLVEVEDKGTPKRLGHLQVNVTVQDINDNPPVFSSSQYQAKIEEDSPVGSSVLKVEATDRDEGPNAAIRYQLAEGTPFQIDP-ESGLVTI--REPLDYESRRQYTLSIQAKDLGTPPLTGRSEALVRLIDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNVTVAILGGNEQRHFEVQTSKVPNLSLIKVASSLDRERIPSYNLTVSVSDQGHPRPRSSVASLVIYVNDINDHPPVFQEPHSKVEISEDLPPGSYICGVSASDGDTGLNANLRYS--IVSGNKLGWFSISENSGLVTSTSALDREIAPQLLLNISARDQGP-QPKTSYATLLVNLLDVNDQKPTFT---GINVNGHLVSLPENSLVGTELLMLKATDGDLGDNGTIRFYFDADNPSQCQGLFRLDPLSGKLSNRADLDREQQDRCTLQILATDLGTPPLSSTAKVIVSLLDVN 670          

HSP 18 Score: 119.013 bits (297), Expect = 3.195e-26
Identity = 161/694 (23.20%), Postives = 302/694 (43.52%), Query Frame = 1
Query:  331 GEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAI--DRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENF-------IDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSV--------DDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS----KVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLIPFIVY-----DHGNFVALTTTATVSIHIQDINDNKPVFI---YPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            GEI+  R++DR+         +  +  L  ++     SP +        S  V V + ++D+ND+ P F  S+     +  N      + +    D D+  N +  Y+I +        +I+    ++ ++  ++ ED+ + +    + A D G   +   TD+ I +TD NDN P F      ++  E + +GS V Q  A+D D G+N  + Y +      KS S  F +NSTTG +     + Y+N        I+R  +FIV A+D G   + +  TV + ++D NDN P+    +    +++N   G  ++  +  D  +   N         + L+ +++        + G   +AS+ + D   N+   I++   D  +P +     +++ + + N + P+FSQ+     + E+L + T +  +SA D D S    + ++I   N    F I+ + G LS+  N+D E  +     +   D G ++        +YVK  DVNDN P       +  + EN     +V +L+ TD D   N    +   + S++S   +    +G I     LD E K  Y +    +     +  +FV      TV++ ++  N+  P F+   Y  E S+          +P  T +  + A+D+D   +  + Y +  ++     +I+ +TG+I
Sbjct: 2711 GEIRNTRQLDRE---------KASQYTL-SVKASDKGSPAR--------SSIVKVIIYVLDDNDNAPRF--SQIFSAFVAENAVLGCFVTQVTTSDEDAGANAISRYTIADTS---LPFHINLNTGVITVSRPLNREDNDRYIVR--VSAHDSG---WTVSTDVTIFVTDVNDNAPRFSKPSYYLDYPETLDIGSKVTQVFATDSDEGLNGHVYYFI------KSQSELFRINSTTGEIFNKQHLKYQNPSVSGNININR-HSFIVSASDRGSPPIMSETTVSINIVDSNDNAPKFSSTKYFTPVSKNAKIGTKLIKVTAVDDKDFGLNS-----EVGYSLSTENIHGKFQIDKETGWITVASSLMMD--INKNYMIKVFAKDKGNPPLSSQALVNITVTEENYHTPEFSQSHVSVTVLESLSVGTVIRTISARDRDASMNGIIAYNISSGNEAGLFAINASTGALSLLKNLDYELCQKHDLTISAVDGGWVAKTGYCVVTIYVK--DVNDNPPIFKADEYFPSVMENAPSGTTVIRLNATDVDSAPNAVIAYS--VQSSDSDLFVIDPNTGIITTQGFLDYETKQHYHLTVKAFNVPDEERCSFV------TVTVQLEGANEYVPRFVSKLYYFEVSEA---------APKGTVVGEVFASDRDGGIDGDVHYLIFGSSRKKGFQIDKKTGKI 3343          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 216.468 bits (550), Expect = 4.020e-57
Identity = 203/741 (27.40%), Postives = 332/741 (44.80%), Query Frame = 1
Query:  310 YVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLIL-LPKAIDRDSLVNGVRHYS--IDNNYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP-------ELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD------GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFI 2412
            Y++++ K G+I T    IDR+  +  C  L+  +   C ++FE++ +     D    + R ++  + I+D ND+ P F      ++I E+    ++  +P A DRDS VNGV  Y   +     +LF + +    D++ P L + G +D E   QR  + L     DG    +  + +  I I D NDN P F+      E+ EN  +G  V Q  A+D D GVN+ I YS    S   ++    +L+ +TGL+ +   +D E+       F V+A D G    +    V + + D NDN P        L+ HQ    +I+E+ P    V     +D+DE     + C         +  V D        Y + +T   D E  +   IEI  +D+ +P +     L V + D+NDN P FSQ+       EN  I   V ++SA+D D+   ++L++SI+        F+I+P +G + + T +DRE+ E++ F V   D G   L   + V + +LD NDN P+       + + EN      V  ++  D DK EN            E+++ N        +G I+     DRE +  Y       D G+    ++   V+I++ D NDN PV + P   S   L       +P    +  +RA D D   NA+L Y +   N     +I+   GE+      +    G++ +   V+D G PS   T+ + F+I
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRE-CQNLEPGE--KCFLEFEVSMT-----DLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDRE---QRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS--DTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG-------TGTILSSISFDREHQSTYTFRLKAVDGGD-PPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTP----VNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 216.468 bits (550), Expect = 5.216e-57
Identity = 203/741 (27.40%), Postives = 332/741 (44.80%), Query Frame = 1
Query:  310 YVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLIL-LPKAIDRDSLVNGVRHYS--IDNNYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP-------ELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD------GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFI 2412
            Y++++ K G+I T    IDR+  +  C  L+  +   C ++FE++ +     D    + R ++  + I+D ND+ P F      ++I E+    ++  +P A DRDS VNGV  Y   +     +LF + +    D++ P L + G +D E   QR  + L     DG    +  + +  I I D NDN P F+      E+ EN  +G  V Q  A+D D GVN+ I YS    S   ++    +L+ +TGL+ +   +D E+       F V+A D G    +    V + + D NDN P        L+ HQ    +I+E+ P    V     +D+DE     + C         +  V D        Y + +T   D E  +   IEI  +D+ +P +     L V + D+NDN P FSQ+       EN  I   V ++SA+D D+   ++L++SI+        F+I+P +G + + T +DRE+ E++ F V   D G   L   + V + +LD NDN P+       + + EN      V  ++  D DK EN            E+++ N        +G I+     DRE +  Y       D G+    ++   V+I++ D NDN PV + P   S   L       +P    +  +RA D D   NA+L Y +   N     +I+   GE+      +    G++ +   V+D G PS   T+ + F+I
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRE-CQNLEPGE--KCFLEFEVSMT-----DLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDRE---QRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS--DTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG-------TGTILSSISFDREHQSTYTFRLKAVDGGD-PPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTP----VNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 216.853 bits (551), Expect = 5.932e-57
Identity = 203/741 (27.40%), Postives = 332/741 (44.80%), Query Frame = 1
Query:  310 YVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLIL-LPKAIDRDSLVNGVRHYS--IDNNYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP-------ELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD------GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFI 2412
            Y++++ K G+I T    IDR+  +  C  L+  +   C ++FE++ +     D    + R ++  + I+D ND+ P F      ++I E+    ++  +P A DRDS VNGV  Y   +     +LF + +    D++ P L + G +D E   QR  + L     DG    +  + +  I I D NDN P F+      E+ EN  +G  V Q  A+D D GVN+ I YS    S   ++    +L+ +TGL+ +   +D E+       F V+A D G    +    V + + D NDN P        L+ HQ    +I+E+ P    V     +D+DE     + C         +  V D        Y + +T   D E  +   IEI  +D+ +P +     L V + D+NDN P FSQ+       EN  I   V ++SA+D D+   ++L++SI+        F+I+P +G + + T +DRE+ E++ F V   D G   L   + V + +LD NDN P+       + + EN      V  ++  D DK EN            E+++ N        +G I+     DRE +  Y       D G+    ++   V+I++ D NDN PV + P   S   L       +P    +  +RA D D   NA+L Y +   N     +I+   GE+      +    G++ +   V+D G PS   T+ + F+I
Sbjct:   99 YLRVDGKTGDIYTTETSIDRESLRE-CQNLEPGE--KCFLEFEVSMT-----DLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDRE---QRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS--DTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG-------TGTILSSISFDREHQSTYTFRLKAVDGGD-PPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTP----VNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 812          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 216.468 bits (550), Expect = 7.719e-57
Identity = 203/741 (27.40%), Postives = 332/741 (44.80%), Query Frame = 1
Query:  310 YVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLIL-LPKAIDRDSLVNGVRHYS--IDNNYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP-------ELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD------GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFI 2412
            Y++++ K G+I T    IDR+  +  C  L+  +   C ++FE++ +     D    + R ++  + I+D ND+ P F      ++I E+    ++  +P A DRDS VNGV  Y   +     +LF + +    D++ P L + G +D E   QR  + L     DG    +  + +  I I D NDN P F+      E+ EN  +G  V Q  A+D D GVN+ I YS    S   ++    +L+ +TGL+ +   +D E+       F V+A D G    +    V + + D NDN P        L+ HQ    +I+E+ P    V     +D+DE     + C         +  V D        Y + +T   D E  +   IEI  +D+ +P +     L V + D+NDN P FSQ+       EN  I   V ++SA+D D+   ++L++SI+        F+I+P +G + + T +DRE+ E++ F V   D G   L   + V + +LD NDN P+       + + EN      V  ++  D DK EN            E+++ N        +G I+     DRE +  Y       D G+    ++   V+I++ D NDN PV + P   S   L       +P    +  +RA D D   NA+L Y +   N     +I+   GE+      +    G++ +   V+D G PS   T+ + F+I
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRE-CQNLEPGE--KCFLEFEVSMT-----DLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDRE---QRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQAS--DTVRRLLHLDRSTGLITVQGPIDREDV--GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNG-------TGTILSSISFDREHQSTYTFRLKAVDGGD-PPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTP----VNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 206.838 bits (525), Expect = 3.658e-54
Identity = 213/792 (26.89%), Postives = 354/792 (44.70%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVL---CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ + + +  N  IG          IP         ++L++ KT    L+   +    GEI  T  +IDR+          C  IVL   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP AID D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + + D NDN+P F  KE  + I EN  +GS V Q  A+D D G N+ I +  S L    +I+ + F+LN+TTGL+ +   +D E         +V+ATD G       ATV+V V DINDNVP +    IV+  N    ++EN P    +   +  D D     ++ C         +  V    + + +    D E  R   I++   D   P + +   L + + D NDN P F+Q+     + EN      + ++SA+D D+    ++++ +       F +D   GIL+    +DRE+ E ++F V   D G   L + + V+V +LD NDN+P  T     +++ E+     +V  ++ TD D  EN   T    I+  N  F +  +SG I      DRE+++ Y   ++  + G  V+ ++TA V+I++ D+NDNKP+FI P        + P    +   T +  + A D D+  NA++ Y +   N      I   +G I      M+   G++ +    +D G P
Sbjct:    4 LSGTYIFAVLLACVVFQSGA---QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVY-KTGDVPLIRIEE--GTGEIFTTGARIDREK--------LCAGIVLDARCFYEVEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSH--KLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLS--ILDVNDQFTIDPQSGVIRPNISFDRERQESYTF-YVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLP---STNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Celsr1 (cadherin, EGF LAG seven-pass G-type receptor 1 [Source:MGI Symbol;Acc:MGI:1100883])

HSP 1 Score: 208.379 bits (529), Expect = 4.606e-54
Identity = 167/622 (26.85%), Postives = 297/622 (47.75%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHIT--DANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHL-STSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF--------GLAIDSVDDG--------IYRIASTQVFDAEFNR----FCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP-FKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTY 2244
            S +  +TV + D ND  P F++S+Y   I E+ E    +L  +A D D+  N    Y +      +F   ID ++ ++     +D E++++  +  L+ A D G N         +HI   D NDNYP F  K   +++ E+++V + V +  A+D+D G N+ I YS+  +SG  ++  +FYL+S +G L ++N +D+E    R +T  + A D GR  L ++S  V V+V+D+NDN P  +      ++ EN P G  VL     D D     +L+   YR          G ++DS +          I+  +      AE +R         +  +D+ SP +     + + ++D+NDN P F+Q  Y   + E+  + ++V  L A D D + V  + + +   N       +     G++++   +D ++   +   V  +D G  S+ ++V++ + D N + P   ++  T  ++E+  +  S+A +S TD D  EN   T   Y++ +  P F++   +G I  M  LD E +  Y +     D+G     + T ++ I I D NDN P F+    +        +F D+P  T+++ + ATD+D   N +L Y
Sbjct:  349 SAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAGGVF--EIDARSGVVRTRAVVDREEAAE--YQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSI--VSG--NLKGQFYLHSLSGSLDVINPLDFEAI--REYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQ---YRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDANSV--ITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASD-GTRSHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARIT---YVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNG-IPQKSDTTSLEILILDANDNAPRFLRDFYQGS------VFEDAPPSTSVLQVSATDRDSGPNGRLLY 944          

HSP 2 Score: 171.785 bits (434), Expect = 1.433e-42
Identity = 180/688 (26.16%), Postives = 297/688 (43.17%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI----DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR--LHLSTSATVIVKVMDINDNVPEL-----IVHQNNSITENEPSGKIVLTFSFTDLDE---------LSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--------------------FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK---SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP--SLTSWMEFFIVLSQANFPK 2439
            P F    Y +++ E+      ++  +A D D    G   Y +    D   N  F+  ID     +     +D E     +    + A D G       T + + ++D ND+ P F+  E    I EN+ VG  V    A+D D+  N+ ++Y L  L G   +   F +++ +G+++    VD E   +  +  +V A D GR    LS SATV + V D NDN P+      +V     +  N      VL    TD D+         +    LK  FY  S   ++D ++            D E  R   + I   D    P+I     + V ++D+NDN P F  + +   + EN+P+  +V  + A D D  +  +L + ++                        F I  ++G +++   +DREE+E++ F V+  D G   +S+ + V + +LDVNDN P  T  +    + E+  +  SV  L   D D   N   T++    +  + F L+     G I L   LD +++  Y++     D       + TA V I++ D N ++PVF     +S H  +  +  D P  T+I T+ ATD+D  ENA++TY L+      F +I+ +TG IY            Y++  T  DNG P  S T+ +E  I+ +  N P+
Sbjct:  258 PQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNGYFL--IDAATGAVTTARSLDRETKDTHVLK--VSAVDHGSPRRSAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRL--LEGAGGV---FEIDARSGVVRTRAVVDREEAAE--YQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVN----TAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINP----------LDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDG----TRSHTAQVFINVTDANTHRPVF-----QSSHYTVS-VSEDRPVGTSIATISATDEDTGENARITYVLEDP-VPQF-RIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPR 906          

HSP 3 Score: 149.828 bits (377), Expect = 8.322e-36
Identity = 149/572 (26.05%), Postives = 251/572 (43.88%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNL----------------FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ---LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKP 2109
            V+V ++D ND+ P F  S +   ++E+   PL   +L  +A+D D+  N    Y + +  + +                F   I   +  + +  ++D E+     + F + A D G         + I + D NDN P F      + + E+ +VGS V    A D+D+  NS+I Y L+      +   +F L+S +G  L+ L   +DY+   +R +   V A+D  R H   +A V + V D N + P     H   S++E+ P G  + T S TD D  +    +  +     +    +D     I +    D E      + I   DN  P       L + I+D NDN P+F +  Y   + E+ P  T+V Q+SA+D D+    +L ++          F I+P +G++  +  +DRE +  ++      D G    LS    + V +LD+NDN P      +   + EN+ +   VA++   D D+  N    ++  I+  N P  F+L   SG +  +  LD E +  Y++  +V        L + ATV I + D NDN P
Sbjct:  566 VSVQVLDVNDNAPIFVSSPFQAAVLEN--VPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEH--YSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTG----GNTRNRFALSSQSGGGLITLALPLDYKQ--ERQYVLAVTASDGTRSH---TAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDED--TGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQ--IVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYML--VV--QATSAPLVSRATVHIRLLDQNDNPP 1114          

HSP 4 Score: 137.502 bits (345), Expect = 4.973e-32
Identity = 118/462 (25.54%), Postives = 217/462 (46.97%), Query Frame = 1
Query:  448 IQTIDNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP-IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ 1800
            ++ +D+   ++S S +V++ ++D ND+ P F +  Y++ + E       +L  +A DRD+  N V  Y +   N  N F +       ++ +   +DY+   Q   + L     DG      +  +FI++TDAN + P F     T+ + E+  VG+ +    A+D+D+G N+ I Y L      +    +F ++  TG +  + ++DYE+     +T  + A D+G    S + ++ + ++D NDN P  +      S+ E+ P    VL  S TD D     +L   F        D       G+ R  + +  D E      +    +D  SP  +     + V ++DINDN P F + +    +EEN P+ + V ++ A+D D     ++ + I++ N    F +D  +G L     +D E   ++   VQ T +  L +++ V++++LD NDN P+
Sbjct:  672 VEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQ---YVLAVTASDGTRSHTAQ--VFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVL------EDPVPQFRIDPDTGTIYTMTELDYED--QAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIR--TQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQAT-SAPLVSRATVHIRLLDQNDNPPE 1115          

HSP 5 Score: 91.2781 bits (225), Expect = 5.529e-18
Identity = 96/366 (26.23%), Postives = 172/366 (46.99%), Query Frame = 1
Query:  175 SHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDN-FQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDG-LNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ---NNSITENE---PSGKI 1242
            SH + ++S++    T I  I  T+++  EN ++ +      + V   +++ + G I T+ ++D +D                Q  + +    I   DN     S + ++ + I+D ND+ P F +  Y  ++ E +     +L   A DRDS  NG   Y+     +     YI+  + ++    ++D E+ +  +++    A D G  N       I + + D NDN P F+  E  + + EN  VGS+V +  A+D D G N+ I Y +  + G  ++   F L+  +G L+ + ++D+E  + R +  +V AT +    L + ATV ++++D NDN PEL   Q   NN +T      PSG I
Sbjct:  807 SHYTVSVSEDRPVGTSIATISATDEDTGENARITY---VLEDPVPQFRIDPDTGTIYTMTELDYED----------------QAAYTLA---ITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVA--VYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQI--VEG--NVPEVFQLDLLSGDLRALVELDFE--VRRDYMLVVQATSA---PLVSRATVHIRLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGVI 1139          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 206.453 bits (524), Expect = 9.450e-54
Identity = 213/792 (26.89%), Postives = 354/792 (44.70%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVL---CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ + + +  N  IG          IP         ++L++ KT    L+   +    GEI  T  +IDR+          C  IVL   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP AID D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + + D NDN+P F  KE  + I EN  +GS V Q  A+D D G N+ I +  S L    +I+ + F+LN+TTGL+ +   +D E         +V+ATD G       ATV+V V DINDNVP +    IV+  N    ++EN P    +   +  D D     ++ C         +  V    + + +    D E  R   I++   D   P + +   L + + D NDN P F+Q+     + EN      + ++SA+D D+    ++++ +       F +D   GIL+    +DRE+ E ++F V   D G   L + + V+V +LD NDN+P  T     +++ E+     +V  ++ TD D  EN   T    I+  N  F +  +SG I      DRE+++ Y   ++  + G  V+ ++TA V+I++ D+NDNKP+FI P        + P    +   T +  + A D D+  NA++ Y +   N      I   +G I      M+   G++ +    +D G P
Sbjct:    4 LSGTYIFAVLLACVVFQSGA---QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVY-KTGDVPLIRIEE--GTGEIFTTGARIDREK--------LCAGIVLDARCFYEVEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSH--KLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLS--ILDVNDQFTIDPQSGVIRPNISFDRERQESYTF-YVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLP---STNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 206.453 bits (524), Expect = 9.450e-54
Identity = 213/792 (26.89%), Postives = 354/792 (44.70%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVL---CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ + + +  N  IG          IP         ++L++ KT    L+   +    GEI  T  +IDR+          C  IVL   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP AID D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + + D NDN+P F  KE  + I EN  +GS V Q  A+D D G N+ I +  S L    +I+ + F+LN+TTGL+ +   +D E         +V+ATD G       ATV+V V DINDNVP +    IV+  N    ++EN P    +   +  D D     ++ C         +  V    + + +    D E  R   I++   D   P + +   L + + D NDN P F+Q+     + EN      + ++SA+D D+    ++++ +       F +D   GIL+    +DRE+ E ++F V   D G   L + + V+V +LD NDN+P  T     +++ E+     +V  ++ TD D  EN   T    I+  N  F +  +SG I      DRE+++ Y   ++  + G  V+ ++TA V+I++ D+NDNKP+FI P        + P    +   T +  + A D D+  NA++ Y +   N      I   +G I      M+   G++ +    +D G P
Sbjct:    4 LSGTYIFAVLLACVVFQSGA---QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVY-KTGDVPLIRIEE--GTGEIFTTGARIDREK--------LCAGIVLDARCFYEVEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSH--KLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLS--ILDVNDQFTIDPQSGVIRPNISFDRERQESYTF-YVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLP---STNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 206.453 bits (524), Expect = 1.008e-53
Identity = 213/792 (26.89%), Postives = 354/792 (44.70%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVL---CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ + + +  N  IG          IP         ++L++ KT    L+   +    GEI  T  +IDR+          C  IVL   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP AID D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + + D NDN+P F  KE  + I EN  +GS V Q  A+D D G N+ I +  S L    +I+ + F+LN+TTGL+ +   +D E         +V+ATD G       ATV+V V DINDNVP +    IV+  N    ++EN P    +   +  D D     ++ C         +  V    + + +    D E  R   I++   D   P + +   L + + D NDN P F+Q+     + EN      + ++SA+D D+    ++++ +       F +D   GIL+    +DRE+ E ++F V   D G   L + + V+V +LD NDN+P  T     +++ E+     +V  ++ TD D  EN   T    I+  N  F +  +SG I      DRE+++ Y   ++  + G  V+ ++TA V+I++ D+NDNKP+FI P        + P    +   T +  + A D D+  NA++ Y +   N      I   +G I      M+   G++ +    +D G P
Sbjct:    4 LSGTYIFAVLLACVVFQSGA---QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVY-KTGDVPLIRIEE--GTGEIFTTGARIDREK--------LCAGIVLDARCFYEVEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLV--SNIAKRLFHLNTTTGLITVKEPLDREESPSH--KLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLS--ILDVNDQFTIDPQSGVIRPNISFDRERQESYTF-YVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLP---STNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q6V0I7|FAT4_HUMAN (Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 1.130e-54
Identity = 187/676 (27.66%), Postives = 325/676 (48.08%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK--AIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRL---HLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQL--SNKSKVYVKILDVNDNAPQ-STTLMTYHIAEN-TQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPS-LTSWMEFFIVLSQAN 2430
            ++  D  QS    +N+TV+  D ND  P F +  Y  +I E +  P  L+    A D DS VNG   Y I N  +   I +++    + N+T  +DYE    + ++ L    +DG  +F     ++ +I D NDN P F     +  ++EN+ VGS V  F  +D D G+NS + YS++        S   +     G+LK++  +D E+     +  +V   D  ++     +++A V + ++D+NDN P  +  +   I EN P   +V     TD D    + ++       G   +I ++ DG  R+  T   D E      + +   D   P +     + V ++DINDN P F+QA Y  EI EN    T++ Q+ A+D D     ++ + I+  N    F ID   G +++   +DRE+   +H  VQ TD G    ++ S V + +LD+ND  P    +  + ++ EN   + +++ Q+   D+D+  N   ++  +  + ++ F L+ SG++ + + LDRE K+ +++     D G+  ALT T T+++ + D+NDN P F      +       I  D+P+ T ++ + A+D D ++NA +  R+   N S FT IN  TG+I    +        Y++    SD G+P  L+S     + ++  N
Sbjct: 1814 VRADDGLQSSDMRINITVS--DVNDHTPKFSRPVYSFDIPE-DTIPGSLVAAILATDDDSGVNGEITY-IVNEDDEDGIFFLNPITGVFNLTRLLDYE---VQQYYILTVRAEDGGGQFTT-IRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIA-----SGDSLGQFTVDKNGVLKVLKALDRES--QSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTI-DGEVRL--TGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGS-PALTGTGTINVIVDDVNDNVPTF------ASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVI--RIIGGN-SQFT-INPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVN 2460          

HSP 2 Score: 204.527 bits (519), Expect = 6.954e-52
Identity = 201/665 (30.23%), Postives = 320/665 (48.12%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVD-DGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA-SSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            ++   V + + D ND+ P F     D+ + E+  +   I+   A+D D   N +  Y+I +  ++ F   ID ++  L  T ++D E   +R  + LL   DDGL     +  I I ++D ND+ P F     + +I E+   GS+V   +A+D DSGVN  I Y    +         F+LN  TG+  L   +DYE  + + +   V A D G     T+  V   ++D+NDN P   ++  + S+ EN P G  VL F+ TD D+   +QL         L   +VD +G+ ++   +  D E   F  + +   D    P  +      V II  D+NDN P F   K  + I EN PI T V++  A+D D+   + + ++++    N F+I   +G + +   +DREE+ N+   V  TD GQ  LS+ ++V V +LD+NDN P  +  L    I ENT     + Q+   D D+  NG   +     + N  F++ + +G I + K LDREK   Y +     D G+    T T+TVSI + DIND  PVF    E S + +  P    +  R TI+ + A D D   N+KL+Y L   N  ++FT   S +GE+     +D   K   + +  T +D+G+P+LT      +++   N
Sbjct: 1721 TQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSF--RIDPESGDLIATRRLDRE---RRSKYSLLVRADDGLQSSDMR--INITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITY----IVNEDDEDGIFFLNPITGVFNLTRLLDYE--VQQYYILTVRAEDGGGQF--TTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKV--LKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTY-IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGS-TPRTDTSTVSIVLLDINDFVPVF----ELSPYSVNVPENLGTLPR-TILQVVARDDDRGSNSKLSYVLFGGNEDNAFTL--SASGELGVTQSLDRETKE-RFVLMITATDSGSPALTGTGTINVIVDDVN 2358          

HSP 3 Score: 183.726 bits (465), Expect = 1.919e-45
Identity = 173/627 (27.59%), Postives = 300/627 (47.85%), Query Frame = 1
Query:  430 EINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP-LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDF---YRSFGLAIDSVDDGIYRIASTQVFDAE--FNR-----FCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL 2250
            E +F  ++ + +  +++    V + + D ND+ P F ++   +N++E+ +    I   KA+D D  VNG+  YS+  N  NLF   I+++   +++ G +D    S   +   + A+D G+ +      + +++ D NDN P FD     + + E+  V S  ++  ASDKDSG N  I Y+++   G    +   + +   G L + +++D E   DR +  +V+A+D     LS +  V V + D+NDN P L    N +    E + +G  V   S  D D     +++  F      F L   S +     I +T  FD E    R     F +  I         +K    +HV + DINDN P+F +  Y   I E+    T V ++SASD+D  +   +++SII+ N    F ID  +G +++   +D E    +   +Q  D+G   L++   + + ILD NDN P    + +   + EN +I + V+ ++ TD+D  +N    +     +N+  F ++  +G I L K LD E + LY +     D G     ++T +V IH++D NDN P F          + K I  + P  T++I++ A D D + N +L+Y +
Sbjct:  858 EQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFA--INEKNGTISLLGPLDVHAGS---YQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIA--EGNTGDAFGIFPD---GQLYIKSELDRE-LQDR-YVLMVVASDRAVEPLSATVNVTVILEDVNDNRP-LFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGE-----ITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGR-PPRSSTMSVVIHVRDFNDNPPSF------PPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTI 1459          

HSP 4 Score: 175.252 bits (443), Expect = 9.472e-43
Identity = 177/645 (27.44%), Postives = 289/645 (44.81%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYS---IDNNYNNLFIVYI----DKQAPILNIT--GKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL------IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ------LKCDFYRSFGLAIDSVDD-GIYRIASTQVFDAEFNRFCWIEINCLDN--ASP-----IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKT--NIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIA--ENTQIDQSVAQLSFTDNDKLENGTFTFK-EYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V V + D ND+ P F      +   E S+    ++L  A D D   NGV H S   I  N    F + I      +   L++   G +D E + Q  +  L+   D G  + +    + + + D NDN P F        + E+  VGS V Q  A+D D G N+ I+Y L      +   T F ++  TGL+ +   +D+E    R ++  V A D G   L+  A  +++++D+NDN P +         +  S+ EN   G +V   + TD D  + N       L  +  R F +    V +  + ++AS    D E      + ++  DN  A P         +  L + + DIND+ P FSQ  Y   + E  P  + V  +SA+D D+     L +SI+  N   +F I   +G+++  +   +DRE        +   D G     S  ++ V +LDVND  P  +    Y ++  EN      +  L  TD D  +NGT  F  +   ++   F+L   SG++  +  LDRE++  Y +  +  D G+    ++ A +++ + DINDN PVF YP +   H     I  + P  + I T+ ATD DL  N  + Y +   + S F ++N+++G I
Sbjct:  121 VRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQ--YQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRL------QDEGTPFQMDPETGLITVREPLDFE--ARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVAS--ALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGS-PPQSSMARINVSLLDINDNSPVF-YPVQYFAH-----IKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRF-QVNAQSGVI 745          

HSP 5 Score: 166.392 bits (420), Expect = 5.075e-40
Identity = 181/680 (26.62%), Postives = 306/680 (45.00%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDR----IFTFIVIATDSGRLH-LSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDE-----LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKE-YIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTA--TVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSR---TTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFP 2436
            +S SV +TV + D ND+ P F +  Y++ + ES          +A D+DS  NG   Y+I + N  + F ++ D Q   L I  ++D E   Q  +  ++ A+D  +       ++ + + D NDN P F+    T    E    GS V +  A DKD G N  ++YS       + +   F L++ +G +   ++ D E+ + R    +F+F VIATD G    L   ATV V + DINDN P+ +      +I+E+  +   VL  S +D+DE     +  + +K +  R F  AIDS    +  I      D E      + I  +D+ +  +     L++ I+D NDN P F ++  + ++ EN+ I   V  ++A+D D+ D   L +SI   N    F+I P  G + +   +D E    +   +   D G+    S   V + + D NDN P       +  I EN  I  SV  ++  D D   NG  ++     M   + F + +  G I     +DRE  +L+ +     D    +     A   V+I + D+NDN P+FI     S++ L        PS    + + T+ A D D   N ++ Y +   +  +F  ++  +G++      ++P   +Y++  + +D G     S  E  I+L   + P
Sbjct:  976 LSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQ---LYIKSELDRE--LQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSF------EMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQF--AIDSTSGQVTLIGK---LDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI-----SQNALAA-----DPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFI-VDRYSGDLRVASA-LVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGP 1627          

HSP 6 Score: 164.851 bits (416), Expect = 1.452e-39
Identity = 182/673 (27.04%), Postives = 310/673 (46.06%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFP--LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTN-ASSFTKINS----------ETGEIYFFYIDMIPK----PGMYS---IKATVSD-NGTPSLTSWMEFFI 2412
            VT+NI+D ND+ P F KSKY   + ++ +    LI +    D+D  +N    Y I N+ N+L    +D     +++   +   D +Q  F   + A D G      +  + I +T+ N + P F     +  I E+ S+GSIV    A D+D+ +N LIKYS+S  SG +     F +NS+TG+L L   +DYE  + +     + A D G +  +   +V V V+D+NDN P  +      ++ EN PSG  V+  + TD D    N +     +S    +  +D     I +    D E  +   + +   +           +++ +   N+  P+F    YYFEI E  P  T V ++ ASD D   + +V+ L F   +   F I+   G + +   +DRE+ E    +V   + G +     ++  V V +LD ND    +  + +  I+E   I   V  +S  D+D + + +  F  +I S N     +   ++G+I +   LDRE   +Y +  +  D G   A T +A++ + ++DINDN P+    + +        +  +    T ++TL++TD DL  N    TY L  T  A+S+  +++          +  +I  FY+ ++ K    P M S   +  TV D N  PS +  +E F+
Sbjct: 2969 VTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISND-NHLGKFKLDNDTGWISVASSL-ISDLNQNFF-ITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSIS--SGNE--EGIFAINSSTGILTLAKALDYE--LCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADS-GTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWS-RFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSA-TGSASLLVTLEDINDNGPMLTVSEGE--------VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFV 3621          

HSP 7 Score: 163.696 bits (413), Expect = 2.900e-39
Identity = 194/736 (26.36%), Postives = 323/736 (43.89%), Query Frame = 1
Query:  271 LLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI------DYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDL--DELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY------------FFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            +LFG     N  N   L+  GE+   + +DR+ ++         + VL  I    + SP  T       + ++NV V+  D ND++P F    Y   I E       +LL  A D D+  N V           + I+  + Q  I   TG+I      D E  ++  +  ++  +D G  E     T + + +TD NDN P F        I      GS V+    +D D G NS + YSLS  +     S KF+++   G +     ++  + +    TF V   D G    + S TV V+ ++  D        Q     EN+P   +V T + + L  + +S      +   +F      +D    +++ +Q  D E  +   + I   D   P       L + ++D+NDN P F +  +  EI ENL     +  +SA D D+    +L++ I+  N    F+I+ A G +     +DRE++ ++   ++ +D G  S  +  KV + ILD NDNAP+ + + + H+ EN+ +  +V +++ +D D   N    +   IM  + PF +  S G I++ + L+RE  D Y I    +D G     T +  V+I + DINDN P F     ++ + L  P   +  S+ T +   ATD D   N ++ Y +   + S + +IN+ TGEI+            F  +++      +S   T SD G PSL S
Sbjct: 2298 VLFGG----NEDNAFTLSASGELGVTQSLDRETKE---------RFVL-MITATDSGSPALTG------TGTINVIVD--DVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAV-----------IRIIGGNSQFTINPSTGQIITSALLDRE--TKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRN-----SEKFHIDPLRGAIMAAGPLNGASEV----TFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTF-----QIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPR-KILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYS--IMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNAPRF----SRTSYYLDCPELTEIGSKVTQVF--ATDPDEGSNGQVFYFI--KSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNI----NRHSFIVTSSDRGKPSLIS 2965          

HSP 8 Score: 155.221 bits (391), Expect = 1.249e-36
Identity = 170/634 (26.81%), Postives = 296/634 (46.69%), Query Frame = 1
Query:  463 NFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLF--ATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL--IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQL------KCDFYRSFGLAIDSVDDGIYRIASTQVF-DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN-KLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
             F   S    + + ++D ND+ P F++  +   I+E+     IL   A+D+DS  NG   Y I N N  N F   I+     +     +D E    ++ H++L   ++D G         + I+I D NDN P F  +  +  + EN  +G  V +   SD+D G+N++ +YS+   S P      F +N +TG + +   ++ E+  DR +   V A DSG    + S  V + V DINDN P      +  +     E   K+   F+ TD DE S  Q+      + +++R      +  +  I +  +   F +   NR  +I +   D   P +     + + I+D NDN PQF ++KY+  + +N+ + T + +++A D  +  +N ++ + I   N+   F +D   G +S+ +++  +  +NF   V   D G   LS+++ V++ + + N + P+ S + M+  I E+  I   V  +S  D D   NG   +     +    F +  S G + L K LD E    + +     D G +VA T   +V++++ D+NDN PVF+             +  ++PS TT+I L ATD D   NA + Y +  +++  F  I+  TG I
Sbjct: 2645 GFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSF--SINHATGEIRSVRPLDRE----KVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLP------FTINPSTGDIVISRPLNRED-TDR-YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFA-TDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFI-VTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAID-GGWVARTGYCSVTVNVIDVNDNSPVFL------SDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFV-IDPNTGVI 3250          

HSP 9 Score: 154.836 bits (390), Expect = 1.833e-36
Identity = 168/635 (26.46%), Postives = 273/635 (42.99%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFK-----EKTIEILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTT----GLLKLVNKVDYENFIDRIFTFIV-----IATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDD--GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC----NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            VNVTV   D ND+ P F  S Y   + E       +L   A D D   N    Y + +         +D +  ++ +   +D+E  ++R +   + A D G+     + +  I + D NDN P   F+      +   + EN  VG++V     +D DS   N  I   +  L G +     F + S+      L+K+ + +D E       T  V         +     S+ A++++ V DIND+ P     V++ N ++E  P G  V   S TD D      L+       GL    + +  G+    S+   D E      + I+  D           L V ++D+ND  P FSQ + Y   + EN P  T +  L A+D D  D   + FS+ +       F +DP +G LS  +++DREE   +   V  TD G    S+ +++ V +LD+NDN+P    +  + HI EN      +  +S TD D   NGT  +      + S F++  +SG I     LDRE+K  Y +  +  D GN  +    A V+I + D  DN PVF     +  +  +  +F +      + ++ A+  DLN N  ++Y +   +      IN  TG++
Sbjct:  236 VNVTVQ--DINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPF---QMDPETGLITVREPLDFE--ARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQI--LGGNE--QRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVN-LSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYS-ISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQS-PNQAIVTITVLDTQDNPPVF----SQVAYSFV--VFENVALGYHVGSVSASTMDLNSN--ISYLITTGDQKGMFAINQVTGQL 848          

HSP 10 Score: 150.984 bits (380), Expect = 2.359e-35
Identity = 152/605 (25.12%), Postives = 270/605 (44.63%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFF-QKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGL-AIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHI--AENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF------IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLD 2253
              + V ++D ND  P F Q   YD++++E+      +L+ +A D D   NG   +S+     +     +D  +  L+    +D E+  Q  +  L+ ATD G         I + + D NDN P F   +    I EN   GS +    A+D D G N  +KYS+S  +G +S   +F +N+ +G++     +D E      +   ++ATD G L     A V + V+D  DN P    V  +  + EN   G  V + S + +D  S            G+ AI+ V     ++ +  V D E   F  +++     +   +     +++ + D+NDN P F QA     + EN     +++Q  A D D      + +S+ Q   N F I+  NG +S+   +D     ++  E+  +D G  QLS+   + V + DVNDN+P    L +Y +  +E+  ++    ++  +D D   NG   +     +    F +   G++ +   LDRE +D Y++  +  D      L+ T  V++ ++D+NDN+P+F       Y +E+ + G            + +  + A D+D   N ++ Y  +
Sbjct:  566 AQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREE--QAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSIS--AGDRS---RFQVNAQSGVISTRMALDREE--KTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTG---QLTTANVIDREEQSFYQLKVVA---SGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHA-GSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQL-SYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRA-VEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAG------------SFVGKVSAVDKDFGPNGEVRYSFE 1140          

HSP 11 Score: 149.058 bits (375), Expect = 1.011e-34
Identity = 182/696 (26.15%), Postives = 313/696 (44.97%), Query Frame = 1
Query:  298 NLVNYVQLNNK-GEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG------LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS----FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLI---PFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            N+ N   +N+  GEI+++R +DR+         +    VL  I+     SP Q        S SV V +NI+DEND+ P F +  +  ++ E++  PL   +      D D  +N +  YSI    +      I+     + I+  ++ ED+ +  +   + A D G   +   TD+ I +TD NDN P F      ++  E   +GS V Q  A+D D G N  + Y +      KS S  F +N+TTG      +LK  N   + N      +FIV ++D G+  L +  TV + ++D NDN P+ +  +    +T+N   G  ++  +  D  +   N  + +++ S     G      D G   +AS+ + D   N+  +I +   D  +P +     +H+ + + N + P+FSQ+     I E+  I + V  +SA D D +    + +SI   N    F I+ + GIL++   +D E  +     +   D G ++      V V ++DVNDN+P   +   +  + EN     +V  L+ TD D   N    +   + S++S   +    +G I     LD E K  Y +    F V D        + ATV+I ++  N+  P F+     SK    + I   +P  T +  + A+D+DL  + ++ Y +   +     +IN +TG+IY
Sbjct: 2711 NMENSFSINHATGEIRSVRPLDRE---------KVSHYVLT-IKSSDKGSPSQ--------STSVKVMINILDENDNAPRFSQ-IFSAHVPENS--PLGYTVTRVTTSDEDIGINAISRYSI---MDASLPFTINPSTGDIVISRPLNREDTDR--YRIRVSAHDSG---WTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFI------KSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNS-EVEYFISNDNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYT--VQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDE----ERCSFATVNIQLKGTNEYVPRFV-----SKLYYFE-ISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIY 3356          

HSP 12 Score: 145.206 bits (365), Expect = 1.702e-33
Identity = 193/731 (26.40%), Postives = 308/731 (42.13%), Query Frame = 1
Query:  184 SFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNN-KGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNF-QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLH---VPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHI-AENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--------SGKIILMKHLDREKKD-LYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            +F   +  +A +F+G +   +K+   N ++ +   SF  +    +L+   GEI    + DR+             ++  +     +F+ I T     Q +     V V + D ND+ P F K  Y   I ES      +L   A D D   NG+ HYSI   N    F   ID  +  + + GK+DYE  +   +  ++ A D G         + I I D NDN P+F      +++LEN+ +G +V    A+D DSG N+ + YS   ++G  +  T F ++  TG + L  K+D+E     ++   + A D GR   S++ +V++ V D NDN P         SI EN P G  V++ +  D D     QL         R     ID V   IY  A     D EF     + +   D A PI  + + L    + + D+NDN P F  ++     + +  I + +  + A+D D     ++ + II    + F +D  +G L + + +   ++  ++  V  TD G    KS   + I+    + P  T      I  E   I  +V  +        E      + YI+S     K           +G I     LDRE+   LYL+     +       T  A V I +QDINDN PVF  P +     + + I   S     I+ L A D D   NA +TY +      SF +I+ E+G++
Sbjct: 1106 TFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRY---SFEMVQPDFELHAISGEITNTHQFDRE------------SLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFA--IDSTSGQVTLIGKLDYE--ATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYS---ITGTNNHGT-FSISPNTGSIFLAKKLDFET--QSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAE---IDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFI-SQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDLRVASALVPSQLI-YNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSE---APVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVF--PTDMLDLTVEENIGDGS----KIMQLTAMDADEGANALVTYTIISGADDSF-RIDPESGDL 1796          

HSP 13 Score: 143.28 bits (360), Expect = 5.454e-33
Identity = 140/543 (25.78%), Postives = 244/543 (44.94%), Query Frame = 1
Query:  814 IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLD-------ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTS 2394
            + I + D ND+ P F  +   + + E    GS V    A+D DSG+N+ ++YS+   +G       F+++  +GL+   +    +  +       + A D G     + A ++V ++D+ND  P     +    S+ EN P+G  +L    TD D         S  + + D  RSF L  D V     R+++    D E   F  + +   D  SP    +  ++V ++DINDN P F   +Y+  I+EN P  + +  +SA+D D      + +SI   +   F ++  +G++S +  +DREE   +  ++  TD G L   N++ V + +LD  DN P  S    ++ + EN  +   V  +S +  D   N   ++          F + + +G++     +DRE++  Y +  +V   G    +T    V+I ++D+NDN P F+   E         +  +  +  +I   +A D D   N  + Y L K N  +   IN + G I     +D+    G Y I+   SD G P L+S
Sbjct:  461 LVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNG----LGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETD-RRSFRL--DPVSG---RLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDL--NSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLK-VVASGG---TVTGDTMVNITVKDLNDNSPHFLQAIESVN------VVENWQAGHSIFQAKAVDPDEGVNGMVLYSL-KQNPKNLFAINEKNGTISLLGPLDV--HAGSYQIEILASDMGVPQLSS 978          

HSP 14 Score: 140.969 bits (354), Expect = 3.061e-32
Identity = 178/679 (26.22%), Postives = 296/679 (43.59%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDRE----KKDLYLIPF--IVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF-YIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN-----FPKSS 2445
            S    + V+++D ND+ P F   +Y  +I E+      I    A D D   NG   YSI     + F   ++ Q+ +++    +D E+ +   +   + ATD G  +   +  + I + D  DN P F     +  + EN+++G  V    AS  D  +NS I Y ++  +G +     F +N  TG L   N +D E   ++ F  + +    G +   T   + VK  D+NDN P  +   ++ ++ EN  +G  +      D DE     +     ++     AI+  +  I  +    V    +     IEI   D   P +     L V + D+NDN P F Q  Y   + E+ P+ +  +++ ASD D+    ++ ++I + N    F I P +G L IK+ +DRE  + +   V  +D     LS    V V + DVNDN P  ++T  T++  E  +    V ++S  D D   NG   +   ++  +  F+L   SG+I      DRE    ++   +  F  I  D G    L   ATV ++++DINDN P F+      K      I   + + T ++ + A+D D   N  + Y + K N      I+S +G++     +D    P  YS+     D+GT  L S     I +   N     FPKS+
Sbjct:  670 SSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRF--QVNAQSGVISTRMALDREEKTA--YQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMD--LNSNISYLIT--TGDQ--KGMFAINQVTGQLTTANVIDRE---EQSFYQLKVVASGGTVTGDTMVNITVK--DLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQ----IEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFP-DGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD--FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFL------KDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPA-YSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKST 1319          

HSP 15 Score: 136.346 bits (342), Expect = 8.908e-31
Identity = 169/675 (25.04%), Postives = 302/675 (44.74%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNG---------VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVA-SDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---NYFTIDPANGILSIKTNIDREEIENFHFEVQ---ITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFV-ALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQD-LNENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            S +VT+ + D ND+ P F ++ Y ++  E  E    +    A D D   NG           ++ I+     +F   I K     N+TG   + + +     F++ ++D G      +T + I+I D+NDN P F   +    + +N+ VG+ + +  A  DKD G+NS ++Y +S      +   KF L++ TG + + + +  +  +++ F   V A D G   LS+ ATV + V + N + PE    H + +I E+   G IV T S  D D      +K          I +++     +   +  D E  +   + I+ +D           + V +ID+NDN P F    Y+  + EN P  T V  L+A+D D S  N +    +Q    + F IDP  G+++ +  +D E  +++H  V+   + D  + S  + V +++   N+  P+  + + Y  I+E       V ++  +D D   +G   +  +  S    F++  K+G+I +   LDREK++   +  +  + G+   A     TV++ + D ND  P+F   IY  + S+           P  T +  + A D D +   ++ +Y +   N +    IN +TG+I     +D    P +Y++     D+GTPS T      + L   N
Sbjct: 2855 STDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQ---NVTG---FSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISN----DNHLGKFKLDNDTGWISVASSLISD--LNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDAD-SGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCS-FATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISE---------GVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLP-IYNLSVLAVDSGTPSATGSASLLVTLEDIN 3504          

HSP 16 Score: 134.42 bits (337), Expect = 2.972e-30
Identity = 159/646 (24.61%), Postives = 286/646 (44.27%), Query Frame = 1
Query:  448 IQTIDNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-----RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDS--VD--DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-IQC------NYFTIDPANGILSIKTNIDREEIENFH----FEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIF-YDSPSRTT----IITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            IQ +D+    ++ +  + ++I+DEND+ P F KS   ++++E+     L+    A D DS  N   +YSI    NN     I      + +  K+D+E  +Q L+   + A D G         + IH+ D NDN P+F   +    I+ENI +G+ V    A D D+ +N  + Y++     P+     F ++   G +    ++D E     +F   V A D       R +   + T++V   D+NDNVP  I     +   +   G ++ T    D DE +  +++   Y       D+  VD   G  R+AS  V     ++  +  I    +  P  +K     + II    + P F+Q KY   ++E  PI TNV  + A+    S+     + + ++C        FTI    GI+     +DRE+    +    + ++ +     + +++V + + D+NDN P   T ++   + EN      + QL+  D D+  N   T+   I   +  F++  +SG +I  + LDRE++  Y +  +  D G     ++   ++I + D+ND+ P F            +P++ +D P  T     +  + ATD D   N ++TY +++ +      +N  TG
Sbjct: 1285 IQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSI-TGTNNHGTFSISPNTGSIFLAKKLDFE--TQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTII-QQMPRG--NHFTIDEVKGTIYTNAEIDRE--FANLFELTVKANDQAVPIETRRYALKNVTILV--TDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIE---YEIINGDTDTFIVDRYSGDLRVASALVP----SQLIYNLIVSATDLGPERRK-STTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYT-IISGADDSFRIDPESGDLIATRRLDRERRSKYSL-LVRADDG---LQSSDMRINITVSDVNDHTPKF-----------SRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITG 1896          

HSP 17 Score: 119.013 bits (297), Expect = 1.693e-25
Identity = 119/465 (25.59%), Postives = 203/465 (43.66%), Query Frame = 1
Query: 1012 FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSIT----ENEPSGKIVLTFSFTDLDELSKNQLKCDFYR--------SFGLAI---DSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII-QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ------STTLMTYHIAENTQIDQSVAQLSFTDNDK-LENGTFTFKEYIMSNNSPFKLTKS-----GKIILMKHLDREKKDLYLIPFIVYDH-----GNFV-ALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            F +NS+TG L   + +D E+    +   +V+++       +    V V V D+NDN P   V  + SI     E+  SG+ V+  + TD D +  N +    YR         F L I    S +     + S    D E      + +   D   P  +    ++V + DINDN P F  + Y   + E+  + ++V Q++A+D D      + + +  +   F +DP  G+++++  +D E    +   VQ  D G   L+ +++  +++LDVNDN P         T     + EN Q+   VA L+ TD D    NG  + +    +    F++  S       I +   LDRE+   Y +   V D+     G  V A ++ A++ I + DIND+ PVF      S+      +  ++P  + +  + ATD D   NA L Y +   N   +  I+  +G
Sbjct:   81 FAINSSTGALYTTSTIDRESLPSDVINLVVLSSAP-----TYPTEVRVLVRDLNDNAP---VFPDPSIVVTFKEDSSSGRQVILDTATDSD-IGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVF------SQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSG 530          

HSP 18 Score: 113.62 bits (283), Expect = 6.670e-24
Identity = 135/575 (23.48%), Postives = 240/575 (41.74%), Query Frame = 1
Query:  808 TDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNST------TGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP-----QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNK-LNFSIIQCN---YFTID----PANGILSIKTNIDREEIENFHFEVQITD------TGQLSNKSKVYVKIL---DVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKLTKSGKIILM---KHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLD--KTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            T++ + + D NDN P F      +   E+ S G  V    A+D D G N +   S   + G +  + +F L+ T         L LV+K   +  +   +  +V   D G         V V V DINDN P     H    + E+   G  VL  +  D DE +   ++   YR         +D     I   +  D E  R   + +  +D   P +       + ++D+NDN P      F     Y  ++EN  + T V  L+ +D D+   N  ++  I+  N   +F +     P   ++ + + +DRE I +++  V ++D         +  +S V   ++   D+ND+ P  S  +   +++E       V+ +S TD D   N    +   I+S N    F +++   ++       LDRE     ++     D G    + + A + + + D+ND KPVF  P+     G    +  ++P+ T ++ LRATD DL +N  + + L   +T+  SF +++  +G +         +   YS+    +D G+P  +S     + L
Sbjct:  119 TEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNE--AGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIR---YRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYS--IVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKV-SYAQLVVTLLDVNDEKPVFSQPE-----GYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSF-RLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSL 679          

HSP 19 Score: 77.411 bits (189), Expect = 7.305e-13
Identity = 95/362 (26.24%), Postives = 160/362 (44.20%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPK-AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLL--FATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFY--------RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENL 1542
            V + +   N+ +P F    Y   I E+     I+    A DRD   +G  HY I  N+    F   I+K+   + ++G +D E   +     L   F +  G +  +   ++   + DAND  P F     +++I E + +G+ V    A D DS + S  ++S     G  + +  F +N  TG + +  ++D E     I+   V+A DSG    + SA+++V + DINDN P L V +   + EN+  G +V+T   TD D L  NQ    +Y          F L+   V      +++T+  D E     ++ +   D+  P +     +H+ +ID NDN  Q    + +     NL
Sbjct: 3284 VNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF--QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNV--TVLDANDP-PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDS-IPSWSRFSY--FIGSGNENGAFSINPQTGQITVTAELDRETL--PIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGE-VMENKRPGTLVMTLQSTDPD-LPPNQGPFTYYLLSTGPATSYFSLSTAGV------LSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNL 3627          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q24292|DS_DROME (Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3)

HSP 1 Score: 210.69 bits (535), Expect = 7.895e-54
Identity = 187/665 (28.12%), Postives = 305/665 (45.86%), Query Frame = 1
Query:  481 RSVNVTVNIIDENDSLPFFQKSKYDINIIESN--EFPLILLPKAIDRD-SLVNGVRHYSIDNNYNNLF----------IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIV-----HQNNSITENEPSGKIVLTFSFTDLDELSK-NQLKCDFYRSFG-LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-----CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENG--TFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNG 2376
            R++ V V + DEND+ P F ++   I   E+   E    LLP A D D    N  R+  +  N N+ F          ++Y+D     L I+G +D E +    +  L+ A D G    +    + I I D NDN P F+       + EN +VG+ V Q  ASD D+  N L++Y+++     K     F ++  TG + +   +D+E     +   +V+A D G   L T+A V ++V D+NDN P + V       +  I+E+   G+ V   S  D D  ++   +        G  A+ + D+ IY +      D E      + +   D  +P +     + + I D+NDN P+F Q  Y+  + E     T+V Q+ A D D    + L +S+ +       +F IDP  G+++ +++ID E        V   D G   LS+ + V V I DVNDN P    +     +AEN  + + + ++S +D D   N    +T  E           + SG+I +   LD E++  Y  P +  D G    L+TTA + + + D+NDN+PVF YP+E        P      S T I+ + ATD D     +++YR+   N +   +I+  TGEI+    DM+    +P M+ +  + +D G
Sbjct:  103 RNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLD-----LQISGFLDRETTPG--YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFET--KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQP-MHMLNISATDGG 750          

HSP 2 Score: 190.274 bits (482), Expect = 1.653e-47
Identity = 185/693 (26.70%), Postives = 302/693 (43.58%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-----DNNYNNLFIVYIDKQAPILNITGKI----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLP----------------IYTNVYQLSASDLDNS-DVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK----VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK--EYIMSNN-------SPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVA--LTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRT--TIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF-----YIDMIPKPGMYSIKATVSDNGTP 2382
            S+S ++ + V++ D ND+ P F+K +Y +N+ ES      I+   A D D+  N    Y I     DN  N++    + +   I   +G I      +  ++  +   + ATD+G      KT + + + DANDN P F   +    I EN+  GS+V    ASD D G N+ I+YSL P      I++ F ++  TG +     +D E  +  ++  +V A D G    S    V + V D+NDN PE+   Q +  S+ E +P G  V+     D D      +     +   S G  + S+D     I +  V D E      + +   D  +P  + +  L V ++D+NDN P F+ +   F + E+                  +  N  + S  DL  +  +N L   +I+   F ID  +G L +   +DRE    F  E++  DT   +N       V +++ DVNDNAP+     +   ++E T +   +   + TD D   NG   ++   Y    N       S F++ + +G + L   LD E    YL+     D  + V   L T+ TV + I D ND+ P F+ P   S  G    +F    +R    +  + A D+D  +N +LTY +   N     +INS+TG I          + + K G +++     D+G P
Sbjct:  962 SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRE--LRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAA-FDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP--NSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1643          

HSP 3 Score: 166.007 bits (419), Expect = 6.640e-40
Identity = 163/673 (24.22%), Postives = 292/673 (43.39%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNL----FIVYIDKQAPILNI---TGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTD--IFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---------------NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDK---TNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            +S +  + + + D ND+ P F   +Y +++ ES        PKA  + S    V   + D +Y N     + +    +A I  I   TG+I     D      +  H L  +  DG N  +   D  +F+ I DA    P F+       + E+I  G++V   +A+  D    S ++YS+   SG       F + + +G +++   +D+E    +    + I    G   +     V ++V D+NDN PE        S+ E+   G  +      D D  S  Q+     +  G  + ++D     +  +Q  D E ++   + +   D   P +     + V + D+NDN P F + +Y   + E+  I   + Q++ASDLD  +  ++ + I+                  +F I P +G + ++  +DRE  + +   V  TD G  +   K++V V++LD NDN P+   +   + I EN +    V  ++ +D D  EN    +   ++  NS F++   +G+I   + LDRE ++LY +     D G  V  +    V IH+ D+NDN P    P+E      +  +  + P  T ++ +RA D+D  +NA +TY + K   ++      I+  +G I    +    +  +Y +    SD G P
Sbjct:  642 LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES--------PKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI--YSGDPD--GYFSIETNSGNIRIAKPLDHEA---KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYS--LLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQED-----VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP 1290          

HSP 4 Score: 151.369 bits (381), Expect = 2.080e-35
Identity = 174/721 (24.13%), Postives = 306/721 (42.44%), Query Frame = 1
Query:  418 QIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI--------DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLN---EFKCKTDIFIHITDANDNYPNF------DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKV-----DYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDN------ASPIIKK-----------------LFHLHVPIIDINDNYPQFSQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS---KVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF-IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA--SSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            Q +F +    + T  +    S ++ V + + D ND+ P + +   D+ + E+     I+    A D D+  NG   Y +        ++    + +  +D     L++   +D+E   + L   ++ A D   N     +    + + I DAND+ P+F        K  ++ I +   +G +V   VA D+DSG N  + Y ++  +G      +F +NS TG+++LV  +     D E      F  I+ A D G+     S+  +  ++  + N P   +      +I EN PSG  VL  +   L       L  +        +  VD     I +   FD E      + +   D       +S  ++K                 +  +++ + D+NDN P+F     Y   + EN      ++ + ASDLD      L +SI   N    F+ID ++G LS +  +DRE+   +  ++Q +D GQ  ++     + + + D NDNAP+   +  T  + E+  +  SV Q+S  D D   N       Y ++N + ++     +SG I  +  LDRE +  Y    +  D G +   + T  V I++ DINDN+P+F  YP       LI+P         T++ ++A D DL  NA++ Y L+  N+  S+  +IN  TG +            +  ++    D G P  +S
Sbjct: 1393 QSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLL--IVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG----EGRFRINSQTGIIELVKSLPPATEDVEK--GGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARP-LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLV---YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQP-------GQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2093          

HSP 5 Score: 144.821 bits (364), Expect = 1.770e-33
Identity = 165/679 (24.30%), Postives = 296/679 (43.59%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGS-----IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK------EYIMSNNSPFKLTK-------SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTII-TLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +S +  V V I D ND+ P F +S Y++++ E+      IL   A D D  VN + +Y+I   + +L    +   +  + I G++D+E  S   + F + ATD G         I + +TD NDN P F  +E  + + E+    S      +   VA+D D G    + Y +  ++G +  +  F ++ +TG + +V           +    + ATD G L  +  A V + ++D     P       N  + E+ P G +V +      D   ++ ++   Y        S++     I   +  D E      + I       P+      +++ + D+NDN P+F  +     + E+  +   +Y   A D D+    ++ +S+++ +    F ID  +G L +  ++D E  +     V  TD G   LS    + V + DVNDN P       + +++E+  I+  + Q++ +D D   N   T++      + + ++ S   +++       SG I L   LDRE +D Y +  +  D+G   A   T  + + + D NDN P F    +KSK+        ++  R +++  + A+D DL ENA + Y L   N SSF +++  TGEI            +Y +     D GTP  ++ +   I +S  N
Sbjct:  538 LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSS--YEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI--VAGNE--AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKF----QKSKYEF---RIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN-SSF-QVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVN 1197          

HSP 6 Score: 138.272 bits (347), Expect = 1.821e-31
Identity = 154/631 (24.41%), Postives = 266/631 (42.16%), Query Frame = 1
Query:  619 SLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ---NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDA---EFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPI-----YTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANG-ILSIKTNIDREEIENFH-FEVQITDTGQLSNKSK--VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPF-------IVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +L  G  H+++    N++++V +    P+       D E  S   +   + ATD G         IF+ ITD NDN P F+       ++E    G+ V Q +A D+D G+NS + YSL+    P++ +  F ++  TGL+   + +D E   + +    V+A D G   LS++ATV+V + D+NDN P  I  Q   N S+ ENEP G+ +L  S +D D      +      + G     + +   R AS ++  A   +F R    E   L      +     + + + D+NDN P F   +Y   + E+         T +  + A+D D  +  ++++ I+  N    F ID + G I  ++ ++     +  H   +  TD G L + +   V++ I+D     P        Y++ E+      V  +     D        +  Y    +  F + T SG I + K LD E K   L+          VY H           V+I ++D+NDN P F    E S   +  P    +     +    A D+D   + ++TY L K +      I++ +G +             +++  T +D G PSL++ +   + +   N
Sbjct:  383 TLNGGDGHFALTTRDNSIYLVIV--HLPL-------DREIVSN--YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLA--ETPETHAQWFQIDPQTGLITTRSHIDCET--EPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP--IFDQSFYNVSVAENEPVGRCILKVSASDPD----CGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGH---------TQVNIEVEDVNDNAPEF----EASMVRISVP--ESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVN 977          

HSP 7 Score: 134.035 bits (336), Expect = 3.529e-30
Identity = 160/677 (23.63%), Postives = 279/677 (41.21%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVY---------------IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNS-----LIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR---LHLSTSATVIVKVMDINDNVPELIVHQNNS-------ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAS-TQVFD------------AEFNRFCWIEINCLDNASPIIKKL-FHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITD-------------------------TGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V ++D ND+ P F  S     + E      ++     I+R + V  VR+ S++ ++ +L + Y               ID+ +  L +   +D E  S+         T    N       + I + D NDN P +      +++ E   VG+I++ F A+D D+G N      LI+Y        +   + F ++S TG L L   +D+E   +  +  IV A D        L TS TV ++++D ND+ P  +   ++        I++    G++V      D D     QL  +     G       +G +RI S T + +             +  RF  I I   D+  P  KK   +LH+ +   ++N P+F QA Y   I EN+P  + V Q++A  L  ++   L++ I   +  + F +D   GI++ +   DRE   ++   V + D                          GQ  + + +Y+ + DVNDN+P+      Y   + EN++    +  +  +D D+  N    +     +  + F +  S   +  + LDRE+   Y +     D G   +      ++I ++D NDN P F   K          +  D+P  T+++ + A D DL  NA+L Y L       F  I+ ++G I
Sbjct: 1300 VEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADV--VRN-SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQE--YLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG-------EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLI-IGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSE-PGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGS------VQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFA-IDGQSGLI 1955          

HSP 8 Score: 114.775 bits (286), Expect = 3.071e-24
Identity = 138/550 (25.09%), Postives = 235/550 (42.73%), Query Frame = 1
Query:  865 KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR-----SFGLAIDSVDDGIY--RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLM-----TYHIAENTQIDQSVAQLSFTDND-KLENGTFTFKEYIMSNNSPFKLTKSGK----IILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKT--NASSFTKINSETGEIYF-FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +E+ +E+ E ++V    YQ        G++S   Y +   +G   + T   ++  TG ++   K+D E    R    +V    SGR     +  V+V V D NDN P       +    EN P           DLD    N  + +        +F L+     DG+    +  +   D E      + I  LD  +P ++    +++ I D+NDN P F+Q++Y+  + EN  + T+V Q+ ASD D  +   + ++I      +   F IDP  G + I   +D E  E     V   D G+  L   + V +++ DVNDN P    +      +  I+E+ Q  + VA++S  D D K E         +   +  F LT        +I+   LDRE    Y +  +  D G    L  + ++ + I D+NDN P F   ++   H  +  +   +   T+++ + A D+D   N+ LTY L +T    + + +I+ +TG I    +ID   +P +  +     D G P L+S     + +   N
Sbjct:   27 RERKLEVFEGVAVD---YQIGYIGDFGGIDSGPPYIIVAEAG---VETDLAIDRATGEIRTKVKLDRET---RASYSLVAIPLSGR-----NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVT--LNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGT-PPLHASKSIFLRITDVNDNPPEF---EQDLYHANVMEV---ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEP-VPQLTVVARDGGVPPLSSTATVLVTIHDVN 552          

HSP 9 Score: 114.005 bits (284), Expect = 5.192e-24
Identity = 128/529 (24.20%), Postives = 243/529 (45.94%), Query Frame = 1
Query:  811 DIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF---GLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF--SQAKYYF-------EIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--FTIDPANGILSIKTNIDREEIE---NFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMT----YHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNN--SPFKLTKSGKIILMKHLDREKKDLYLIPFIV-YDHG----NFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRA--TDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            ++ I + D NDN P F  K+    + E  + G+ V Q  A D D+G N+ ++Y +   +   +   +    + +G+++    +D E  I  I+   +IATD G   ++ +AT+ V+++D+NDN P    +   +++E    G ++ + S  D+D       +     +     ++I ++D    ++   +  D E  +   +++   D A    +    L V + D NDN P F   Q   YF       EI E+L +  ++  ++A+D D+   N     II+     F++ P+NG++S+  +  +  +    ++   +   D G+ + KS   +++   NDN    +  +       I+E   +   V QL     D L+         I++ N  S F+L +S  I+L+K LDRE+ DLY +  ++ + HG    + +  ++  +V I I D NDN P+F   +       I  +   +P R +I  L+A   DQ+   N+++ Y +   N      I+  TG ++
Sbjct: 2254 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIE---PAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV-QANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDALDQSL-----AIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF--DRSAKYEAEISEL---APLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLF 2760          

HSP 10 Score: 102.449 bits (254), Expect = 1.813e-20
Identity = 151/673 (22.44%), Postives = 271/673 (40.27%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILN--ITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN----------NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRF---------CWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQIT--------DTGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREK-KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-----DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG 2376
            + + + DEND+ P F + ++   + E +N+   +    A D D+  N  +R++ +D N++N F++      P  +  +   I  +   + ++   + ATD+G+ +      I + I D NDN P F      + + E   +G+++    A+D D+      +         +++S  F L+  +G L L  ++DYE  + + +   VIA+D+          + V+V D NDN P  +  Q           + I+E+      +LT + TD D    N             I+   +G     S  V     +R           ++ I   D   P +K    L V   D      QF Q +Y  +I E  P+ + V QL    LD S       +II  N    F +  +  I+ +K  +DRE  + +   + ++         +   S+   V + ILD NDN P       Y   I+E   +  S+AQL   D D+           I S N     T    +G + +   LD +     Y +     D  +   L +     + + D NDN+P F  P  +  H L +    + P  +++    A+D D     +L Y +     D+++   F +++SE+G +   ++    +   Y ++   SD G
Sbjct: 2255 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVI-----EPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI-FALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNS-------KVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF--PLTEYVHFLAE----NEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMF-RVDSESGLVTSAFVFDYEQRQRYDMELLASDMG 2894          

HSP 11 Score: 100.138 bits (248), Expect = 1.001e-19
Identity = 96/363 (26.45%), Postives = 164/363 (45.18%), Query Frame = 1
Query: 1432 SPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPA-NGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF---KEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTT---IITLRATDQDLN-ENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP---KPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQ 2469
            +P +     L + + D NDN P+FSQ ++   + E     T V Q+ A D D     +L + I+  N+   F I+PA +GI+     +DRE  + +  ++  TD G  Q++  + + V+I+DVNDN P         ++E T++   +  +S  D D     T+         + N S F L + SGK++L + LD E +  Y +  I  D     A      +++ + D NDN PVF+  +  +   ++  I   S S +    ++T+ ATD D    N+K+ Y ++   A     ++   G +      + P     G Y ++    D G P+L S     ++  QAN   S  +  L  Q
Sbjct: 2246 APFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP--AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST---LLRVQANDNGSGRSQFLQNQ 2599          

HSP 12 Score: 99.3673 bits (246), Expect = 1.477e-19
Identity = 163/682 (23.90%), Postives = 279/682 (40.91%), Query Frame = 1
Query:  448 IQTIDNFQSISR----SVNVTVNIIDENDSLPFFQK------SKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKI-----DYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIH--ITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH-LSTS----------------------ATVIVKVMDINDNVPELIVHQ--NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG------LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK---VYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP----FKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            +Q +D   +++     SV V + I+D ND  P F            + I ++     ++    A+D DS  NG   Y I    N      I+ Q  I+ +   +     D E   +  F+ ++ A D G  E K K+ + +H  +  +++N P F        ILEN+  GS V Q  A       N+ + Y +     P  ++   F+++   G++    + D E+     +   V   D+ R   LS+S                      AT+ + V D+NDN PE         S+ EN   G ++ T   +DLDE     L    Y   G       +IDS    +    S +  D E +    ++I   D   P  ++  H ++ I   D NDN P+F  +KY   ++E+ P+ T+V Q+SA D D     +L +S+       F ID  +G+++    +DRE   +++F V  TD G+   +S    V + +LD+NDN P          +    Q  Q++ ++   D D   N    +   + + NS     F++  S G +   + L  E   L  +  +  D GN    ++   + + I +     PV  +  E  +  L +    +SPS T ++ + A   D     K+ +     N      ++S +GEI
Sbjct: 1516 VQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-NGEGRFRINSQTGIIELVKSLPPATEDVEKGGR--FNLIIGAKDHGQPEPK-KSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI-----PAGVANDLFHVDWQRGIITTRGQFDRES--QASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADL---IYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS--LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGN-PPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKE----NSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEI 2169          

HSP 13 Score: 96.2857 bits (238), Expect = 1.376e-18
Identity = 156/674 (23.15%), Postives = 282/674 (41.84%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQK-SKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDN-NYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFK---CKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHL-STSATVIVKVMDINDNVPELIVHQNNSITENEPS----GKIVLTFSFTDLDELSKNQL--KCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP--QFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFIVLSQANFPKSSSNNLLT 2463
            + + + D ND+ P F+  S Y +++ E++E  +I    A D D   N    YSI   N  N F   ID  +  L+    +D E  S+  +   + A+D G  + +   C   IF+   D NDN P F   + T  + E+  +G+ V Q  A D D GVN+ + YSL+          +F ++  +GL+  V K+D E  +   + F+V+ATD GR  + S +  V + V+DINDN P   + +        P+    G+ +L     D D  +  ++    +   S   A   ++     ++++Q   +E  +   +E+   D  +P    L  + + I +     P  +F    Y   ++EN P  T + Q+ A   D     K+ FS      F     +GILS         +++   E+++       NK      +LD +  +  S + ++   A + + +   +     +N        T   + ++N+ P ++    +++L+             PF          L + A + I ++D NDN P F      S+   +  +   +   T +  + A D D   NA+L Y + D  + ++F    + +G +    +       +Y +K   +D G P +  T+ +   IV    N P    NNL+T
Sbjct: 1780 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKF--SIDSSSGELS-ARPLDREQHSR--YTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRE--LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP---IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRR-QKVQFS------FGAGNEDGILS---------LDSLSGEIRV-------NKP----HLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEI----RVVLVARTADA-------PF----------LASYAELVIELEDENDNSPKF------SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVT 2382          

HSP 14 Score: 91.2781 bits (225), Expect = 4.996e-17
Identity = 150/660 (22.73%), Postives = 279/660 (42.27%), Query Frame = 1
Query:  448 IQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYN--NLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTI---------EILENISVGSIVYQFVASDKDS-GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIV--IATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP------IIKKLFHLHVPIIDINDNYPQFSQ-AKYYFEIEENLPIYTNVYQLSASDLD--NSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREE-IENFHFEVQITDTGQ---LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIM----SNNSPFKL----TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            I T +    ++ +  + V I+D ND+ P F  +   + + E+ E   ++    A D D+          ++  +  N+ I  +D+ +  L +  ++DYE   Q+ +   + A+D      + +T + + + D NDN P F  ++            EI E++SV   +    A+D DS G NS + Y + P          F ++ + G++  VN    +  +     + V  IA D+G+  L +S  + V+  D      + + +Q  + I+E  P G +VL      LD+ S   +  +   +F L           I   +  D E N    + +       P             + + I+D NDN+P F + AKY  EI E  P+  ++ QL A D D  N+  +++ + I   N    FTID   G+L +   +D +   +++   ++  D+     L +     +++ D NDN P+   T   + +AEN  +  SV +   +D DK   G F    Y +    S+ S +K+    ++SG +      D E++  Y +  +  D G   A   +  V + I+  ++  P F     +  +  + P     P    +  + ATD D   + ++ Y+L   +  S  K+N  +G +
Sbjct: 2346 IATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE--LQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP------AQEGFSVHPSNGVVS-VNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ-SLAIIAGNEESAFELLQSKA------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK---GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA---SVAVRVEIESRDEFTPQFT----ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPH--SHFKVNRSSGAV 2973          

HSP 15 Score: 70.4774 bits (171), Expect = 1.103e-10
Identity = 121/537 (22.53%), Postives = 228/537 (42.46%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFF---QKSKY--------DINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-----RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQ-------LKCDFYRSFGLAIDSVD--DGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI-------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQI----DQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK 1980
            +R+V +TV + DEND+ P F   Q   Y        +I+   S +F L+ +  A D DS  N  +   I       F V+       +N++ ++    SS   +   + A D G    K  T + +   D       F   +   +I E   +GS+V Q        G ++L + SL+ ++G +  + +   +    L+K +++   + +  R+    V++   G      L+ S+  +VI+ ++D NDN P   +   ++  E E S    L +S   L  +  +Q       +  D        + ++D   G+  + +   +D+    +  I   C  +    +  L    + + D NDN P+F   +Y   + EN P+ ++V++  ASDLD     +LN+SI            F +D  +G+++     D E+ + +  E+  +D G       V V+I   ++  PQ T   TY       +       V Q++ TD+D   +G   ++  + + +S FK+ +S   +L+K
Sbjct: 2461 ARTV-LTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTV-NATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMS-RLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL-------GQDALDQ-SLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRL----VLSHPHGPPLISSLNSSSGISVIITILDANDNFP---IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTE-RTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQ--LSAPHSHFKVNRSSGAVLIK 2976          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|O35161|CELR1_MOUSE (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3)

HSP 1 Score: 208.379 bits (529), Expect = 3.222e-53
Identity = 167/622 (26.85%), Postives = 297/622 (47.75%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHIT--DANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHL-STSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF--------GLAIDSVDDG--------IYRIASTQVFDAEFNR----FCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP-FKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTY 2244
            S +  +TV + D ND  P F++S+Y   I E+ E    +L  +A D D+  N    Y +      +F   ID ++ ++     +D E++++  +  L+ A D G N         +HI   D NDNYP F  K   +++ E+++V + V +  A+D+D G N+ I YS+  +SG  ++  +FYL+S +G L ++N +D+E    R +T  + A D GR  L ++S  V V+V+D+NDN P  +      ++ EN P G  VL     D D     +L+   YR          G ++DS +          I+  +      AE +R         +  +D+ SP +     + + ++D+NDN P F+Q  Y   + E+  + ++V  L A D D + V  + + +   N       +     G++++   +D ++   +   V  +D G  S+ ++V++ + D N + P   ++  T  ++E+  +  S+A +S TD D  EN   T   Y++ +  P F++   +G I  M  LD E +  Y +     D+G     + T ++ I I D NDN P F+    +        +F D+P  T+++ + ATD+D   N +L Y
Sbjct:  349 SAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAGGVF--EIDARSGVVRTRAVVDREEAAE--YQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSI--VSG--NLKGQFYLHSLSGSLDVINPLDFEAI--REYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQ---YRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDANSV--ITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASD-GTRSHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARIT---YVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNG-IPQKSDTTSLEILILDANDNAPRFLRDFYQGS------VFEDAPPSTSVLQVSATDRDSGPNGRLLY 944          

HSP 2 Score: 171.785 bits (434), Expect = 1.002e-41
Identity = 180/688 (26.16%), Postives = 297/688 (43.17%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI----DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR--LHLSTSATVIVKVMDINDNVPEL-----IVHQNNSITENEPSGKIVLTFSFTDLDE---------LSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--------------------FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK---SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP--SLTSWMEFFIVLSQANFPK 2439
            P F    Y +++ E+      ++  +A D D    G   Y +    D   N  F+  ID     +     +D E     +    + A D G       T + + ++D ND+ P F+  E    I EN+ VG  V    A+D D+  N+ ++Y L  L G   +   F +++ +G+++    VD E   +  +  +V A D GR    LS SATV + V D NDN P+      +V     +  N      VL    TD D+         +    LK  FY  S   ++D ++            D E  R   + I   D    P+I     + V ++D+NDN P F  + +   + EN+P+  +V  + A D D  +  +L + ++                        F I  ++G +++   +DREE+E++ F V+  D G   +S+ + V + +LDVNDN P  T  +    + E+  +  SV  L   D D   N   T++    +  + F L+     G I L   LD +++  Y++     D       + TA V I++ D N ++PVF     +S H  +  +  D P  T+I T+ ATD+D  ENA++TY L+      F +I+ +TG IY            Y++  T  DNG P  S T+ +E  I+ +  N P+
Sbjct:  258 PQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNGYFL--IDAATGAVTTARSLDRETKDTHVLK--VSAVDHGSPRRSAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRL--LEGAGGV---FEIDARSGVVRTRAVVDREEAAE--YQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVN----TAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINP----------LDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDG----TRSHTAQVFINVTDANTHRPVF-----QSSHYTVS-VSEDRPVGTSIATISATDEDTGENARITYVLEDP-VPQF-RIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPR 906          

HSP 3 Score: 149.828 bits (377), Expect = 5.821e-35
Identity = 149/572 (26.05%), Postives = 251/572 (43.88%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNL----------------FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ---LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKP 2109
            V+V ++D ND+ P F  S +   ++E+   PL   +L  +A+D D+  N    Y + +  + +                F   I   +  + +  ++D E+     + F + A D G         + I + D NDN P F      + + E+ +VGS V    A D+D+  NS+I Y L+      +   +F L+S +G  L+ L   +DY+   +R +   V A+D  R H   +A V + V D N + P     H   S++E+ P G  + T S TD D  +    +  +     +    +D     I +    D E      + I   DN  P       L + I+D NDN P+F +  Y   + E+ P  T+V Q+SA+D D+    +L ++          F I+P +G++  +  +DRE +  ++      D G    LS    + V +LD+NDN P      +   + EN+ +   VA++   D D+  N    ++  I+  N P  F+L   SG +  +  LD E +  Y++  +V        L + ATV I + D NDN P
Sbjct:  566 VSVQVLDVNDNAPIFVSSPFQAAVLEN--VPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEH--YSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTG----GNTRNRFALSSQSGGGLITLALPLDYKQ--ERQYVLAVTASDGTRSH---TAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDED--TGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQ--IVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYML--VV--QATSAPLVSRATVHIRLLDQNDNPP 1114          

HSP 4 Score: 137.502 bits (345), Expect = 3.479e-31
Identity = 118/462 (25.54%), Postives = 217/462 (46.97%), Query Frame = 1
Query:  448 IQTIDNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP-IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ 1800
            ++ +D+   ++S S +V++ ++D ND+ P F +  Y++ + E       +L  +A DRD+  N V  Y +   N  N F +       ++ +   +DY+   Q   + L     DG      +  +FI++TDAN + P F     T+ + E+  VG+ +    A+D+D+G N+ I Y L      +    +F ++  TG +  + ++DYE+     +T  + A D+G    S + ++ + ++D NDN P  +      S+ E+ P    VL  S TD D     +L   F        D       G+ R  + +  D E      +    +D  SP  +     + V ++DINDN P F + +    +EEN P+ + V ++ A+D D     ++ + I++ N    F +D  +G L     +D E   ++   VQ T +  L +++ V++++LD NDN P+
Sbjct:  672 VEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQ---YVLAVTASDGTRSHTAQ--VFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVL------EDPVPQFRIDPDTGTIYTMTELDYED--QAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIR--TQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQAT-SAPLVSRATVHIRLLDQNDNPPE 1115          

HSP 5 Score: 91.2781 bits (225), Expect = 3.867e-17
Identity = 96/366 (26.23%), Postives = 172/366 (46.99%), Query Frame = 1
Query:  175 SHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDN-FQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDG-LNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ---NNSITENE---PSGKI 1242
            SH + ++S++    T I  I  T+++  EN ++ +      + V   +++ + G I T+ ++D +D                Q  + +    I   DN     S + ++ + I+D ND+ P F +  Y  ++ E +     +L   A DRDS  NG   Y+     +     YI+  + ++    ++D E+ +  +++    A D G  N       I + + D NDN P F+  E  + + EN  VGS+V +  A+D D G N+ I Y +  + G  ++   F L+  +G L+ + ++D+E  + R +  +V AT +    L + ATV ++++D NDN PEL   Q   NN +T      PSG I
Sbjct:  807 SHYTVSVSEDRPVGTSIATISATDEDTGENARITY---VLEDPVPQFRIDPDTGTIYTMTELDYED----------------QAAYTLA---ITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVA--VYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQI--VEG--NVPEVFQLDLLSGDLRALVELDFE--VRRDYMLVVQATSA---PLVSRATVHIRLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGVI 1139          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.878e-53
Identity = 210/789 (26.62%), Postives = 363/789 (46.01%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ I + I  N  IG+         IP         ++L++ KT    L+   +  + GEI  T  +IDR+    +C  +   +   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP A+D D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + +TD NDN+P F   E  + I EN  VG+ V Q  A+D D G N+ I +S S L    +I+ + F+LN+TTGL+ +   +D E   +     +V+A+D G   +   A V+V V D+NDNVP +    IV+  N    ++EN P    +   + TD D     ++ C         +  V    + + +    D E  +   I++   D   P + +   L + + D NDN P F+Q+     I EN      + ++SA+D D+    ++N+ +       F++D   G+L++   +DRE+ + + F +   D G   L++   V+V I+D NDN+P  T     +++ EN     +V  ++ TD D  +N   T    I+  N  F + +++G I      DREK++ Y   ++  + G  V+ +++A V+I++ D+NDNKPVFI P     + L+ P    +   T +  + A D D   NA++ Y +   N      I+ ETG I       +   G++ +    +D G P
Sbjct:   36 LSGTYIFAVLLVCVVFHSGA---QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVY-KTGDVPLIRIEE--DTGEIFTTGARIDRE---KLCAGIP--RDEHCFYEVEVAILP-------DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNH--KLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS--ILDENDDFTIDSQTGVIRPNISFDREKQESYTF-YVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLP---STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 116.701 bits (291), Expect = 5.253e-25
Identity = 106/386 (27.46%), Postives = 172/386 (44.56%), Query Frame = 1
Query: 1315 FGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-------STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFT-FKEYIMSNNSPFKLTK--SGKIIL--MKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            FGL +    +G  + ++   +  D E      +++   D   P       L V + D NDN+P F + +    I EN P+ T+V QL A+D D  +  K++FS       I    F ++   G+++IK  +DREE  N    V  +D G +  ++ V V + DVNDN P        +    T  ++EN  ++  +A ++ TD D   NG  T F ++ +    PF+L    S + +L    +LD E    Y I  +  D G    L  +A + I ++D NDN PVF      ++  +   I  ++     ++ + ATD D   NA++ Y L       F+ ++  TG +         K   Y       DNG P LTS +  F+
Sbjct:  217 FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI----PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFS-LDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFV 590          

HSP 3 Score: 106.686 bits (265), Expect = 7.225e-22
Identity = 142/565 (25.13%), Postives = 238/565 (42.12%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYV-----QLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS--ITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLP---IYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQST 1806
            +I +N    T +  +  T+ +  EN ++ F   SF NLV+ +      LN    + TI++ +DR++  N           L  +  +    P + +           V VN+ D ND++P     +Y +N +       ++L + I  ++ +  +     D ++N     + D + P           +L     +DYE  S + +   L A D G         +FI + D NDN P F     T+ I EN S G  + +  A+D DSG N+ I Y L P + P     +F L+  TG+L +V K+D E   +  + F ++A D+G   L+++ TV V ++D NDN P +  H      + EN P    V   + TD D    + +       +    IDS   G+ R   +  FD E        +   D           + + ++D+NDN P F    Y +  E  LP     T V+Q+ A D D     ++ +SI+  N    F ID   G +++    D  ++      V+  D GQ  +   V +  L VN++   +T
Sbjct:  289 SIPENAPVGTSVTQLHATDADIGENAKIHF---SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNH---------KLLVLASDGGLMPARAM-----------VLVNVTDVNDNVPSIDI-RYIVNPVNDT----VVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYE--STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPP-----EFSLDRRTGMLTVVKKLDREK--EDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSP-VFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS-QTGVIRPNIS--FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT 812          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.019e-53
Identity = 210/789 (26.62%), Postives = 361/789 (45.75%), Query Frame = 1
Query:  106 LFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGH---------IPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEI-KTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK-FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            L   Y F+ +   +   + A     K++ I + +  N  IG          IP         ++L++ KT    L+   +  + GEI  T  +IDR+    +C  +   +   C  + E+   P         I R V +   I D ND+ P F  +  +I+I E++       LP A+D D  +NGV++Y +  + N   +  I+     + P L +  ++D E+      + +    +DG    +  T I  + +TD NDN+P F   E  + I EN  VG+ V Q  A+D D G N+ I +S S L    +I+ + F+LN+TTGL+ +   +D E   +     +V+A+D G   +   A V+V V D+NDNVP +    IV+  N    ++EN P    +   + TD D     ++ C         +  V    + + +    D E  +   I++   D   P + +   L + + D NDN P F+Q+     I EN      + ++SA D D+    K+N+ +       F++D   G+L++   +DRE+ + + F +   D G   L++   V+V I+D NDN+P  T     +++ EN     +V  ++ TD D  +N   T    I+  N  F + +++G I      DREK++ Y   ++  + G  V+ +++A V+I++ D+NDNKPVFI P     + L+ P    +   T +  + A D D   NA++ Y +   N      I+ ETG I       +   G++ +    +D G P
Sbjct:    4 LSGTYIFAVLLACVVFHSGA---QEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVY-KTGDVPLIRIEE--DTGEIFTTGARIDRE---KLCAGIP--RDEHCFYEVEVAILP-------DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDT---YVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--SNIARRLFHLNATTGLITIKEPLDREETPNH--KLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLS--ILDENDDFTIDSQTGVIRPNISFDREKQESYTF-YVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLP---STNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 114.775 bits (286), Expect = 2.058e-24
Identity = 106/386 (27.46%), Postives = 170/386 (44.04%), Query Frame = 1
Query: 1315 FGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI------IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-------STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFT-FKEYIMSNNSPFKLTK--SGKIIL--MKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            FGL +    +G  + ++   +  D E      +++   D   P       L V + D NDN+P F + +    I EN P+ T+V QL A+D D  +  K++FS       I    F ++   G+++IK  +DREE  N    V  +D G +  ++ V V + DVNDN P        +    T  ++EN  ++  +A ++ TD D   NG  T F ++ +    PF+L    S + +L    +LD E    Y I  +  D G    L  +A + I ++D NDN PVF      ++  +   I  ++     +  + A D D   NAK+ Y L       F+ ++  TG +         K   Y       DNG P LTS +  F+
Sbjct:  185 FGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI----PFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGK-PPLNQSAMLFIKVKDENDNAPVF------TQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFS-LDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFV 558          

HSP 3 Score: 103.605 bits (257), Expect = 6.611e-21
Identity = 141/565 (24.96%), Postives = 240/565 (42.48%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYV-----QLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----------ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFY-RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF----SQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQST 1806
            +I +N    T +  +  T+ +  EN ++ F   SF NLV+ +      LN    + TI++ +DR++  N        K+++  +  +    P + +           V VN+ D ND++P     +Y +N +       ++L + I  ++ +  +     D ++N     + D + P           +L     +DYE  S + +   L A D G         +FI + D NDN P F     T+ I EN S G  + +  A D DSG N+ I Y L P + P     +F L+  TG+L +V K+D E   +  + F ++A D+G   L+++ TV V ++D NDN P    ++ N  + EN P    V   + TD D    + +       +    IDS   G+ R   +  FD E        +   D           + + ++D+NDN P F    S   Y   +    P  T V+Q+ A D D     ++ +SI+  N    F ID   G +++    D  ++      V+  D GQ  +   V +  L VN++   +T
Sbjct:  257 SIPENAPVGTSVTQLHATDADIGENAKIHF---SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPN-------HKLLV--LASDGGLMPARAM-----------VLVNVTDVNDNVPSIDI-RYIVNPVNDT----VVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYE--STKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPP-----EFSLDCRTGMLTVVKKLDREK--EDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDS-QTGVIRPNIS--FDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNAT 780          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A095ANT6 (Protocadherin alpha-2 OS=Schistosoma haematobium OX=6185 GN=MS3_04214 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.685e-89
Identity = 264/918 (28.76%), Postives = 427/918 (46.51%), Query Frame = 1
Query:  301 LVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFP------------LILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVY----IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSIST---KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQ-------AKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN------------YFTIDPANGILSIKTNIDREEIENFHFEV------QITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENG-------------TFTFKEYIMSNNSP--------FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPK--EKSKHGLIKPIFYDS-------------------------------PSRTTIIT-----LRATDQDLNENAKLTYRLDKT-NASSFTKINSETGEIYFFYIDMI-----------PKPGMYSIKATVSDNGTPSLTSWMEFFIVL-------SQAN-FPKSSSNNLLTKQRNFF----------------------------SNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            L+   ++ + G+  T   IDRD + ++CGPL CC +++C +  ++ F        F  I+ S+ V VN  I D ND+ P F +  + + I E N               +  LP A D DS  NGV  Y I  +    + F VY    I+K   ++     +DY++ +QR+F   + A D G      +  + +HITD NDN P F     +I +LEN      +Y   A+D DS  N LIKY+LS L+ P ++S+   KF  +STTG L L N +DYE F +R    + IA D+G   LS++A + + + DINDN P+LI+  NN+ITEN   G++ L     D DE+S++ + C     + +    ++I S D  +  + +    D E     +  I CLD ASP   + F+L + I D+NDN P+F           Y   + E  P+   +  ++A DLD+ +  ++ +S+++ +            YF ID   G + +   +D E+ +   F+V      +  D  +LS+ + V V+ILDVNDN P+  +  T  I E++ +   +  L FTD D    G             T T +++ + N           FKLT +G ++ ++ +DRE+  +  +P    D G    +T+T T++IHI DINDN P+   PK  E   +  IK I +DS                                SR  I +     L+A D D  EN ++TY+ + + N S +  ++  +GE    +ID              + G+Y +   ++DNG PSL +   F++ +       S  N +P  S+N++ +   NF+                            SN+VI  L+ +F+  +I TL A ++W R+K+
Sbjct:   43 LLQLFRVTDNGDFYTQTLIDRDSQDHLCGPLNCCHLIICNLTVDVLF--------FHPITESITVHVNLQIHDANDNSPHFTQQTFSLWIPEDNRLKYTDLDIQNMHKIIYGLPLATDIDSAPNGVVQYRIHGSLPVISTFQVYSNLSIEKLGLLIKPGVFLDYDNVNQRIFKLTIEAVDGGHPARTGRMLVLVHITDVNDNIPVFKKSRDSITLLENTMFDEPIYTVQATDIDSDDNGLIKYTLS-LTNPNTLSSVMEKFTFHSTTGELYLRNVLDYETFQERQIDLLFIACDTGDPSLSSTAQLTIYLQDINDNPPQLIIQLNNTITENSEPGQLALRLMIRDKDEVSRDMVTCHSDHSNLHVPLKMSI-SDDKTMITVITNATIDYELTPRLYYTITCLDEASPKQMRQFNLTISIGDLNDNPPKFKSSTFAPKIGHYKILLSEAEPVNQLLLIVTAEDLDSGENGRVTYSLMEIDHNTEVPTVNALQYFKIDSQTGSIFLNKQLDYEQNDLLRFKVLAEDNPRPADGIRLSSVATVIVQILDVNDNGPKLISSDTLSITEHSPVGTDLGLLKFTDPDTGPGGQIAHITLINSFSLTKTDEKHSIQNKCNIFNEGIHYFKLTDNGHLLSIQSIDREECSIIYLPIYAIDRGLPNPITSTTTLTIHILDINDNIPIIGKPKLGETLIYQPIKLIDWDSLSFYQLTNKHDKILNYKLLNNTYLKQNINNKMSRKYIYSRVAFQLQANDLDAGENGRITYQQNTSCNGSKYFHLDEFSGEFRARFIDYQKLSTPELIESDARRGIYHLCVQLTDNGKPSLQTTTWFYVKVIDPIMPPSVHNIWPADSANDMDSLFSNFYNTTNSLWSTDYFDTSKSDAVRLPIDMNISNIVISLLLAIFAITIICTLTAAILWARTKR 950          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A0R3WAJ9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7587 PE=4 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 6.992e-89
Identity = 251/884 (28.39%), Postives = 418/884 (47.29%), Query Frame = 1
Query:  184 SFNISDNIQANTFIGHI--PLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSV--NVTVNIIDENDSLPFFQKSK-----YDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNY--NNLFIVYIDK--------------QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKE-KTIEILENISVGS-IVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-------DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP--IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--------YFTIDPANGILSIKTN--IDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDND-----------------KLENGTFTFKEYIMSNNSPFKLTK-------SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDK-TNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG-TPSLTSWMEFFIVLSQAN-------FPKSSSNNLL--------TKQRNFFSNVVIFSL-IIVFSTALISTLIAVVVWVRSK 2571
            +F + D I+    +G+I   L  K ++    ++   + F+    Y  +   G I   + +DRD+  +ICGPL CC+  +C I   + F   Q+ +        V  ++ +++ D ND+ P F  +      + I I E  +F   +LP A+D DS  NGV  Y I+ N    +LF +  +K                P L    ++DYE+ + R F  ++ A D G         + + + D NDN P F+     +IE+ EN +     VY+F+A+D DS  N LI YSLSPL+ P  +  KF ++  +G L L + +DYE + +R FT IV+A+D+G    S + T+ V   D+NDN+P L+V +N ++ E     K V+ F   D D +S+ ++ C           S  L +  V    Y + +  +FD E  R   +EI C D A      +++  + V I D ND+YP+F   ++  ++ E+ P    V Q++ASD D     +L +S++  N         F ID A G++++K +  +DRE  E     V   D G LS  +K+ ++++D+NDN+P      +  + EN      V ++  TD D                 ++ N   T  E   + NS F   K       +G ++  K LDRE  + Y I F+  D G    + T  +V + + D NDN PV  +P+  +  G    ++ +SP  + +  LR+ D D  EN  + Y L   TN S + +++  TGE+   +    P PG+Y++K  + D G +P+  +W  FF+ +S  N         KSSS            +K R   + V++ S+ +++    LIS +  + + +RS+
Sbjct:   19 TFQMVDEIKPGQTVGNICHALWPKSSIAFSLIVVTSSRFQRFNEYFSITKNGSIIAQKFVDRDNINDICGPLDCCQSAICIIHARVMFIVEQSENPVMHSHDQVLAHLQIHLTDINDNSPRFPLNSQGYPHFTIRIQEGAKFAREMLPSAVDLDSAGNGVVQYRIEANSPSTDLFQLTYEKVLINPPSESHGWRLSPPTLIQLRELDYENPADREFELVVIAIDGGEPALTGSLSVTVVLMDINDNAPVFERTNISSIELAENTTYSPDPVYKFLATDMDSADNGLITYSLSPLNEPM-VFEKFAIDGRSGALYLNSILDYEVYSERRFTVIVVASDNGTPKRSGTTTLTVVTKDVNDNLPSLVVQENITVIEGLNYTKPVVRFYVKDDDYVSRGKVICRPAPNRAKGVGSASLRLQEVTTNAYFVFTEGIFDYEEARSASVEIICSDTADSFNTRERILPITVAIGDANDHYPEFGVTEFLAKLPEHSPKGKRVVQVTASDADAGIHARLTYSLVSSNGGRCSIQEIFNIDSATGVVTVKNSECLDREVNEEIEAYVAAEDGGGLSTSAKLRIRLMDINDNSPSIQVPDSLSVTENLPAGVVVGRVRCTDADIGSNAEIRLELSANNTQQVRNAFDTISESGSARNSFFSRGKVRGMNDITGLLVTKKPLDREDIESYTIQFVATDSGTPQRI-TYKSVQVLVLDENDNVPVLRFPQLDTTVGYHPQVYTNSPYGSKVCVLRSYDPDKGENGTVIYALQHDTNGSRYFQLDQTTGELTTAWHHRGPAPGVYAVKILLYDMGQSPTKVAW-NFFVYVSPRNPLLDAVHLSKSSSTGRASNVTASTKSKSRLTHTTVIMISVAVLIVLILLISCVCMIKILLRSR 899          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A430QQX4 (Protocadherin delta 1 OS=Schistosoma bovis OX=6184 GN=DC041_0010353 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.298e-87
Identity = 271/967 (28.02%), Postives = 442/967 (45.71%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALENYQL-----------LFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFP------------LILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVY----IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSIST---KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQ-------AKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN------------YFTIDPANGILSIKTNIDREEIENFHFEV------QITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTF-------------TFKEYIMSNNSP--------FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPK--EKSKHGLIKPIFYDS-------------------------------PSRTTIIT-----LRATDQDLNENAKLTYRLDKT-NASSFTKINSETGEIYFFYIDMI-----------PKPGMYSIKATVSDNGTPSLTSWMEFFIVL-------SQAN-FPKSSSNNLLTKQRNFF----------------------------SNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            F + D +    FIG+IP    + + N+             L   + F  L+   ++ + G+  T   IDRD + ++CGPL CC +++C +  ++ F        F  I+ S+ V VN  I D ND+ P F +  + + I E N               +  LP A D DS  NGV  Y I  +    + F +Y    I+K   ++     +DY++ +QR+F   + A D G      +  + +HITD NDN P F     +I +LEN      +Y   A+D DS  N LIKY+LS L+ P ++S+   KF  +STTG L L N +DYE F +R    + IA D+G   LS++A + + + DINDN P+LI+  NN+I EN   G++ L     D DE+S++ + C     + +    ++I S D  +  + +    D E     +  I CLD ASP   + F+L + I D+NDN P+F           Y   + E  P+   +  ++A DLD+ +  ++ +S+++ +            YF ID   G + +   +D E+ +   F+V      +  D  +LS+ + V V+ILDVNDN P+  +  T  I E++ +   +  L FTD D    G               T +++ + N           FKLT +G ++ ++ +DRE+  +  +P    D G    +T+T T++IHI DINDN P+   PK  E   +  IK I +DS                                SR  I +     L+A D D  EN ++TY+ + + N S +  ++  +GE    +ID              + G+Y +   ++DNG PSL +   F++ +       S  N +P  S+N++ +   NF+                            SN+VI  L+ +F+  +I TL A ++W R+K+
Sbjct:   52 FMLPDELPQGHFIGNIP----KNIPNFPFYNILNSSVSTTLVDSSGF--LLQLFRVTDNGDFYTQTLIDRDSQDHLCGPLNCCHLIICNLTVDVLF--------FHPITESITVHVNLQIHDANDNSPHFTQQTFSLWIPEDNRLKYTDLDIQNMHKIIYGLPLATDIDSAPNGVVQYRIHGSLPVISTFQIYSNLSIEKLGLLIKPGVFLDYDNVNQRIFKLTIEAVDGGHPARTGRMLVLVHITDVNDNIPVFKKSRDSITLLENTMFDEPIYTVQATDIDSDDNGLIKYTLS-LTNPNTLSSVMEKFTFHSTTGELYLRNALDYETFQERQIDLLFIACDTGDPPLSSTAQLTIYLQDINDNPPQLIIQLNNTIKENSEPGQLALRLMIRDKDEVSRDMVTCHSDHSNLHVPLKMSI-SDDKTMITVITNATIDYELTPRLYYTITCLDEASPKQMRQFNLTISIGDVNDNPPKFKSSTFAPKIGHYKILLSEAEPVNQLLLIVTAEDLDSGENGRVTYSLMEIDHNTEVPTVNALQYFKIDSQTGSIFLIKQLDYEQNDLLRFKVLAEDNPRPADGIRLSSVATVIVQILDVNDNGPKLISSDTLSITEHSPVGTDLGLLKFTDPDTGPGGQIAHITLIDSFSLIKTDEKHSIQNKCNIFNEGIHYFKLTDNGHLLSIQSIDREECSIIYLPIYAIDRGLPNPITSTTTLTIHILDINDNIPIIEKPKLGETLIYQPIKLIDWDSLSFYQLTNKHDKILNYKLLNNTYLKQNINNKMSRKYIYSRVAFQLQANDLDAGENGRITYQQNTSCNGSKYFHLDEFSGEFRARFIDYQKLSTPELIESDARRGIYHLCVQLTDNGKPSLQTTTWFYVKVIDPIMPPSVHNIWPADSANDMDSLFSNFYNTTNSLWSTDYFDTSKSDAVRLPIDMNISNIVISLLLAIFAITIICTLTAAILWARTKR 1002          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A4Z2DW29 (Protocadherin-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003398 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.331e-87
Identity = 258/912 (28.29%), Postives = 414/912 (45.39%), Query Frame = 1
Query:  316 QLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFP------------LILLPKAIDRDSLVNGVRHYSIDNN--YNNLFIVYIDKQAPILNITGK----IDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSG--PKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQ-------AKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ------------CNYFTIDPANGILSIKTNIDREEIENFHFEV------QITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF-------------KEYIMSNNSP--------FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPK--EKSKHGLIKPIFYDS-------------------------------PSRTTIIT-----LRATDQDLNENAKLTYRLDKT-NASSFTKINSETGEIYFFYIDM----IP-------KPGMYSIKATVSDNGTPSLTSWMEFFIVL-------SQAN-FPKSSSNNLLTKQRNFF----------------------------SNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            ++ + G+  T   IDRD+  ++CGPL CC +++C +  ++ F        F   + S+ V VN  I D ND+ P+F +  + + I E N               +  LP A D DS  NGV  Y I  +    + F +Y +  +  L +  K    +DY++++QR+F  ++ A D G      +  + +HITD NDN P F   + +I + EN      VY+  A D DS  N LIKY+ S ++   P S+  KF  +STTG L L + +DYE F +R    I  A D+G   LS +  + + + DINDN P+LIV  NN+I EN   G++ L     D DE+S++++ C     ++     ++I S D  +  + +T   D E     +  I CLD ASP   + F+L + I D+NDN P+F           Y   + E  PI   V  ++A D D+ D  ++++S+                YF ID   G + +   +D E+ +  HF+V      + TD  ++S  + V V++LDVNDN P+  +  T  + E++ I   +  L FTD D    G                 ++Y + N           FKL  +G +I ++ +DRE+     +P +  D G    +T+T T++IHI DINDN P+   PK  E   +  IK I +DS                                SR  I       + A D D  EN ++TY+ + + N S +  ++  +GE    +ID      P       + G+Y +   ++DNG P L +   F++ +       S  N +P  S+N++     NF+                            SN+VI  L+++F+  ++ TL A ++W RSK 
Sbjct:  119 RVTDNGDFYTQTLIDRDNPDHLCGPLNCCHLIVCNLTVDVLF--------FHPATESIKVHVNLQIHDANDNSPYFAQQTFSLWIPEDNRLKYSDLDIQNMHKTIYALPLATDADSAPNGVVQYRIHGSIPATSTFQIYSNLSSEKLGLLIKPGVFLDYDNANQRIFKLIIEAIDGGHPARTGRMLVLVHITDVNDNIPTFRISKDSISLPENTKFDEPVYKVQAKDADSDDNGLIKYTFSLVNPNIPSSVMEKFTFHSTTGELYLRDVLDYETFQERQIDLIFTAYDTGDPPLSATTQLTIYLQDINDNPPQLIVQINNTIKENSEPGQLALRLQIRDKDEVSRDKISCHSDHSNYQVPLKMSI-SRDKTMITVITTASVDYELTPKLYYTITCLDEASPKQMRQFNLTISIGDVNDNPPKFKTSTFAPKIGHYKILLSEAEPINQLVLIVTAEDADSGDNGRISYSLTDIAHNTETSHFNGVQYFKIDSQTGSIFLMKQLDYEQNDLLHFKVLAEDNPKPTDGIRMSAIATVIVQVLDVNDNGPRLISSDTLSLVEHSPIGTDLGLLKFTDPDTGPGGQIAHISLIDSLSITKINEKYSIQNKCNRLHKSIHYFKLNDNGHLISIQSIDREECSTIFLPILAIDRGLPNPMTSTTTLTIHILDINDNIPIIEKPKLGETLTYQPIKLINWDSISFYQLTSKHDKILNHKLLNSTYLKQNVNNKMSRRYIYARIAFQIHANDLDAGENGRITYQQNTSCNGSKYFHLDENSGEFRARFIDYQKLSTPELIESDSRRGIYHLCVQMTDNGKPPLQTTTWFYVKVIDPIMPPSTHNIWPADSANDIDLLFTNFYNSTNPLWSSHLLDASKSDSLHLPMDMNISNIVISILLVIFAITIVCTLTAAILWARSKH 1021          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A183LHJ7 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3272 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 2.314e-86
Identity = 272/979 (27.78%), Postives = 446/979 (45.56%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALENYQL-----------LFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFP------------LILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVY----IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSIST---KFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQ-------AKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN------------YFTIDPANGILSIKTNIDREEIENFHFEV------QITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF-------------KEYIMSNNSP--------FKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPK--EKSKHGLIKPIFYDS-------------------------------PSRTTIIT-----LRATDQDLNENAKLTYRLDKT-NASSFTKINSETGEIYFFYIDMI-----------PKPGMYSIKATVSDNGTPSLTSWMEFF------IVLSQAN--FPKSSSNNLLTKQRNFF----------------------------SNVVIFSLIIVFSTALISTLIAVVVWVRSKQ-----NGQMIDS 2595
            F + D +    FIG+IP    + + N+             L   + F  L+   ++ + G+  T   IDRD + ++CGPL CC +++C +  ++ F        F  I+ S+ V VN  I D ND+ P F +  + + I E N               +  LP A D DS  NGV  Y I  +    + F +Y    I+K   ++     +DY++ +QR+F   + A D G      +  + +HITD NDN P F     +I +LEN      +Y   A+D DS  N LIKY+LS L+ P ++S+   KF  +STTG L L + +DYE F +R    + IA D+G   LS++A + + + DINDN P+LI+  NN+I EN   G++ L     D DE+S++ + C     + +    ++I S D  +  + +    D E     +  I CLD ASP   + F+L + I D+NDN P+F           Y   + E  PI   +  ++A D+D+ +  ++ +S+++ +            YF ID   G + +   +D E+ +   F+V      +  D  +LS+ + V V+ILDVNDN P+  +  T  I E++ +   +  L FTD D    G                 +++ + N           FKLT +G ++ ++ +DRE+  +  +P    D G    +T+T T++IHI DINDN P+   PK  E   +  IK I +DS                                SR  I +     L+A D D  EN ++TY+ + + N S +  ++  +GE    +ID              + G+Y +   ++DNG PSL +   F+      I+    N  +P  S+N++ +   NF+                            SN+VI  L+ +F+  +I TL A ++W R+K+     +G++I S
Sbjct:   51 FMLPDELPQGHFIGNIP----KNIANFPFHNILNSSISTTLVDSSGF--LLKLFRVTDNGDFYTQTLIDRDSQDHLCGPLNCCHLIVCNLTVDVLF--------FHPITESITVHVNLQIHDANDNSPHFTQQTFSLWIPEDNRLKYTDLDIQNMHKTIYGLPLATDIDSAPNGVVQYRIHGSLPVVSTFQIYSNLSIEKLGLLIKPGVFLDYDNVNQRIFKLTIEAVDGGHPARTGRMLVLVHITDVNDNIPVFKKSRDSITLLENTMFDEPIYTVKATDMDSDDNGLIKYTLS-LTNPNTLSSVMEKFTFHSTTGELYLRDVLDYETFQERQIDLLFIACDTGDPPLSSTAQLTIYLQDINDNPPQLIIQLNNTIKENSEPGQLALRLMIRDKDEVSRDMVTCHSDHSNLHVPLKMSI-SDDKNMITVITNASIDYELTPRLYYTITCLDEASPKQMRQFNLTISIGDVNDNPPKFKSSTFAPKIGHYKILLSEAEPINQLLLIVTAEDVDSGENGRVTYSLMEIDHNPEVPIVNALQYFKIDSQTGSIFLIKQLDYEQNDLLRFKVLAEDNPRPADGIRLSSVATVIVQILDVNDNGPKLISSDTLSITEHSPVGTDLGLLKFTDPDTGPGGQIAHITLINSFLITKIDEKHSIQNKCNIFNEGIHYFKLTDNGHLLSIQSIDREECSIIYLPIYAIDRGLPNPITSTTTLTIHILDINDNIPIIEKPKLGETLIYQPIKLIDWDSLSFYQLTNKHDRILNYKLLNNTYLKQNINDKMSRKYIYSRVAFQLQANDLDAGENGRITYQQNTSCNGSKYFHLDEFSGEFRARFIDYQKLSTPELIESDARRGIYHLCVQLTDNGKPSLQTTTWFYVKVIDPIMPPSVNNIWPADSANDMDSLFSNFYNTTNSLWSTDYFDTSKSDAVRLPIDINISNIVISLLLAIFAITIICTLTAAILWARTKRRFKRAHGKIIKS 1013          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 207.223 bits (526), Expect = 2.351e-54
Identity = 215/787 (27.32%), Postives = 348/787 (44.22%), Query Frame = 1
Query:  184 SFNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKC------DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFE-IEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPS--LTSWMEFFI 2412
            ++ + +    NT +G   L   + L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ +     C ++FE++ + +       S  R +   + I DEND+ P F     ++ I E+        +P A+D+D+  NG+  Y +++  +  NLF + +    D++ P L + G +D E   QR  + L     DG    +  + +  I ITD NDN P F+      E+ EN  VG  V Q  A+D D G N  + YS    S   ++    +++  TG++++   VD E     +  F V A D+G    S+ A V + V D NDN P        L+ H++   +++E+ P G  V     +D DE     + C       F      A DS     Y + +T   D E  +   IEI  +D+ +P +     L V + D+NDN P FS + Y  +  EEN P    V  + A+D D+    +L +SII        F I+P  G + +   +DRE  E + F V+  D G   L   + V V++LD NDN P+      ++ + EN      V  ++  D DK EN        +   N  F +   +G I+     DREK+  Y       D G+    ++   ++I++ D NDN P    P   S +  ++P+   SP  T +  + A D D   NA+L Y +   N     +I+S  GEI           G++ +   VSD G PS   T+ +  F+
Sbjct:   36 TYQLREEQPPNTLVGS--LAADQGLPDTGHLYKLEVGGP-------YLRVDGKTGDIYTTDVPIDRET-------LKDCRNLFEGDPCFLEFEVSITDLMK----GSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDRE---QRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPS--PNVQRLLHIDHNTGIIQVKGSVDREEV--PLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQP-GDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLS--VEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGD-PPRSSYVGITINVLDENDNAPYVTKPS-NSSYKFLQPLT--SPD-TRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFV 787          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 205.682 bits (522), Expect = 7.761e-54
Identity = 219/793 (27.62%), Postives = 358/793 (45.15%), Query Frame = 1
Query:  331 GEI-KTIRKIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIES----NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP-SLTS--WMEFFI--VLSQANF-------------PKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            GEI  T  +IDR+         + C  V     C  + E+   P         I R V +   I D ND+ P FQ +  +I+I E+    N +P+   P A D D  +NG++HY +  + +   +  I+     + P L +   +D E  ++  F  +    +DG N  K  T I  + ++D NDN P F   E  + + EN  +G+ V Q  A+D D G N+ I +S S    P +    F ++S+TGL+ +   +D E+  + +   IV+A+D       + ATVIV V D+NDNVP +    I++  N    ++EN P    +   + TD D     ++ C         +  V +  + + +    D E  R   I+I   D+  P +     + + I D NDN P F Q +    I EN    T + +++A+D D+     + +S+     + F IDP +GILS+   +DRE+ E + F V   D G    +S V VK++  D NDN+P  T     +++ EN  +  +V  ++ TD D  +N   T    I++    F +  K+G I      DRE++  Y       D G  +  T+ A V+I++ D+NDN+PVF+ P     + L+   F  +P  + +  + A D D   NA+L Y +   +      I+  TG I           G++ +   V D G P SL S   +  F+   +S A F              K+  ++ +  Q N +   VI  + I+  T  +  +I V   VR +Q
Sbjct:  122 GEIFTTANRIDRE---------RLCSGVFNEKRCFYEIEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPV---PSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRE--TKDTF-VMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPAT-KRHFAIDSSTGLITVKQPLDRES--NPVHKLIVLASDGSAT--PSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLS--IINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG-LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVP--FTTNPG-SVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGY---VIVVIAIIAGTMTVILVIFVTALVRCRQ 878          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 205.297 bits (521), Expect = 1.963e-53
Identity = 219/793 (27.62%), Postives = 358/793 (45.15%), Query Frame = 1
Query:  331 GEI-KTIRKIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIES----NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDK----QAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP-SLTS--WMEFFI--VLSQANF-------------PKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            GEI  T  +IDR+         + C  V     C  + E+   P         I R V +   I D ND+ P FQ +  +I+I E+    N +P+   P A D D  +NG++HY +  + +   +  I+     + P L +   +D E  ++  F  +    +DG N  K  T I  + ++D NDN P F   E  + + EN  +G+ V Q  A+D D G N+ I +S S    P +    F ++S+TGL+ +   +D E+  + +   IV+A+D       + ATVIV V D+NDNVP +    I++  N    ++EN P    +   + TD D     ++ C         +  V +  + + +    D E  R   I+I   D+  P +     + + I D NDN P F Q +    I EN    T + +++A+D D+     + +S+     + F IDP +GILS+   +DRE+ E + F V   D G    +S V VK++  D NDN+P  T     +++ EN  +  +V  ++ TD D  +N   T    I++    F +  K+G I      DRE++  Y       D G  +  T+ A V+I++ D+NDN+PVF+ P     + L+   F  +P  + +  + A D D   NA+L Y +   +      I+  TG I           G++ +   V D G P SL S   +  F+   +S A F              K+  ++ +  Q N +   VI  + I+  T  +  +I V   VR +Q
Sbjct:  122 GEIFTTANRIDRE---------RLCSGVFNEKRCFYEIEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPV---PSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRE--TKDTF-VMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISP-ATKRHFAIDSSTGLITVKQPLDRES--NPVHKLIVLASDGSAT--PSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLS--IINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG-LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVP--FTTNPG-SVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGY---VIVVIAIIAGTMTVILVIFVTALVRCRQ 878          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 201.06 bits (510), Expect = 4.043e-52
Identity = 220/794 (27.71%), Postives = 356/794 (44.84%), Query Frame = 1
Query:  331 GEI-KTIRKIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIES----NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYI-----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQST-TLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP-SLTS--WMEFFI--VLSQANF-------------PKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQ 2574
            GEI  T  +IDR+         + C  V     C  + E+   P         I R V +   I D ND+ P FQ +  +I+I E+    N +P+   P A D D  +NG++HY +       F + I       + P L +   +D E  ++  F  +    +DG N  K  T I  + ++D NDN P F   E  + + EN  +G+ V Q  A+D D G N+ I +S S    P +    F ++S+TGL+ +   +D E+  + +   IV+A+D       + ATVIV V D+NDNVP +    I++  N    ++EN P    +   + TD D     ++ C         +  V +  + + +    D E  R   I+I   D+  P +     + + I D NDN P F Q +    I EN    T + +++A+D D+     + +S+     + F IDP +GILS+   +DRE+ E + F V   D G    +S V VK++  D NDN+P  T     +++ EN  +  +V  ++ TD D  +N   T    I++    F +  K+G I      DRE++  Y       D G  +  T+ A V+I++ D+NDN+PVF+ P     + L+   F  +P  + +  + A D D   NA+L Y +   +      I+  TG I           G++ +   V D G P SL S   +  F+   +S A F              K+  ++ +  Q N +   VI  + I+  T  +  +I V   VR +Q
Sbjct:   82 GEIFTTANRIDRE---------RLCSGVFNEKRCFYEIEVAVLP-------DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPV---PSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRE--TKDTF-VMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPAT-KRHFAIDSSTGLITVKQPLDRES--NPVHKLIVLASDGSAT--PSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLS--IINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSG-LIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVP--FTTNPG-SVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGY---VIVVIAIIAGTMTVILVIFVTALVRCRQ 839          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 198.364 bits (503), Expect = 1.432e-51
Identity = 200/774 (25.84%), Postives = 330/774 (42.64%), Query Frame = 1
Query:  322 NNKGEIKTI-RKIDRDDEKNICGPLQCCKIVL----CQIQFEIN-FSPIQT-IDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP-LILLPKAIDRDSLVNGVRHY-----------------------------------SIDNNYNNLFIVYI-----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKI---------VLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC--NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTF-----KEYIMSNNSPFKL----TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSL--TSWMEFFI 2412
            N  GE+ T  R+IDR+        L  C+++     C + FE++   P+Q+ +D F+         + + D ND+ P F      +++ E+     L LLP A DRD   NG+  Y                                   S+    +N+F + +      ++ P L + G +D E  ++  +  +L   D G      +  + + ITD NDN P F+      E+ EN   G+ V Q  ASD+D GVN  ++Y     +  +S+     L+  +G L +++++D E        F V A D G+   +  ATVI+ V D NDNVP + + +   I   + +  +         V     +D D+     + C    D   +   A ++ +   + + ++ + D E  R   + I  +D+ SP +     L V ++DIND+ P F+Q+       EN      V  + A+D D+    ++ +S+       F ID  NG +     +DRE+ E + F V   D G   L   + V V++ D NDNAP+    + T+++ EN   +  V  ++ TD D+ EN          +E   +     +L      +G I      DRE +  Y       D G     + TATVS+ + D NDN P    P  +S + L+ P    S +RT + T+ A+D D   NA L Y L   N     +I   +G I           G++ +   V+D+G PSL  T+ +  FI
Sbjct:   82 NVTGELTTSSRRIDREK-------LPQCQMIFDENECFLDFEVSVIGPLQSWVDLFEG-------RIVVTDVNDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDRE--ARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFG--AATESVRRLLRLDEASGWLSVLHRIDREEVSQ--LRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAMVPENVLVDTPVALVQVSDRDQGENGAVTCTVVGDVPFTLKPAGENRNKKKFFLHTSALLDYEATRDYTVTIVAVDSGSPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVTVVAADADSGKNAEIAYSLDPSVNGAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGE-PPRSATATVSLFVTDENDNAPSVTAPANES-YTLLPPA---SGARTVVRTVMASDGDAGSNADLRYALVGGNPFQLFEIGPSSGVITLAEPLERRHRGLHRLVVRVNDSGVPSLCATALVHVFI 830          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.756 bits (517), Expect = 3.318e-54
Identity = 185/700 (26.43%), Postives = 303/700 (43.29%), Query Frame = 1
Query:  481 RSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLF-----------------------IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNF-DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVN--KVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNN-------SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQ--------AKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-------CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK--VYVKILDVNDNAPQ------STTLM-TYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-----TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYP--KEKSKHGLIKPIFYDSPSRTTI-ITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG 2376
            R ++V + + D ND  P F+    +++I ES      + LP+AID D+  N ++HY I     +                            +  +A +L +  ++D E      +  LL+  D G  +      + I + DANDN P F D   + + I E+  VG+ V Q  A+D D+G N  I YS        +     +++ TTGL+ + N  K+D E     +   +V+A D G+L  S S TV V++ D NDN P  E+I  Q          I EN PSG  V+  S +D D  S   +        G  + S +   + + +T++ D E  +   + +   D  +P + KL +L + ++DINDN P F          A Y   + EN P  T V  L A+D D+     + F++ +          F+++   G L++ T +DRE+   +   V+  D G    K++  V V +LD NDNAP       ST  M  + + E T +   V  +S +D D+ +N        ++    P  +     T  G +  +  LDRE +  Y +     D G   AL+ +  VSI + D NDN PV   P   +  KH     +   SP+   + +++ A D D  +N +  Y +   N      +N+++G +           G++ +   V D G
Sbjct:  126 RLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRA-LLELREQLDREAVPS--YELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETM--PVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALN--LVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGR-PALSASCRVSITVSDTNDNAPVITSPNTNDTWKH-----VRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 121.324 bits (303), Expect = 3.212e-28
Identity = 138/578 (23.88%), Postives = 237/578 (41.00%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLP-FFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNL---FIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--------FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP----------ELIVHQNNSITENEPSGKIVLTFSFTDLD------------ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF------SQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQL---SFTDN--DKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMKHLDREKKDLYLIPFIVYDHGN 2043
            +S SV +T+ ++D ND+ P F       + I E ++    ++  +A D D+  NG   YS      +L     +++D    ++ +      +  +  +   ++ A D G         + + + D NDN P F+          +  ++I+EN+  G+ V     SD D G +  +   L   +G +  S     N    LLK    +DYE    + +   V+A D G   LS    +I+ V+DINDN P          ++ V++  S+ EN P+G +VL    TD D            EL+  +   + +        S++    ++      D E      + +   D  SP  K    + V ++D NDN P F      +   Y F +EE   + T V  +S SDLD  D  ++  ++++           D   G++     +DRE+   +   V+  D+G+  LS   +V + + D NDNAP  T+  T    ++ +       L   S T N  D  +NG   + E I  N     L    SG + L + +    + L+ +   V D G 
Sbjct:  252 LSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASP----NKVQFLLKTTRLLDYEEA--QQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYE-VSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELF--------SLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLY-EIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 3 Score: 117.472 bits (293), Expect = 5.710e-27
Identity = 130/507 (25.64%), Postives = 216/507 (42.60%), Query Frame = 1
Query:  472 SISRSVNVTVNIIDENDSLPFFQ----KSKY----DINIIES--NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAP-----ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNF--------DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-------ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGL----AIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQA---KYYFEIEENLPIYTNV-YQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFH-FEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAEN-TQIDQSVAQ 1863
            S S SV VTV + D+ND+ P F+    + +Y     + I+E+  +  P++L+    D D   +G     ++      F    +  +P     +L  T  +DYE++ Q  ++  + A D G  +     ++ I + D NDN P F        D     + + EN   G++V   +A+D DSG N  I ++LS L+G +S++  F LN  TG L L   +D E  +   +   V A D G       A V V V+D NDN P  +   N++       + E    G  V T S +DLDE    ++  +  R  G            G+ R  +  V D E      + +  +D+  P +     + + + D NDN P  +       +  +    P    V   ++A+D+D  D  +  + II  N    F ++  +G LS+   +   + E  H   V++ D G   ++    V  L +   AP    +      EN T I+Q VA+
Sbjct:  363 SRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLI-SVSDPDLGSSGTVDVRLE------FPTGAELASPNKVQFLLKTTRLLDYEEAQQ--YNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMR--YELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVR--TLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLD-EGLHRLVVRVRDRGGSGSRRVRAVSGL-LEAAAPVLLHVFVNETVENVTLIEQLVAE 854          

HSP 4 Score: 99.7525 bits (247), Expect = 1.836e-21
Identity = 138/597 (23.12%), Postives = 226/597 (37.86%), Query Frame = 1
Query:  811 DIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTT-------------------GLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF-------GLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFS----QAKYY----FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-------STTLMTYHIA--ENTQIDQSVAQLSFTDNDKLENG--TFTFKEYIMSNNSP--FKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSET--GEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            D+ + + D ND+ P F      + I E+ +VG  V    A D D+G NS+  Y +S  SG       F L  +                     LL+L  ++D E      +  ++   D G   LS S  + + V+D NDN P  +        ITE+   G  V+     D D      +   F+           L +D    G+  + + +  D E      + +   D           + V + D NDN P F     Q +Y      +I ENLP  T V  +S SD D      ++  +         + +    +L     +D EE + ++  V   D G  +LS    + + ++D+NDN P           +  Y ++  EN      V  L  TD D   NG  TFT  E     +    F L  ++G++ L   LDREK+  Y +     D G+       A V + + D NDN P F+     +       +  ++   T + T+  +D D  +NA++   L +     +     +T  G +    +        Y +     D+G P+L++     I +S  N
Sbjct:  129 DVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPS--YELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGT-TGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGS-PQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTN 721          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 189.119 bits (479), Expect = 2.345e-49
Identity = 206/769 (26.79%), Postives = 343/769 (44.60%), Query Frame = 1
Query:  184 SFNISDNIQANTFIGHIPLTEKEA---LE-NYQLLFGKTSFRNLVNYVQLNNK-GEI-KTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE----SNEFPLILLPKAIDRDSLVNGVRHYSI---DNNYNNLFIVYIDKQA-----PILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK----FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL----IVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR---SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII--QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNG 2376
            S+ +++ ++   FIG+  +  + A   LE  Y+++  K         V++N + GE+    RK+DR+    +CG         C +  ++   P+Q    F+ I     V +N+ D ND+ P F      +++ E       FP+     A D DS  NGVR Y +   D    + F + + + A     P L +   +D E+  ++L+   L A D G         + I++TD NDN P FD  E  +EI EN  VG+ V Q  ASD+D+G N+ + Y L   +G           F L+  +GL+ +   ++ E     ++  I++ATD G   +  +ATV V V D+NDN P +    IV   N    I+E       V   + +D D  +   + C  Y     F L   +  +  Y + + +  D E      ++I   D  +  + +   + + ++D NDN P F++  Y   + EN  I  ++  +SA+D D     ++ + +       F +DP  GI+S+   +DRE+  N+ F +   D G   L   + V V +LDVNDN P+ S     +++ EN     +V  ++  D+D+ ENG          N   F +  +SG I      DRE++  Y++     D G  V  ++T  V IH+ DINDN P+ + P   + +  + P        T +  + A D D   NA+L Y +   N  +   I+   G I           G++ +   VSD G
Sbjct:   40 SYRVAEELREGAFIGNPSVDLRLADYNLELTYKVMLSKAE-DAAPPLVRVNPRTGELFAAGRKMDRE---ALCGGQDPGD--ECHVDVQVGVLPVQPGPFFKLIE----VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPI---QPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREE--RQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREE--SPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQ-YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVR-SSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPG---TIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 1.059e-43
Identity = 167/636 (26.26%), Postives = 290/636 (45.60%), Query Frame = 1
Query:  463 NFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYS-IDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITE-NEPS-GK-IVLTFSFTDLDELSKNQLKCDFYRS----FGLAID-----SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF----IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
             F   S  + + V+++D ND+ P F  S++   + E+     I++  A+D+DS +NG   YS ID N  N+F   ++  +  +     +D E+ +   +   + ATD G     C   + I +TD NDN P F  +  +  + E+ +VG  V +    D D G N+ I +SL         S  F ++ +TG + +  +++ E   DR    + +        +ST  T++V   D+NDN P     Q     E  EPS G+ +V   S +D D+ +  Q+   F RS    F +  D     SV    YR  +     A  N++ ++ +  +D   P +     + + I+  N N P+F + +Y   +   +   T +  +SA D D     ++ +S++  N    F +D A G L ++ ++  +    F   V+  D G+  LS+++   + + + N  AP+ +   +   + EN     S+A+++ TD D   NG   +       +  F +++ SG ++L+  LD E + LY +     D G + A T  + VSI + D+NDN P+      YP           I  ++PS TT++ + A D D   NA   Y LD   A  F  +N +TG
Sbjct:  312 GFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVF--RVNPNSGEIRSVSTLDRENVAS--YELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT-QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSL------LDPSLPFSIHPSTGEITVSRRLNRE---DRSGYAVKVRASDPAWTVSTDVTIVVD--DVNDNAPRF--GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF-FMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFV-VTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-GGWQAKTECSGVSISVTDVNDNPPMLNASDYYPV----------IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFV-LNQKTG 914          

HSP 2 Score: 172.555 bits (436), Expect = 1.258e-43
Identity = 167/678 (24.63%), Postives = 299/678 (44.10%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLR--ATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY----FFYIDMIPKPG-------MYSIKATVSDNGTPSLTS--WMEFFIVLSQANFPK 2439
            VTV + DEND+LP F  ++    + E  + P+   + L  A D D+ +N +  Y +     +  +     Q   +  T  +D E   +  +   + A D G          + + +TD ND+ P F           +   G+ V+   A D D+G N  +++SLS      S S  F ++   G++     +  +   D + T  V  +D G    S   TV V+  D  +  P       + S  E++P G  +   +       S+      ++ + G  +    +VD     ++  +  D E+     + +   D+  P       L V ++DINDN P+FS ++++ ++ EN P  T V  L+A D D+    ++++SII     N F ++P +G +   + +DRE + ++   V+ TD G  +     KV + + D NDN+P+ T + + H+ E+  +   V ++S  D D+  N   TF   ++  + PF +  S G+I + + L+RE +  Y +     D     A T +  V+I + D+NDN P F    + + +     I +  PS    +  R  A+D D   N ++ + + ++   +F ++  ++GEI+      Y D  P  G        YS   T  D G P L+S   +   IV+  AN P+
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPE--DAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ---IITTASLDRE--GRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS-----GSASAGFSVDPRRGVIHAARAL--QGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARS----SRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFS--LLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRF---GQTAYY-----IEFPEPSEGEALVARVSASDADDGANGQVFFFM-RSQTENF-RVGRDSGEIHSVRPLRYRD--PAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPR 650          

HSP 3 Score: 168.703 bits (426), Expect = 2.005e-42
Identity = 177/690 (25.65%), Postives = 294/690 (42.61%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-----ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIY---------RIASTQVF-DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTNAS--SFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI-VLSQANFPKSSSN 2451
            +S    VT+NI+  N + P F + +Y   +  +      IL   A+D D  VNG   YS+   N +  F V        L++   +  +  S  +F   + A D G      +    I +T+ N   P F      + + EN   GS + +  A+D D+GVN  I YS++   G    S  F ++  +G + LV ++DYE   ++++   V A D G    +  + V + V D+NDN P L    N S     I EN PSG  VL     D D  S             + + S+DDG            + +TQ F D E  +   + +   +           +HV I  +N+ +P+F Q +Y F + E+ P+   V  + A+D D   +  V  + F   +   F+++   G + + + +DRE   +    V   + G +     ++  V V I D ND    S+ L    ++E   +   V  +S  D D    G  TF   I S N+    +    +G I++   LDRE   LY +  +  D G   A  TT  V + ++D+NDN P  +    K        +  + P+  T++ L A D DL  N    T++L  ++ +   +  ++S         ID   KP  + +   ++D G+P LTS +   + VL Q + P  + +
Sbjct:  631 LSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---DAGGFLHLRASLAGDAGS--IFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG----SGLFDISRASGDVLLVGELDYE--TEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML----NASDYYPVIPENAPSGTTVLVMDAVDADSPSN-----------AVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDS-PPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVV-VALEDVNDNGPFLLTSSAK--------VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKP-EFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARD 1283          

HSP 4 Score: 108.997 bits (271), Expect = 3.920e-24
Identity = 150/688 (21.80%), Postives = 277/688 (40.26%), Query Frame = 1
Query:  298 NLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE--FPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRI-------FTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIY-RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK--SKVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            N+ N  ++N N GEI+++  +DR++  +              ++     SP Q          +V V +++ DEND+ P F +  +  ++ E     FP++ +   +D D   N    +S+    +      I      + ++ +++ ED S   +   + A+D     +   TD+ I + D NDN P F      IE  E     ++V +  ASD D G N  + + +      +S +  F +   +G +  V  + Y +            ++F+V A D GR  LS+ ATV + ++  N N P  +  + +  +     +G  +L  S  D D     Q+              VD G +  + ++   DA       + +   D   P +       + + + N   P+F+       + EN P  +++ +++A+D D      + +SI        F I  A+G + +   +D E  + ++  V   D G  +    S V + + DVNDN P       Y  I EN     +V  +   D D   N   T           F L  K+G +     LD E K  Y +    +++ +     +TA V + I  +N+  P F+    + ++  +  +   +P    + ++ ATD+D   +  + Y L   + S    +N  TGEI
Sbjct:  378 NIGNVFRVNPNSGEIRSVSTLDRENVASY----------ELTVKATDRGSPTQHC--------TVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRV-STLDADEGPNAAITFSL---LDPSLPFSIHPSTGEITVSRRLNREDRSG--YAVKVRASDP---AWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM------RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDA--GSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSN-AVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHY-STAQVHVQITGVNEYFPRFV----QREYNFV--VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEI 1021          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 1.103e-43
Identity = 170/637 (26.69%), Postives = 293/637 (46.00%), Query Frame = 1
Query:  463 NFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYS-IDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITE-NEPS-GK-IVLTFSFTDLDELSKNQLKCDFYRS----FGLAID-----SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVN-KLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF----IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
             F   S  + + V+++D ND+ P F  S++   + E+     I++  A+D+DS +NG   YS ID N  N+F   ++  +  +     +D E+ +   +   + ATD G     C   + I +TD NDN P F  +  +  + E+ +VG  V +    D D G N+ I +SL         S  F ++ +TG + +  +++ E   DR    + +        +ST  T++V   D+NDN P     Q     E  EPS G+ +V   S +D D+ +  Q+   F RS    F +  D     SV    YR  +     A  N++ ++ +  +D   P +     + + I+  N N P+F + +Y   +   +   T +  +SA D D  DVN ++ +S++  N    F +D A G L ++ ++  +    F   V+  D G+  LS+++   + + + N  AP+ +   +   + EN     S+A+++ TD D   NG   +       +  F +++ SG ++L+  LD E + LY +     D G + A T  + VSI + D+NDN P+      YP           I  ++PS TT++ + A D D   NA   Y LD   A  F  +N +TG
Sbjct:  312 GFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVF--RVNPNSGEIRSVSTLDRENVAS--YELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT-QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSL------LDPSLPFSIHPSTGEITVSRRLNRE---DRSGYAVKVRASDPAWTVSTDVTIVVD--DVNDNAPRF--GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF-FMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFV-VTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDR-DVNGQIAYSVVGGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-GGWQAKTECSGVSISVTDVNDNPPMLNASDYYPV----------IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFV-LNQKTG 914          

HSP 2 Score: 172.555 bits (436), Expect = 1.287e-43
Identity = 167/678 (24.63%), Postives = 299/678 (44.10%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNE-FKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKS--KVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLR--ATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY----FFYIDMIPKPG-------MYSIKATVSDNGTPSLTS--WMEFFIVLSQANFPK 2439
            VTV + DEND+LP F  ++    + E  + P+   + L  A D D+ +N +  Y +     +  +     Q   +  T  +D E   +  +   + A D G          + + +TD ND+ P F           +   G+ V+   A D D+G N  +++SLS      S S  F ++   G++     +  +   D + T  V  +D G    S   TV V+  D  +  P       + S  E++P G  +   +       S+      ++ + G  +    +VD     ++  +  D E+     + +   D+  P       L V ++DINDN P+FS ++++ ++ EN P  T V  L+A D D+    ++++SII     N F ++P +G +   + +DRE + ++   V+ TD G  +     KV + + D NDN+P+ T + + H+ E+  +   V ++S  D D+  N   TF   ++  + PF +  S G+I + + L+RE +  Y +     D     A T +  V+I + D+NDN P F    + + +     I +  PS    +  R  A+D D   N ++ + + ++   +F ++  ++GEI+      Y D  P  G        YS   T  D G P L+S   +   IV+  AN P+
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPE--DAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ---IITTASLDRE--GRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS-----GSASAGFSVDPRRGVIHAARAL--QGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARS----SRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFS--LLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDP----AWTVSTDVTIVVDDVNDNAPRF---GQTAYY-----IEFPEPSEGEALVARVSASDADDGANGQVFFFM-RSQTENF-RVGRDSGEIHSVRPLRYRD--PAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPR 650          

HSP 3 Score: 168.318 bits (425), Expect = 2.234e-42
Identity = 177/690 (25.65%), Postives = 294/690 (42.61%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-----ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIY---------RIASTQVF-DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD---NSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS----NKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNEN-AKLTYRLDKTNAS--SFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI-VLSQANFPKSSSN 2451
            +S    VT+NI+  N + P F + +Y   +  +      IL   A+D D  VNG   YS+   N +  F V        L++   +  +  S  +F   + A D G      +    I +T+ N   P F      + + EN   GS + +  A+D D+GVN  I YS++   G    S  F ++  +G + LV ++DYE   ++++   V A D G    +  + V + V D+NDN P L    N S     I EN PSG  VL     D D  S             + + S+DDG            + +TQ F D E  +   + +   +           +HV I  +N+ +P+F Q +Y F + E+ P+   V  + A+D D   +  V  + F   +   F+++   G + + + +DRE   +    V   + G +     ++  V V I D ND    S+ L    ++E   +   V  +S  D D    G  TF   I S N+    +    +G I++   LDRE   LY +  +  D G   A  TT  V + ++D+NDN P  +    K        +  + P+  T++ L A D DL  N    T++L  ++ +   +  ++S         ID   KP  + +   ++D G+P LTS +   + VL Q + P  + +
Sbjct:  631 LSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---DAGGFLHLRASLAGDAGS--IFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG----SGLFDISRASGDVLLVGELDYET--EKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML----NASDYYPVIPENAPSGTTVLVMDAVDADSPSN-----------AVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDS-PPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVV-VALEDVNDNGPFLLTSSAK--------VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKP-EFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARD 1283          

HSP 4 Score: 108.612 bits (270), Expect = 4.636e-24
Identity = 150/688 (21.80%), Postives = 277/688 (40.26%), Query Frame = 1
Query:  298 NLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE--FPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRI-------FTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIY-RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK--SKVYVKILDVNDNAPQSTTLMTYH-IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            N+ N  ++N N GEI+++  +DR++  +              ++     SP Q          +V V +++ DEND+ P F +  +  ++ E     FP++ +   +D D   N    +S+    +      I      + ++ +++ ED S   +   + A+D     +   TD+ I + D NDN P F      IE  E     ++V +  ASD D G N  + + +      +S +  F +   +G +  V  + Y +            ++F+V A D GR  LS+ ATV + ++  N N P  +  + +  +     +G  +L  S  D D     Q+              VD G +  + ++   DA       + +   D   P +       + + + N   P+F+       + EN P  +++ +++A+D D      + +SI        F I  A+G + +   +D E  + ++  V   D G  +    S V + + DVNDN P       Y  I EN     +V  +   D D   N   T           F L  K+G +     LD E K  Y +    +++ +     +TA V + I  +N+  P F+    + ++  +  +   +P    + ++ ATD+D   +  + Y L   + S    +N  TGEI
Sbjct:  378 NIGNVFRVNPNSGEIRSVSTLDRENVASY----------ELTVKATDRGSPTQHC--------TVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRV-STLDADEGPNAAITFSL---LDPSLPFSIHPSTGEITVSRRLNREDRSG--YAVKVRASDP---AWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM------RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDA--GSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSN-AVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHY-STAQVHVQITGVNEYFPRFV----QREYNFV--VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEI 1021          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 1.714e-43
Identity = 174/643 (27.06%), Postives = 281/643 (43.70%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSI--DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDS----GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKC-------DFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCW-----IEINCLDNASPIIKKLFHLHVPII--DINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC---NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIA-------ENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVA-LTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTII-TLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V +N++D ND+ P FQ+  Y     E+ N    ++  +A D DS  N    YSI   + Y++ F + +     ++ +   +DYE          + A D G           + + D NDN P FD    +I I ENI  G+ V    A+D D     G  SLI YSL         ST+F +N+ +G +     +D E     I     +    G    +  ATV + ++D+NDN P    +    +I EN P G  + T S  D D L++N            FYR     I++   G  R    Q+   + N   +     I ++  D  SP  +      V ++  D+NDN P F    Y  ++ E LP  + ++Q++A+D D      + +S+        F +D A G+++    +DRE +  +   +  TD G   LS+ + + + +LDVNDNAP      T+H A       E+   D  V  L+ TD D   N   +F  +I   N   + +   + G +  +  LDRE K  Y +     D+G   +  T T T+ + + D+NDN+P+F+        G  +    ++ +R  II  ++ATD D   N ++ YR+   N      +N  +G I
Sbjct:  117 VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEG-------STQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPD-LNENGTLVYAIDPPNPFYR-----INAA-SGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAP------TFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSF--FITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFL-------EGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLI 729          

HSP 2 Score: 169.859 bits (429), Expect = 8.588e-43
Identity = 164/607 (27.02%), Postives = 286/607 (47.12%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN---SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKK--LFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-YFTIDPANG-ILSIKTNIDREEIENFHFE------VQITDTG----QLSNKSKVYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTY 2244
            S  V + +I+END+ P F    Y++++ E+      ++   A D D+ V G   Y   ++ +      +D  + ++++   +D+E + +  F   + A D G  E   +  + I++ D NDN P F          EN +  + V +  A+D+DS  N+ I YS+ P S   S  +   ++   G++ L   +DYE       +  ++A D G   L+++ T IV+V D NDN P  I  +N+   +I EN  +G  VL  + TD D+  +       Y   G     ++     I ST + D E      + +  +D      +K  +  +++ ++D+NDN P +    Y   I EN P  T+++ +SA+D D ++   L ++I   N ++ I+ A+G I +    +DRE++    F       V   D G    + +  + V V + DVNDN P    L     + E    + ++ Q++ TD D+  NG  T+          F+L   +G I  +  LDRE    Y +  +  D G   AL++T T+S+ + D+NDN P F +P  +S   L++ +  DS     +I+L  TD D   NA+L++
Sbjct:   13 SARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKF---SLDPASGLISVAAALDFEATPR--FTVTVMARDGGGQETAGR--VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFS-ITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP--IFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGT-PALSSTTTLSLVVLDVNDNAPTF-HPA-RSAVSLMESVARDS----VVISLNCTDADSGLNAELSF 602          

HSP 3 Score: 155.606 bits (392), Expect = 1.774e-38
Identity = 166/586 (28.33%), Postives = 254/586 (43.34%), Query Frame = 1
Query:  766 LFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS----ITENEPSGKIVLTFSFTDLDELSKNQ-----LKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNS-DVNKLN--FSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG----QLSNKSKVYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL--TKSGKIILMK-HLDREKKDLYLIPFIVY--------DHGNFV-ALTTTATVSIHIQDINDNKPVFIYPKEKSKHGL--IKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            LFA +    E      + I + + NDN P F      + + EN ++G+ V Q +A+D D+GV   + Y  S        S KF L+  +GL+ +   +D+E      FT  V+A D G     T+  V + ++D+NDN P   V Q +S      EN+ S   V+    TD D    NQ     L    Y S+     S   G+  +A    ++        + I  LD  SP +       V + D NDN P F +  Y   I EN+     V  ++A+D D S +  +L+  +S+     F I+  +G ++  T +DRE +  +   V+  D G    Q +  + V + +LDVNDN P    L     I ENT     +  +S  D D  ENGT     Y +   +PF      SGKI      LDRE  DL  I F           D G+     T +ATV++ +QD+NDN+P F+        GL     +    P+ +T+  + ATD D   N  +TY +         ++++ TG I             Y ++   +D GTP+L+S     +V+   N
Sbjct:    1 LFANETS-GEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFS------DDSDKFSLDPASGLISVAAALDFEATPR--FTVTVMARDGG--GQETAGRVRINLLDVNDNTP---VFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLV---YAIDPPNPFYRINAASGKIRTTGLQLDRE--DLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFV--------GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVN 559          

HSP 4 Score: 138.272 bits (347), Expect = 4.061e-33
Identity = 145/632 (22.94%), Postives = 266/632 (42.09%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP--KAIDRDSLVNGV----RHYSIDNNYNNLFIVYIDKQAPILNI-TGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNF-DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDS----VDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF--SQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--------YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ-LSNKSKVYVKIL--DVNDNAP-------QSTTLMTYHIAENTQIDQSVAQLSFT-DNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTAT------------VSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL 2250
            V VN+ DEND+ P F+     +  +  +  P  LL    A DRD+  NG      H          +I+ I  ++ +  +   K D+ + + +   F + A D G        ++ + + D NDN P F       + ++E  + G++V    A+D D+G N  + + +    G      K  +  + G++++    + +      +T +V+A D G   LS SA V V V D+ND  P  +   Q  S+ E+   G  V T   T   E  K       Y+  G+  ++       G+  + ST++  + + RF    +   D+  P +     L+V ++D+ND+ P F          I E +P+   + ++ A D D      + +S +            F I+  +GI+S    +DRE    +   +  +D GQ +S +S   ++++  D++DN P             ++ I E++    +V  +S   D D   N    +     +  + F L++ G ++++  LDRE    Y I      + N+    TT              V ++++DIND  PVF      + H     +  D+   + ++ L A D+D+  N+ + YR+
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGG-----DKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT---ENYKGHNTKYTYKIAGIGKNAFTVHATSGL--VTSTRLLKS-YERFNLTAV-ATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVF------TNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 5 Score: 136.346 bits (342), Expect = 1.737e-32
Identity = 140/556 (25.18%), Postives = 249/556 (44.78%), Query Frame = 1
Query:  814 IFIHITDANDNYPNFDFKEKT-IEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYL---NSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG--LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI--IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAP---QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENG----TFTFKEYIMSNN-SPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLR-ATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYS---IKATVSDNGTPSLTSWMEF 2406
            +++++TD NDN P F+    T +E+ E+ + G+++    A+D+D+G N  +       +G + I  ++ L   N +   +  V K D+     +   F ++A D G    ST+  + V V+D+NDNVP  +       S+ E    G +V +   TD D     Q+        G  L+I    DGI R+A     D E      + +  +D  +P +     + V + D+ND  P F        + E+L + + V  + A++       K  + I  I  N FT+   +G+++    +  +  E F+     TD G+  L  ++ +YV++LDVND+ P           +I E   +   + ++   D D+ +NG    +F     + S +   F++   SG I   + LDRE + +Y +  +  D G  V+  +T  + + + DI+DN+PVFI   +         I   SP  T +  +  A D D+  NA + Y +   N  +  K N     +     D+  +   Y    +KA+ + N TP++T+  EF
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTR-IPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGP-SDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL--KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGN--KFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEF 2374          

HSP 6 Score: 132.494 bits (332), Expect = 2.420e-31
Identity = 155/552 (28.08%), Postives = 251/552 (45.47%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP--KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATD---DGLNEFKCKTDIFIHITDANDNYPNF-DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSG-PKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLK---------CDFYRSFGLAIDSVDDGIY--RIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLS----ASDLDNSDVNKLNFSIIQCN--YFTIDPANG--ILSIKTNIDREEIENFHFEVQI--TDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENT-QIDQSVAQLSFTDNDKLENGTFTFKEYIMS-NNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHG 2040
            + +V + I DEND+ P F  + Y++ + E      + +    A D D   N    Y+I +  N      ID    +L     +D+E S+  L+  ++ ATD   D          + +H+ D ND  P F    E  I++ E    G  +  F+ASD+DSG+N  ++YS+  + G P++   +F ++   G L++   V+ +      +   ++A D G   L+++ TV V+V+D++DN P  + +  N S++E      IV     +D +E  +N            C+  R+F    DS    +Y  R    +   AE+     +  N  DN S   K    + V I+D NDN P FSQ  Y  EI EN P  T +  L+    ASD D      L +S++  +  YF ID   G   +++   +DRE I     E+ I   D G+ +   ++ V +LDVNDN P  + T  T H+ EN+  +  SV  +   D D       T +  I S  N  F + +S G I+ +  +D E +  YL+  +  D  
Sbjct: 1155 TTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSG-NTAATFGIDNGTGVLTAVKALDFEVSAG-LYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSI--IDGDPRN---EFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANE-GRNCAALLQHSPTSFCNGERAF--YADSQTGLVYVNRPLDRERV-AEYRLTLTVRDNP-DNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA 1693          

HSP 7 Score: 119.783 bits (299), Expect = 1.749e-27
Identity = 159/672 (23.66%), Postives = 273/672 (40.62%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEF--PLILLPKAIDRDSLV--NGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLK-LVNKVDYENFIDRIFT----FIVIATDSGR------LHLSTSATVIVKVMDINDNVPELIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSV-------DDGIYRIASTQV-FDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF-SQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI--IQCNYFTIDPANGILSIK--TNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR------LDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            +V + V ++D ND+ P F  +    +++E++      +++ KA+DRD  V   G   YSI +  N+ F   ID+   ++     IDYE   + L   ++ ATD          ++ + + +  D   +F        + E    G++V +  A    +     +  ++      +    K   +    L+  L  ++  +  +DR  T      V++ D G       L     A V V V D NDN PE          + E+   G ++     TD D  S   +    +   G  I          + G+  +   +  F  + ++F    I  LD  SP     F+L V ++D+NDN P F S   Y   + E     T V  + A+D D     ++ F I     +  +I P++GI+ +    NIDRE    +   V   D G   LS  + V V + DVND  P     + T  + E+  +   VA +  T+N K  N  +T+K   +  N+      SG +   + L   ++  + +  +  DHG    L   A + + + D+ND++PVF+ P     +G +  I    P    I+ + A D D  +N  + Y       +   +  SF +IN+ +G I            +YS+    SD G P
Sbjct: 1593 TVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTF--GIDESTGLIVTVAPIDYETRPEYLL--MVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYER--FNLTAVATDHGR-PPLWGQAGLYVEVLDVNDHRPVFVLP----PNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESF-RINATSGIISTARALDRESQAVYSLILLASDQGQP 2252          

HSP 8 Score: 119.013 bits (297), Expect = 3.140e-27
Identity = 146/580 (25.17%), Postives = 247/580 (42.59%), Query Frame = 1
Query:  799 KCKTDIFIHITDANDNYPNFDFKEKTIEILENIS-VGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGR---LHLSTSATVIVKVMDINDNVPELIVHQNNSI--TENEPSGKIVLTFSFTDLD-----ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ------CN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK-----VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLS----FTDNDKLENGTFTFKEYIMSNNSPFKLTKSGK----IILMKHLDREK--KDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPS-RTTIITLRATDQDLN--ENAKLTYRLDKTNASSFTKINSETGEIYFFY-IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            +  T + I ITD NDN P F      + + E  S  G  V    ASD D G N+ + Y++  +SG  + +  F +++ TG+L  V  +D+E     ++  +V ATD  R     L+++ATV V V D+ND  P  +      I  +E +P  +I  TF  +D D     EL  + +  D    F   + S  DG  R+      D E   F  + I   D  +P +     + V ++D++DN P F        + E   +   V ++ ASD +     +   +++Q      CN    F  D   G++ +   +DRE +  +   + + D     + ++     + V ILD NDN+P  S       I EN+     +  L+     +D D   N T  +   ++  +S + L    +    + L + LDRE        +  +V D G   A   T  + + + D+NDN P F    + +       +  +SP+  T++I ++A D+DL   +   + Y +      +F  I+  TG I     ID   +P  Y +    +D   P  T+  E  + L
Sbjct: 1153 QATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI--VSG--NTAATFGIDNGTGVLTAVKALDFE-VSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIA-TFMASDQDSGLNGELEYSIIDGDPRNEF---VISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANE---GRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYS--LLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNA---TVRLGVTVLDVNDNTPTFNVTSQTAH------VLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTF-GIDESTGLIVTVAPIDYETRP-EYLLMVVATDQAPPFHTASCELRVSL 1707          

HSP 9 Score: 116.316 bits (290), Expect = 2.463e-26
Identity = 159/638 (24.92%), Postives = 257/638 (40.28%), Query Frame = 1
Query:  451 QTIDNFQSISRSVNVTVNIIDENDSLPFFQKS-KYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLS---GPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIA-TDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFS----FTDLDELSKNQLKCDFY--RSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLP-IYTNVYQLSASDLDNS--DVNKLNFSIIQC--NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVND-NAPQSTTLMTYHIA-------ENTQIDQSVAQLSFTDNDKLENGTFTFKEY-------IMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTT-----TATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIIT-LRATDQDLNENAKLTYR 2247
            Q  D  + ++ +  V+V++ D ND  P+F +S +  I++ E    P I    A D+DS +NG   YSI D +  N F+  I      L +   ++ +  +Q  ++  + A D G         + + + D +DN P F        + E  +V +IV +  ASD + G N       SP S   G ++    FY +S TGL+ +   +D E   +   T  V    D+       S  +IV ++D NDN P    V     I EN P+G ++   +     +D D      L        S    ID  D G   +A  Q  D E      +E+  L            L V ++D+NDN P F+       + EN P + T+V  + A D D    D   + +SI     + F ID + G++     ID E    +   V  TD     + +   +++   N+ +   S +L  Y  A           +  +  Q+       L       K +         S+N+       G+I     LDRE  D Y++  +  D G   A+        A V +++ D NDN P F    E     L++    +S +  T++T L ATD+D   N  ++ R
Sbjct: 1254 QPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFV--ISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERA----FYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDR-DRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEF----EAGSATLVE--VRESAAPGTLLTVLHATDRDAGSNGTVSAR 1878          

HSP 10 Score: 106.686 bits (265), Expect = 2.217e-23
Identity = 123/541 (22.74%), Postives = 225/541 (41.59%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVY---------IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFY-LNSTTGLLKLVN-KVDYENF----IDRIFTFIVIATDSGR--LHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK----SKVYVKILDVNDNAPQSTTLMTYHIA--ENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKH--LDREKKDLYLI 2016
            +V   V + DEND+ P F ++ Y I I E+      +L   A D D              Y  L ++Y         I+ ++  +  T  +D E  SQ +         DG ++      + I + D NDN P +      + I+EN   G+ ++   A+D D   N  + Y++ P          FY +N+ +G ++    ++D E+        + + +V   D G      + SATV V + D+NDN P  + +     + E  P+   +   + TD DE +   +      +       +D     I +    D E      + +   D  +P +     L + ++D+NDN P F  A+    + E++   + V  L+ +D D+    +L+F I   N    F++   +G++    ++DRE   ++   ++  D G   ++    + + V +LDVNDN P      +Y ++  EN      + Q+  TD D+  NG   ++    + +  F +  S  +I      LDRE   L+ +
Sbjct:  224 TVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQ----------SPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDP-------PNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLE-GSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHAL 746          

HSP 11 Score: 97.8265 bits (242), Expect = 9.991e-21
Identity = 123/519 (23.70%), Postives = 219/519 (42.20%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLP-FFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKV-DYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS---ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIAST-------QVFDAEFNRFCWIEINCLDNASPI-IKKLFHLHVPIIDINDNYPQF-----SQAKYY-FEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII----QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITD---------TGQLSNKSK------VYVKILDVNDNAPQSTTL-MTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK 1914
            S + N++V ++D ND++P F     Y ++++E      L+    A D D+  NG   + I++   +     I     I+ +    + +  ++  +  ++ A D G         + + + D ND  P F    +T+ +LE++SVGS V    A++   G N+   Y ++ +         F +++T+GL+     +  YE      F    +ATD GR  L   A + V+V+D+ND+ P  ++  N +   ITE  P    ++     D DE     ++  F  + G  + S D   +RI +T       +  D E      + +   D   P+  +    L V + DI+DN P F       A Y  F I E+ P  T V  +S +   +   N + +  I    + N F +    G+L + +++DRE    +   V+ +          TG   + SK      V V + D+ND  P  T    T  +A + ++   + QL   D D   N    ++
Sbjct: 1934 STTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKL--SIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIG-----KNAFTVHATSGLVTSTRLLKSYER-----FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGG--VGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLS-RWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYR 2437          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 217.624 bits (553), Expect = 1.267e-57
Identity = 214/778 (27.51%), Postives = 368/778 (47.30%), Query Frame = 1
Query:  151 ISNDATIYSHKSF--NISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN--NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQV-------FDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSII---QCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            ++++A +++  S+  ++ +N+     +  +  T+++  EN    Y+L  G TS +  VN       G + T R +DR+D                Q  + +  + +      QS   ++ +T+N  D ND+ P F +SKY + + E+      IL   A D D+  NG   YSI   N+ N F   ID     + + G +D E  +   ++  + A D G+  +     + I + D NDN P F   E +  I E +S+GS V    A+D+D G N+ + YS+      +  ++ F +N+  G+L +  +++ E      +T  + A+D G   +++   + V V D+NDN P +   Q+   S+ EN      VLT +  D D  +   L+          I   D+  ++I ST          D E      +E+   D  S    K  ++ + +I++ND  P F+Q  Y   + EN P  T+V ++SASD D+     L++SI+     + F+ID  +GI+S    +DRE +  +  +V++TD G   LSN + V +KILD NDN+P+  ++  +  I EN+       +L+ TD D+  N   T   Y +S N  F +   SG I L + LDRE K  Y +     DHG      ++ T+ + + DIND++P+       S  G ++    + P  T ++ + A+D D   NA+LT+ L      S   +++ TG+I         +  +Y+++  V+D G PSL+S  +  I
Sbjct: 1092 VNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS-KFEVNPA----TGLVTTKRPLDRED----------------QASYSLRVTAMDHGKPSQSAVAAITLTIN--DLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAF--RIDSTTGRITVVGVVDRE--ALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV-----RGDTSAFAINAMNGVLTVKKEINRETV--PTYTLTIRASDRGSPMMTSDKELTVVVNDVNDN-PPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI-------ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD--SKYTAKT-NVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARIT---YNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGT-PPQASSITIRVTVIDINDHRPLI---NSSSLRGSVR---ENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVII 1812          

HSP 2 Score: 201.83 bits (512), Expect = 1.185e-52
Identity = 193/771 (25.03%), Postives = 346/771 (44.88%), Query Frame = 1
Query:  115 IYFFSKIFFTIGIS----NDATIYSHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRK-IDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLS---GPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID-SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKI--LDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDN 2373
            + F +     I I+    N  T      FNIS++    T +G +  T+++   N  + +   S  N  N  QL+ +  I ++R  +DR          +        ++     SP Q+I        + ++ V+++D ND+ P F+KS +   I E ++    +L  K  D+D   NG    S+    ++ F   ID    +L+ T  +DYE ++   +   + A D G         + I I + NDN P+F    +   I E++++ + V +  A+D D           +PL+      +  + F ++ ++GL+ +  ++D E   +  +T +V AT++G    S      ++V+D+NDN P         S+ EN P G+ V   + TD DE      K  +  S G      V+     + + +  D E      + +  +D+  P    +  + + I D+NDN PQFSQ+KY   + EN    +N+ ++ ASD D     ++ +SII  N+   F ID   G +++   +DRE + +++  +   D+G     S  +V I   D NDN+P  ++   +Y I E   I   VA ++ TD D+  N    F   +  + S F +   +G + + K ++RE    Y +     D G+ + +T+   +++ + D+NDN PVF      +    I  +  +S   T+++T+ A D D+  NA L Y +   N     KINS +G I         +   Y ++ T +D+
Sbjct:  768 VRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISG-NQGNSFQLDPRSGILSVRSTLDR----------ETIPSYTLVVKASDAGSPQQSI--------TASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFT--IDSTGFVLSKT-PLDYETTAA--YQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDG----------TPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTAN--YTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDE--GENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV-FYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPM-MTSDKELTVVVNDVNDNPPVF------NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS 1492          

HSP 3 Score: 196.052 bits (497), Expect = 8.020e-51
Identity = 196/758 (25.86%), Postives = 346/758 (45.65%), Query Frame = 1
Query:  193 ISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQK-SKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYS-IDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIV-HQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNF--SIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK--SKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYF---FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            + +N+ A   + ++  T+ ++  N ++ +   S    + +      GEI T   +DR+               +      IN      +  F +   +  V ++I DEND+ P F   S+++I+  +S     +    A DRD   NG   Y+ I  N  N F   +D ++ IL++   +D E  +   +  ++ A+D G  +      I + + D NDN P F+    + EI E+ SV S V Q    DKD G N  I  SLS        S  F ++S TG +     +DYE      +   V A D G    S +A V + ++++NDNVP  +   Q  SI E+      V+  + TD D      L  D       +   +D     I+  +  D E      + +   +  S       +  + ++D+NDN P F+   Y   + ENLPI   V +++A+D D  +  K+ +  S+   + F ++PA G+++ K  +DRE+  ++   V   D G+ S    + + + I D+NDN+PQ S +  T  + ENT    ++ ++  +D D   NG  T+     ++ + F++ + +G+I ++  +DRE    Y +     D G      +TA V+I + D NDN P+F     ++ +G+ + +     SR  ++T  ATD+D   NA++ Y + + + S+F  IN+  G +        + +P    Y++    SD G+P +TS  E  +V++  N
Sbjct:  694 VGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRE--------------TIASYSLTINADDGSLV-RFMA---ATTVNISIADENDNQPTFTGPSRFNIS-EDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSF--QLDPRSGILSVRSTLDRE--TIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEG-----SDNFTIDS-TGFVLSKTPLDYETTA--AYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSG-VPPWVSTAFVAITVADENDNSPIFA--SNETSYGIDEGVSIG--SRVAVVT--ATDRDEGSNAQVFYSIVRGDTSAF-AINAMNGVLTVKKEINRETVP---TYTLTIRASDRGSPMMTSDKELTVVVNDVN 1406          

HSP 4 Score: 192.971 bits (489), Expect = 7.321e-50
Identity = 196/666 (29.43%), Postives = 300/666 (45.05%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDI-FIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS---FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLS--NKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNN--SPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYP-----KEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL-DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            V +++ DEND+ P F  + Y  NI E+     + +  A DRDS  N    YS+ +  N   +    K   I  +T  +D+E           F   DG    K  T +  I + D NDN P F        + E+++VGSIV Q  A D D G+N+ + YSL  +SG     T ++   + G+++     D E      +   + A D G    S  ATV ++++D+NDN P     Q   S+ E+   G  ++T + +D D  +   L+  F          +D+V  G+  ++  +  D E      + ++  D  SP +    HL + + DINDN P FS + Y   ++EN P  T   Q+SA+D D+S    L F II+ N    FTID + GI+SI  + D E    +   VQ  D G     + ++V + I DVND++P  S +  +  I E+T I  +V  ++ TD D    G   ++  ++S N    F +   SG I +   LDRE    Y +     D     + +++  V+I +QDINDN P+F  P      E S  G              I  + ATD D + N  + Y L D T+  S   IN+ TG I         K   Y +  T  D GTPS +S     +++   N
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMN--SKTGEIRTVT-PLDHETKDSYTMRISAF---DG----KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL--VSG----DTSYFTVDSQGVIRTKGAFDRETKAS--YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAV-TGVVTVS--RSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR--LISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGH------------QIGQVAATDADDSSNGDVRYALSDNTDVFS---INTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVN 679          

HSP 5 Score: 187.578 bits (475), Expect = 3.889e-48
Identity = 197/742 (26.55%), Postives = 329/742 (44.34%), Query Frame = 1
Query:  262 NYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYS-IDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR------SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSS 2445
            +Y L+ G TS      Y  ++++G I+T    DR+ + +    L+           +   SP        S S    V + I+D ND+ P F  ++Y  ++ E       ++   A D+D+  N    YS    N N+ F   +D    ++ ++  +D+E  S   +   L  TD G       + + I++ D NDN P F        + EN   G+   Q  A+D+DS  N  + + +  + G  +    F ++ +TG++ +    DYEN     +   V A D G      +A V + + D+ND+ P       +  I E+   G  V+T + TDLD   + +L+   YR           ID+ + G  R++S    D E      +++   D  S        + + + DINDN P F Q  Y F + E+      + Q++A+D D+S    + +++    + F+I+ + G++++KT +D E+   +   V   D G  S  S   VK++  DVNDN PQ + +L T  + EN     +V  ++ TD D   NG  ++     + N  F + + +G+I     LDRE    Y +  I  D G+ V      TV+I I D NDN+P F  P   +       I  DSP+ T +  L ATD+D+  N  +TY +   N     + NS       F +D  P+ G+ S+++T+     PS T      +  S A  P+ S
Sbjct:  204 SYSLVSGDTS------YFTVDSQGVIRTKGAFDRETKASYQVALRA----------QDGGSP--------SRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFT--LDAVTGVVTVSRSLDFEQRSS--YALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGI--IKG--NDDGVFTIDGSTGIISIAKSPDYENKTR--YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLE---YRLISGNVKGAFNIDA-NSGSIRVSSE--LDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSL-TINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFN-------ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGN-----QGNS-------FQLD--PRSGILSVRSTLDRETIPSYT----LVVKASDAGSPQQS 875          

HSP 6 Score: 185.652 bits (470), Expect = 1.618e-47
Identity = 184/659 (27.92%), Postives = 296/659 (44.92%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNE-FPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLD-----ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKI--LDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGT-FTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            VT+ + D ND+ P FQ   Y   + ES+     I    A D D   NG   Y++ +N +   +  I+    ++ +  ++DYE  +Q  +   + A D G       T + + + D NDN P F     T  + EN++ G  V    A+D DSG N  I YS+  LSG ++++  F ++  TG +     +D E      ++  + A D   +    + TV + + D NDN P        +I+E+ P+G  V   + TD D      ++   +  +   SF L   S   GI  + ST   D E      + +   D  SP       +HV ++D+NDN P+F ++ +  EI E+  +++ V Q+   D D      +  S+     + FTID    +LS KT +D E    +   V   D G  S  +   VKI  ++VNDN P   +      I E+  I+  V +L+ TD+D    GT  TF     +  S FK+ +S G I + K LDRE    Y +     + G+    +     +I + D+NDN PVF      +     K +  + P   T+  + ATD+D  ENAK+TY L   + S F ++N  TG +             YS++ T  D+G PS ++     + ++  N
Sbjct:  569 VTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD---VFSINTSTGLITLKTQLDYEKKTQ--YMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI--LSGNENMA--FAMDRFTGEITTRVPLDRETIAS--YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRS---GILSVRST--LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLS-KTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD----GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGS-QGESVYNNATIRVLDVNDNAPVF------NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKF-EVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLN 1197          

HSP 7 Score: 183.341 bits (464), Expect = 8.417e-47
Identity = 169/575 (29.39%), Postives = 266/575 (46.26%), Query Frame = 1
Query:  643 YSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYE---NFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLD-----ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKII-LMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFI---YPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            YSI D N   +F   ID     +  TG+  ++  S+  +   + A D      K +T + I + D NDN P F        I EN     +     A+D+DSG N+ I YSL   SG      KF +NS TG ++ V  +D+E   ++  RI  F       G+ H  T+   ++ V D+NDN P   L V++   + E+   G IV   +  DLD      LS + +  D   S+   +DS   G+ R  +   FD E      + +   D  SP       + + I+D+NDN P FS A+Y   ++E++ I   +  ++ASD DN +   L +S    N    FT+D   G++++  ++D E+  ++   + +TD G   L++ S + + + D+NDN P  S +     + ENT    +  Q+S TD D   NG   F     +++  F +  S  II + K  D E K  Y +     D G  V    TA V+I I+D+ND+ PVF    Y K+  +  +I          +T++T+ ATD D     +L YRL   N      I++ +G I
Sbjct:    1 YSIMDGNDQGMFT--IDSSTGSITTTGR-KFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSL--FSGEN----KFMMNSKTGEIRTVTPLDHETKDSYTMRISAF------DGK-H--TTFVPLITVDDVNDNAPFFALSVYKTG-VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT--SY-FTVDS--QGVIR--TKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENT---PAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKY-DTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIG---------STVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSI 535          

HSP 8 Score: 178.718 bits (452), Expect = 1.925e-45
Identity = 177/653 (27.11%), Postives = 300/653 (45.94%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSN---KSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSK-HGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP----KPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            +N+ D ND+ P F  S Y   + E+   P      A DRDS  NG   + I   N + +F   ID    I++I    DYE+ ++  +   + A D G+        + I I D ND+ P F     + +I E+  +GS V    A+D DSG    ++Y L  +SG  ++   F +++ +G +++ +++D E      ++  V A D G    S+S  V + + DINDN P         ++E+   G  +   + TD D+ S   ++  +  S    + S++     I      D E      + +   D  +P    L  + V + D+NDN PQF+++ Y   + ENL     V  ++A+D D+    K+++SI+  N    F +D   G ++ +  +DRE I ++   +   D G L      + V + I D NDN P  T    ++I+E++     V QL+ TD D   NG  T+     +  + F+L  +SG + +   LDRE    Y +     D G+    + TA++ + + D+NDN P F    EKS   G I+    D+   +T++ ++  D+D   N  +T  L    + +FT I+S TG    F +   P        Y +  T  D G+PS ++  +  I +
Sbjct:  364 INVNDINDNPPVFSPSAYQSRVKENT--PAGTQVSATDRDSSTNGALVFGIIKGNDDGVFT--IDGSTGIISIAKSPDYENKTR--YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL--ISG--NVKGAFNIDANSGSIRVSSELDRETTPS--YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVR--YALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTIN-ADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGS-PQQSITASIHVSVLDVNDNAPRF----EKSLFSGEIR---EDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFT-IDS-TG----FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITI 987          

HSP 9 Score: 153.295 bits (386), Expect = 1.481e-37
Identity = 145/556 (26.08%), Postives = 258/556 (46.40%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN--NSITENEPSGKIVLTFSFTDLDE---LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVK--ILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKE 2130
            V + + DEND+ P F  ++    I E       + +  A DRD   N    YSI     + F   I+    +L +  +I+ E  +   +   + A+D G        ++ + + D NDN P F+ +     + EN +  + V    A D D G N++++YS+  +SG  +   +F +NST+G++     +D+E      +   V ATDS     +    V ++V+++ND  P     QN   S+ EN P+   V+  S +D D    LS + +       F     S+D     I++  V D E      I++   D  +P +  L  + + I+D NDN P+F  + Y   I EN    +  ++L+A+D D     ++ +++ + + F I  ++G++++   +DRE    +   +Q  D G     S + ++  ++D+ND+ P  +++ +   + EN   +  V ++  +D D   N   TF      + S F L   +G I     LDRE++ +Y +   V D GN  +L++ A V I + D +DN P F  P E
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFA--INAMNGVLTVKKEINRE--TVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI--ISG--NDEKRFKINSTSGVIMTTTPLDFEE--KSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAF-TQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKF-----SIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGN-PSLSSVADVIIDVIDEDDNCPRF-QPTE 1828          

HSP 10 Score: 119.398 bits (298), Expect = 3.749e-27
Identity = 103/369 (27.91%), Postives = 176/369 (47.70%), Query Frame = 1
Query:  490 NVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN--NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD 1587
            NVT+ +I+ ND  P F +  Y  ++ E++     ++   A DRDS   G   YSI    ++     ID+++ I++    +D E  S  L+   +  TD G       T + I I D NDN P FD    +  ILEN +  S  ++  A+D D G N+ I Y+LS        +  F + +++G++ L   +D EN     +   + A D G    ++S T+ V V+DIND+ P LI   +   S+ EN+P    V+    +D D     +L      +   ++ ++D+    I++    D E      + I   D  +P +  +  + + +ID +DN P+F   +Y   I E+LP   ++ Q++A D+D
Sbjct: 1499 NVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDKF-SIDQRSGIISTADVLDRELVS--LYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSR-------NDAFMIGASSGVITLAQPLDREN--KSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 196.438 bits (498), Expect = 7.663e-51
Identity = 203/735 (27.62%), Postives = 338/735 (45.99%), Query Frame = 1
Query:  151 ISNDATIYSHKSFN--ISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAI-DRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS----ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNK-LNFSIIQC-NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG---QLSNKSKVYVKILDVNDNAP---QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            ++++  I+S   +N  I ++ QA + IGH+    ++   N ++++   S  N  N V +N+ G +    ++D           +    +   +Q +   +P         +    NVT+ +ID ND+ P F  S   + + E           ++ D DS V G   +S+ +N   LF   +D     L++T  IDY +S+ R +   + A D G         + + + D ND  P F     T  +LE     S + + VA+D DSG N  I Y+       K  ++KF L +  G + + +K+D E+  +  +   VIA D G    S+SA V V V D+NDN P     Q  S    + ENEP    +   S +D DE S   +   F       I  VD    +I ++QV D E        I   D  S P + K   + V + D+ND  P+FS+ KY   + E+LP+ +++  L A+D D    N  + + I+     F+++   G+L++ + +DRE        V  +D G    L   + + + +LDVNDN P     TT  T  + E   I   VA +   D+D+ +NG   +K    + +  FK+ + +G I  ++ LD E  + Y++     D G     T+   V+I+++D NDN+P F       K+ +I  I+ + P  T + T++A D D   N+++ Y +D  +  +  KINSETG I
Sbjct:  696 VNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVY-SISKGNTDNIVLINSTGTLYLQSEVDH----------EKIPSLYLTVQAKDKGTP--------PLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLF--NLDSNTGALSLTKLIDYGNSA-RSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDS----KVDTSKFGLRNG-GKIFIKSKLDREDIEE--YNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF---QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFI--VDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKT-QVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKT--VPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF------DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLI 1387          

HSP 2 Score: 173.711 bits (439), Expect = 9.882e-44
Identity = 191/774 (24.68%), Postives = 342/774 (44.19%), Query Frame = 1
Query:  193 ISDNIQANTFIGHIPLTEKEALENYQLLF---GKTSFRNLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF--PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVF------DAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ--CNYFTIDPANGILSIKTNID-REEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN--FPKSSSN 2451
            + +N   NT +  +   +++   N +L++     T  R+ +++  ++ + G I T   +DR+         Q  ++VL  +  +    P+         S + +V VN+ D ND+ P+F +S Y+ ++ E++    P++ L  A D D   N +  YSI       F+   D +  ++  +  +D+E   Q  + F + ATD G     C   + + +TD NDN P FD    ++E  EN  +G  + Q  A D+DS      K++++     +  + + +    +GL+ L   +D E   + + T  V A D G       A V + V+D+ND  P     + N +I E+  +  ++        D+ +  ++     +          D I  I ST         D E     ++ +   D  +P +    ++ + +IDINDN PQF+ +     + E+ PI    Y +S  D D+  + +++FS++      F +D   G LS+   ID      ++   VQ  D G    S+ + + +K++DVND +P       T H+ E T  D ++ ++  TD D  ENG  ++      + S F L   GKI +   LDRE  + Y +  I  DHG     +++A V + + D+NDN P F   ++ S    +K    + P  T +  + A+D D   N  +TYR D T  + F  ++ +TG+I    +        Y      +D G+       +  +++   N   PK S N
Sbjct:  398 VWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDRE---------QIPQVVLTVLVHDRGSPPL---------SDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQL-LAQDPDIGENSLILYSILTPNTPFFL---DPRKGLVTNSRTLDHE--VQSSYTFQVAATDGGGR--SCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSP-----KFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLT--VKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGN-------TDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGT-PRRSSSADVKVIVDDVNDNNPHF---QQASYAFFVKE---NEPVATYLGAVSASDSDEGSNGHVTYRFD-TQVAQFI-VDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKN 1122          

HSP 3 Score: 173.711 bits (439), Expect = 1.023e-43
Identity = 191/680 (28.09%), Postives = 312/680 (45.88%), Query Frame = 1
Query:  454 TIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSS-----QRLFHFLL--FATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLH-LSTSATVIVKVMDINDNVPELIV----HQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRS---FGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASP--IIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC-------NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAP---QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNE-----------NAKLTYRLDKTNASSFTK-INSETGEIYFFYIDMIPKPGMYSIKATV 2364
            TI  F +  +S  V V + D ND+ P F +      ++  N+        A+D D   N  + Y+I   N  N+F + I K+    ++   +    SS     +RL  ++L   A+D G         + I + D NDN P F     +  I ENI VG+ + Q  ASDKD G N+ I+YS+   S P++I   F ++ TTG++    ++DYE    R +  +V A D G  H LS+SA V ++V+D+NDN P + V      +  +TEN   G  V   S +D D     ++          F +  D ++D    IA  Q  D E +   +++  C+D   P    +K F ++V   D+ND  P+F +  Y   + EN  + T V  ++A D D    ++L ++I          ++F IDP++G+++  T++DRE+I      V + D G   LS+   V V + D NDN P   QS+      + EN+     V QL   D D  EN    +   I++ N+PF L  + G +   + LD E +  Y       D G     +  ATV + + D+NDN+PVF    + S + +    F ++    +I  L+A D+D  +           NA   + +D +   +  K ++ ET + Y   +  +   G  S+   +
Sbjct:   31 TIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKL-ISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI---FGIHPTTGVIVNNVRLDYE--AKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI-IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVG--DVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSS--YNASLFENSPSGSPVVQLLAQDPDIGENSLILYS--ILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG---GRSCNATVHVSLTDLNDNQPVF----DPSSYSV--EYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAI 688          

HSP 4 Score: 146.747 bits (369), Expect = 1.777e-35
Identity = 172/679 (25.33%), Postives = 292/679 (43.00%), Query Frame = 1
Query:  445 PIQTIDNFQSI-SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENE--PSGKIVLTFSFTDLDELSKNQ----LKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNAS-PIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK---VYVKILDVNDNAP--QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKH-LDREKKDLYLIPFIVYDHGNFVA---LTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF----YIDMIPKPGMYSIKATVSDNGTPSLTSWMEF 2406
            P+Q  D      S +  + + ++D ND  P F    Y  +++E+      I+   A D DS  NG   Y+ D+  +        +    + I  K+D ED  +  ++  + A D G        D+ + + D NDN P+F        + EN  V + +    ASD D G N  + Y         +   +F ++  TG +     +D E     +F+  ++ATD G         V V V D+ND  P+   ++  S+T NE  P G  +LT   TD D+   N     +     ++F L   +   G+  + S    D E      + +   D      ++ + ++ + ++D+NDNYP F     +  + E LPI + V  + A D D  D  K+ + I+  N    F I+   G++S    +D E    +   V  TD G+   K+    V + + D NDN P      ++T+ I EN  I+ +V  +   D+D   N    +     S  + FK+     +I   H +DRE+   Y +     D   F     L  TAT+ I IQD+NDN P F+     S++  +  +  D P    + ++ A D D  +   + YR+   +   F+ ++ +TG +       Y D +P+   Y++  + +D G+P LTS+  F
Sbjct:  881 PVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL--RNGGKIFIKSKLDREDIEE--YNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRF------DTQVAQFIVDKQTGKITTSQVLDREAKASYVFS--IVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKY-SVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVT---GVLTLVSP--LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITW-IYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQA-FTEQDRLYNTATLKIIIQDLNDNAPKFV-----SRN--LTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFS-LDLKTGVLKLIGSLDYED-VPQ---YTLHISATDLGSPPLTSYQLF 1527          

HSP 5 Score: 144.436 bits (363), Expect = 1.099e-34
Identity = 170/639 (26.60%), Postives = 304/639 (47.57%), Query Frame = 1
Query:  469 QSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL---ILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG---RLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYR-------SFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG---QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT---KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYD-SPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIY 2307
            QS+     + +N++D ND+ P F        + E  + P+   +    A+D D   NG VR+  ++ N +  F   I++   +++    +D+E +++ +    + ATD G  + K    +  I++ DANDN P FD       I EN+ + + V    A D DSG+NS I Y++   S P++    F +NS TGL++  + +D E   +  ++  V ATD     +  L  +AT+ + + D+NDN P+ +      + E+EP    V + +  D D      ++   YR        F L + +   G+ ++  +   D E      + I+  D  SP +      +V ++D+NDN P+F++  +   + EN P  T+V +++A D D+    +L +SI   ++ + F+ID  +G++   + +DRE+ + +   V  T      ++S+ S V + ++D NDN P+  + ++T  + EN+   + +  L+  D D   N    +   IMS N+    T    +G++     LDRE K  Y +     D       T  A ++I I+D NDN PVF       +  L      + +P  T+I+ L A+D+D   N  + Y L       ++ I+S TG +Y
Sbjct: 1202 QSLETITYIEINVLDVNDNYPVFINETTFKTVPE--KLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTF--KINETTGVISTLRALDFEVTNRYVLR--VSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQS-PRA---HFKINSETGLIQTTHPIDREEISE--YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVE---YRIVSPDTGKFSLDLKT---GVLKLIGS--LDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTS-VRINVMDRNDNPPKFISPVVTLKVPENSPA-RLIYTLTVQDLDYGNNTKVLYS--IMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDI-TPPYYTAFANITIFIEDQNDNPPVF-------QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYS-IDSRTGIVY 1807          

HSP 6 Score: 120.939 bits (302), Expect = 1.454e-27
Identity = 145/586 (24.74%), Postives = 247/586 (42.15%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPK--AIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASD----------------------------KDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTD------LDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAP--QSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIV--YDHGNFVALTTTATVSIHIQDINDNKPVF 2115
            +N+ID ND+ P F  S     + E +  F    + K  A D DS  NG   YSI    N   +  ID     +     +D E ++   F  ++  TD G+        + + +TD NDN P FD   + + I E+   G++V   VA+D                            +DSG N+ IKYS  P++    I  K  +++ TG++     +D     D      V A D G       A V V+++   +   EL  +    + EN   G  VLT   TD      L  +S N    +++R    +      G+  I+  +  D E  R   + ++ +D+ +P       +++ + D+ND  P F Q+ Y  +  E +P+ T V  +SA+D D+    ++ F+I   +    F ID   G++  +  +D E I+  H  V+ TD G   +     V +++LD+NDN P  +        + EN  ++  + +++ TD D   N   +F     +    F + K SG +      D E   +Y     +   D GN   L++  T+ +++ D ++  P F
Sbjct: 2055 INVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTG-NEAGVFTIDSTTGEITTAKLLDRETTAS--FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSE-VNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF-PITNSDQIDYK--IDADTGVISARRTIDVR-IRDSFIQIPVQAMDQGVP--PQRALVYVRIIITREPKFELPSYFGK-VPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRS------GV--ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGN-PPLSSNITIIVNVADEDEYDPSF 2620          

HSP 7 Score: 117.087 bits (292), Expect = 2.576e-26
Identity = 125/495 (25.25%), Postives = 210/495 (42.42%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDS--GVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI--VHQNNSITENEPSGKIVLTFSFTDLDE-------LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTN--VYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFK 1914
             N+T+ I D+ND+ P FQ+S Y   I E +     IL   A D+DS  NG   Y++ N+   ++   ID +  I+    +  +E S ++ ++F   A D G +       + I I D N++ P F      + I  N S  ++V    A+D D+    N  + Y    L   K+ ++ F + S TG ++      + N         +IA D G   L     V + + +I D+ P  +       SI EN   G  + T       +       +S N+ +  +   F         G+  +AS    D E  +   + +         +     L + +ID NDN P F  +    ++ E+   +    V +++A+D+D+    K+ +SI   N    FTID   G ++    +DRE   +F   ++ TD+G    S   +V V + D+NDN P    L   +I E+T+    V  +  TD DK    T+  K
Sbjct: 1734 ANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVY--SIDSRTGIVYSAAR--FETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYR---LDDSKNSTSLFVVESNTGSVR--TSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPF--------TGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLK 2211          

HSP 8 Score: 107.842 bits (268), Expect = 1.362e-23
Identity = 148/655 (22.60%), Postives = 282/655 (43.05%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDS--LVNGVRHYSIDNNYN--NLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNF-DFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKL--VNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITE-NEPSG----KIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQF---------------------------SQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY----FTIDPANGILSIKTNIDREEIENF-HFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDK-LENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V V + I D+N+  P F K+ Y+++I   ++   L+ +  A D D+    NG   Y +D++ N  +LF+V    ++   ++     + +  Q      + A D G    +    + I I +  D+ P F +     + I EN  VGS +    A    +  ++ + YS+  +SG K  +  FY++  TG++ +   + +DYE+   + F   ++AT  G + L+    + + V+D NDN P    H +N + +  E +G    + V+  + TD+D  +  ++    +      + ++D     I + ++ D E      + I   D+  P       + V + D+NDN P F                            +++  + ++        + ++SA+D D+    ++ +S    N     + ID   G++S +  ID    ++F    VQ  D G    ++ VYV+I+   +   +   L +Y   + EN  +  SV  +  TDN   L  G  +   Y + N++ F++  +SG I + K LD E K  +L+     D     +      V I++ D+ND KPVF       + G +       P  T ++ + A D+D   N ++ + +   +      I+ +TG I
Sbjct: 1838 VPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVV----ESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSI--ISGNKGRA--FYVDPFTGVISVASADALDYEST--KNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF--HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFE---LPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRIS---YNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDD-TAPSKPVRVPVYINVSDVNDEKPVF------GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVI 2464          

HSP 9 Score: 101.293 bits (251), Expect = 1.483e-21
Identity = 108/428 (25.23%), Postives = 194/428 (45.33%), Query Frame = 1
Query:  352 KIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDS--LVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSIT--ENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCW---IEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNF 1614
            KID D      G +   + +  +I+      P+Q +D      R++ V V II   +  P F+   Y   + E+      +L   +  ++  L  G   Y+I+N+  N F   I +++ ++++   +DYE  ++R F  ++ A DD       +  ++I+++D ND  P F       +  E I VG+IV    A+DKDSG N  + +++   SG    S  F ++  TG+++    +D+E    +     V ATD G   + T  +V ++V+D+NDN P   V   N +   EN P    +   + TD D  +  +L        G  +  +D     + +   FD E N   +   + I   D  +P +     + V + D ++  P F++  Y F++  N  I   V Q++A+D D+ D  ++ F
Sbjct: 2251 KIDAD-----TGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRAL-VYVRIIITRE--PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS--NYF--RIGQRSGVISVNKPLDYE--TKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQ--SGDDKGS--FAIDRKTGVIRTQRALDHETI--KTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYE-NTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 10 Score: 90.5077 bits (223), Expect = 2.857e-18
Identity = 146/597 (24.46%), Postives = 242/597 (40.54%), Query Frame = 1
Query:  604 AIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCK-TDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN---NSITENEPSGKIVLTFSFTDLDELSKNQ----LKCDFYRSFGLAIDSVDDGIYRIASTQV-FDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD-----NSDVN-KLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ--STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNS-------PFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF----IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            A DRDS  N    YSI +    +    IDK + ++     +D E   ++  +FL          F+   T + I++ D NDN P F     T+++ EN S   ++Y     D D G N+ + YS+  +SG  +    F +  +TG L    K+D E      +   V A D    + +  A + + + D NDN P  +  Q+   ++I+E  P G  +L  + +D D  S       L  D Y  +  +IDS    +Y  A  +     E+N FC  +    D    I+     + + I D N++ PQF++  Y   I  N      V  ++A+D D     N  V  +L+ S    + F ++   G +                 +   D G   L     V + I ++ D+ P+  + T     I EN+++   +  +    +   +    T+   I+S N        PF    S  +     LD E    + +  +    G +V+L     + I++ D NDN P F    +  +     G  KP F        ++ + ATD D   N K+TY +   N +    I+S TGEI
Sbjct: 1565 AYDRDSGSNAELTYSIPSGVE-MDKFSIDKHSGLIVTNSILDRE---KKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSI--MSG--NTDGAFTIGRSTGELSTTTKLDRETKAS--YQLSVQAKDITPPYYTAFANITIFIEDQNDNPP--VFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVY--SIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVP----VRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQ---VTYS--IISGNKGRAFYVDPFTGVIS--VASADALDYESTKNFRLHLVATPQG-WVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRF--------VVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEI 2126          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 185.652 bits (470), Expect = 1.302e-47
Identity = 184/662 (27.79%), Postives = 295/662 (44.56%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEV--QITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL---TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQ-DINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKS 2442
            V +++ D ND+ P F  + Y  NI E +     +L   A D D   NG   YSI    N+L    +D Q+ ++     +D E  S       + A D G       T + + I D NDN P F        I E  S+G+ V Q  A+D DSG N  I Y +S  S    ++  F LN+ TG+L   +++D E     +++F V+A D G   L +S  V + + DINDN P    V    SI ENEP GK+ L  + TD DE +   +  D          S+D     I++    D E   F  + I+  D  +    K   ++V +++  DN P F    Y F + EN+P  T V ++ A+  D +    ++++I+     N F +D   GI+ I  ++DREE   +   V  ++     LS ++ V +++LD NDNAPQ ST+ +   I     + Q V   +  D D  +NG      Y +++N+   L   + SG I L + L    +  Y +  +  D G   +    +T++IHI   IN       +P + +    +  +    P       + A DQD  +N +L Y + + N      I    G++Y     +    G Y +    +D G PS ++ +   I +  +N  +S
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGG-NDLGWFQVDFQSGLVTTAKPLDREQVSS--VTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEIS--SSDAQVNGLFELNTQTGVLWTKSQLDRET--KSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKL-LQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKN--GSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNG---LVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSG---SPPQHSTMTIHITLSIN-------HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGI-FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRS 1048          

HSP 2 Score: 150.599 bits (379), Expect = 9.472e-37
Identity = 182/685 (26.57%), Postives = 285/685 (41.61%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQ----------KSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNN-------LFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQV--------FDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLM-TYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKII-LMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPK---EKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPK 2439
            VT+N++D ND+ P  +          K+    N + +     IL+    D+DS  N      I N  +        L   +I  Q P       +D E      ++  L  TD G+        + I +TD NDN P F     T  I E    GS V Q  A+D D G N  + YS   ++G   +   F ++  +GL+     +D E       T  + A D G    + S TV V ++D NDN P  +      +I+E    G  VL  S TD+D     ++  +   S     D+  +G++ + +TQ          D E        +   D+  P +     + + I DINDN P F   +Y+  I EN P    + Q++A+D D      +++ II  N    F+ID + G++S   ++D E  E F   +   D G    +  + V V +L+  DN P     M  + + EN      V ++  T  DK  NG+ ++        + F +  +G II +   +DRE+K  YL+  I    G    L+  ATV+I + D NDN P F       +     L+  + Y++          A D D  +N  + Y+L  +NA     INS +G I             Y+++   SD+G+P   S M   I LS  + PK
Sbjct:  299 VTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILV---TDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKP-------LDRE--LVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYS---ITGGNDLG-WFQVDFQSGLVTTAKPLDREQV--SSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS-----DAQVNGLFEL-NTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPP-GKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-VGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNA---------AAVDLDAGKNGLVRYQL-TSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPK 945          

HSP 3 Score: 145.206 bits (365), Expect = 4.170e-35
Identity = 163/626 (26.04%), Postives = 276/626 (44.09%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNY---NNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDF-------KEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTG--LLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI----IQCN-YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            + + I+DEND  P F ++ Y  +I E+ +  + IL   A DRDS  NG   Y+ID +    N++F   +D    ++     +D+E   +  + F + A+D G+        + I++ D NDN P            +K I   EN  + + +   + +DKDS  NS  +  ++          +F      G   ++L   +D E  +   +   +  TD G    ST   V++ V D+NDN P    +   + I+E   +G  VL  + TD DE     +         L    VD     + + +  D E      I I   D+ S        + V IID NDN P+F ++ Y   I E   I   V Q+SA+D+D+ D  ++ + I     Q N  F ++   G+L  K+ +DRE    + F V   D G  QL +  KV + I D+NDNAP    +  +      +    + Q++ TD D+  N   ++     +NN  F + + +G I  +  LD E ++ + +     D GN  A   TA V++ + +  DN PVF+Y            ++ + P  T +  + AT +D  +N  ++Y +   + ++   ++S  G I
Sbjct:  192 INITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIF--DLDSSTGVIRTKQNLDFE--VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIR-SENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFL-----GFYFIQLQKPLDRE--LVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYA-AKTAVVNVTVLNKADNLPVFLYEMYNFT------VYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGII 796          

HSP 4 Score: 139.813 bits (351), Expect = 2.113e-33
Identity = 160/656 (24.39%), Postives = 291/656 (44.36%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLN-NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI---DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN-SITENEPSGKIVLTFSFTDLDE---LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC--NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTY--HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFI 2118
            NIS+  Q  +++  +  T+ +  +N  + +  T   +L  + Q++   G + T + +DR+         Q   + +     +   +P          + S  VTV IID ND+ P F KS Y   I E       +L   A D DS  NG   Y I   D   N LF   ++ Q  +L    ++D E  ++ L+ F + A D G  +      + + I+D NDN P F   E    I+EN   G ++ Q  A+D D G N++I Y +  + G    +  F ++S+TG++  +  +D+E  ++  F+ I+ A D G  + + +A V V V++  DN+P  +    N ++ EN P G +V     T  D+   +S   +  D    F   +DS   GI +I +  +   E  ++    I  +    P+  +   +++ ++D NDN PQFS +    +I+    +   VY  +A DLD      + + +         I+  +G++ +   +   +   +  +V  +D+G     S + + I  ++ N P   TL +Y  H+  +  +      +   D D  +NG   +     +    F +   GK+ + K L +  K  Y +     D G   + + +  V+I+IQD ND++ +F+
Sbjct:  433 NISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL-GWFQVDFQSGLVTTAKPLDRE---------QVSSVTITITAQDHGSAPK---------TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLF--ELNTQTGVLWTKSQLDRE--TKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDI--IGGNN--NGNFSIDSSTGVISTLASLDHE--VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLF--LVDST-GGIIKI-NGDMDREEKAQYLLAVIARVGTVKPLSAQA-TVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATD-GGVPSFSASVPVTIYIQDSNDHRSLFV 1051          

HSP 5 Score: 137.117 bits (344), Expect = 1.256e-32
Identity = 155/613 (25.29%), Postives = 259/613 (42.25%), Query Frame = 1
Query:  604 AIDRDSLVNGVRHYSI-DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLST----SATVIVKVMDINDNVPELIVHQNNSITENEPS--GKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDRE----KKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIP-KPGMYSIKATVSDNGTPS 2385
            A+D+DS  NG   YSI   N   LF ++   +  I     +     + +  +  ++ ATD G+  F     + I+I D+ND+   F        + EN S G++V   VA   D      I YSL       S  + F ++  +G +    ++D E  I    + + I       + +T     A VIV V D+NDN P +      +IT +E S  G  V      D DE    +         G+    ++     +  ++  D E      + +   D ++  +     + + + D ND  P F ++ Y   I E+  I + V  L+ASD D      + +SI   N    F ++ A G L +  ++D E  + +   +   D G   LS+   V V +LDVNDNAP   T  +T  + EN      V + + +D D   N    F  Y  + +  F + + + +I  +  +D E     +D + +  +  D G+   L+T  ++++ + D NDN P F+ P   +           + S   ++T+ A D D N N K+TY +   N   F  ++  TG++    I  IP  P +Y +    SD G PS
Sbjct:  970 AVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYI-----RKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL------ISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP-VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGS-PKLSTRKSITVQVTDENDNSPGFVSPPAAA-----------AGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYF-NLHPSTGQLQM--IHQIPDNPTIYQLTIQASDGGQPS 1555          

HSP 6 Score: 135.576 bits (340), Expect = 4.003e-32
Identity = 152/556 (27.34%), Postives = 247/556 (44.42%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP----KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSIT--ENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAE---FNRFCW-IEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNI-DREEIENFHFEVQITDTGQLSNKSKVYVKILD---VNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNS--PFKLTKS-GKIILMKHLDRE--KKDLYLIPFIVYDHGNFVALTTTATVSIHIQDIN 2097
            V V + D ND+ P F ++ Y I +   +E  L   P    KA+D D   N    YS+ +    +   +I+     L+++  +D E +S   ++ ++ ATD           I I + D+ND  P F   + T+ I E+  +GS+V    ASDKD G N LIKYS+S      +++  F + S TG L +   +D+E    +++   + A D G + LS++  V V V+D+NDN P L   Q  ++T  EN  +G  V   + +D D  +   +    Y        SV+     I +    D E     R  + + +   D  SP +     + V + D NDN P F                 NV  ++A D D +   K+ +SII  N  YF + P+ G L +   I D   I  +   +Q +D GQ S +++  V +     +      S+      + EN     SV  +         NG   +  Y+ S++S   F++ KS G +   + +DRE       L+ + V   G   A T++ATV+I +QD+N
Sbjct: 1145 VIVTVTDLNDNAPVFSRAVYAITV---SELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG-TGMDKFFINSSTGELHLSKTLDRETTSS--YNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS----NGNLAAMFDVESATGRLIVAKSLDFET--TQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP-LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSS-----LNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEY--YLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGP-SARTSSATVTITVQDVN 1677          

HSP 7 Score: 131.724 bits (330), Expect = 6.437e-31
Identity = 151/607 (24.88%), Postives = 259/607 (42.67%), Query Frame = 1
Query:  703 ILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN---NSITENEPSGKIVLTFSFTDLDELSKNQLK--CDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFS-------QAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN------------YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK--VYVKILDVNDNAPQSTT-LMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNA--SSFTKINSETGEIYF-FYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            +++ T +ID E ++Q             LN       + + + D NDN P F     T+ I E++ V +      A+D D+G N  + Y+++      + S       T   L ++ K   +      +   + ATD G   L     + + ++D ND+ P  +  QN    SI EN   G  +L  S  D D  S   +K   D+      +I  +D     I + Q  D E        +   D   P    L  + + ++D NDN PQ                 E +L I TN+  +  +D D++  ++    I   +            YF        + ++  +DRE +  ++  + +TD G  S  +   V + + DVNDN+P  T+   T +I+E  Q    V QL+ TD D+ +NGT ++     ++   F++  +SG +   K LDRE+     I     DHG+    T + TV++ I D NDNKP F+    K        I   +    T++ + ATD D  +N ++TY +  ++A  +   ++N++TG ++    +D   K  +YS      D+G P L S ++  + +S  N
Sbjct:   50 VISTTARIDRETTTQISLQLRT------LNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAP--VFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSL-INTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF--------IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGS-APKTGSTTVTVTIIDGNDNKPRFMKSSYKGT------ISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETK-SLYSFTVLAKDHGDPQLMSSVKVELTISDIN 631          

HSP 8 Score: 119.398 bits (298), Expect = 3.628e-27
Identity = 171/637 (26.84%), Postives = 288/637 (45.21%), Query Frame = 1
Query:  484 SVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSI--DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSG-PKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPS---GKIVLTFSFTDLDE----LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQS---TTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREK--KDLYLIPFIVYDHGNFVALTT---TATVSIHIQDINDNKPVF---IYPKEKSKHGL-IKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYF 2310
            SV V + I D ND+ P F   +Y  +I+E NE P  LL   A D D   N V  Y I   NN  N     ID    +++    +D+E      F  L+ +  DG N++  KT +  + + +  DN P F ++     + EN+  G++V +  A+ KD   N  I Y++  +SG P ++   F ++ST G++K+   +D E      +   VIA       LS  ATV ++V+D NDN P+     ++ I + + +   G++V   +  DLD     L + QL  +   + GL   +   G+ ++A  ++ D +  ++  +++   D+ SP       +H+  + IN + P+F+ + Y   +  + P+    + + A D D+    +L +SI Q N    F I P  G L I+ ++ +    ++   V+ TD G  S  + V V I   + N  +S        + +AEN+     V  L     D        +   ++S+ S F +  +SG+I     LDRE+  K+     +I+     +   T     A V + + D+NDN PVF   +Y    S+  L   P+F           ++A D D  +NAK  Y L          INS TGE++ 
Sbjct:  620 SVKVELTISDINDNAPVFYPVEYFASIME-NEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNF---SIDSSTGVISTLASLDHE---VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAI--VSGDPTNL---FLVDSTGGIIKINGDMDREEKAQ--YLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF--STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSN---AEGLLWINSTSGVIKLAR-KLTDGDETQYT-VQVLASDSGSPPQHSTMTIHI-TLSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPG-GKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYS--LISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFR----------IKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHL 1218          

HSP 9 Score: 115.161 bits (287), Expect = 8.142e-26
Identity = 144/575 (25.04%), Postives = 243/575 (42.26%), Query Frame = 1
Query:  385 GPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLI--LLPKAIDRD-------SLVNGVRHYSIDNNYNNLFI-VYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNN---SITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSI---IQCNYFTIDPANGILSIKTNIDREEI----ENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHG 2040
            G L   K +L  ++   +     T     S S SV VT+ I D ND    F  + +   + E S+   L+  L+  A+D         SL++   H+++D     +   V +D++  I N TG   Y   ++ +++      D        K  + + +TD NDN P F      I + E    GS V++  A D D G N+   YSL   +G      KF++NS+TG L L   +D E      +  +V ATD+   +L ++A + + V D ND  P  +  +++   +ITE+   G +V+  + +D D      +K         A+  V+    R+   +  D E  +   + I   D+    +    ++ V ++D+NDN P F        + EN+     V + +ASD D      + FS+        F+++ A   ++    ID E +    ++F   V  TD G  +LS +  + V++ D NDN+P          A       +V  ++  D D+  NG  T+   I  NN  F L  S   + M H   +   +Y +     D G
Sbjct: 1000 GKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKN-TGSNVYIMQAEAMYNDTTIKRD--------KAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD----KFFINSSTGELHLSKTLDRET--TSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPG----FVSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYS-IISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGG 1552          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 185.267 bits (469), Expect = 2.424e-47
Identity = 175/645 (27.13%), Postives = 293/645 (45.43%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLF---HFL-LFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY-FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTYH--IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQAN 2430
            P F + + D ++ E  E   ++    A D DS  NG+  YS+  + N +   Y      I  ITG I  +    R F   HF  + A D G    +   D+ I++ D NDN P F+      +I E+ S+G  V    ASD DSG N  +KY +    G  S    F +   +G + ++ K+D E      +T  V A D G    S + TV + ++D+ND  P+      + +I E+ P  ++V T   TD D+ S  ++  +      +   S++     +   Q  D E      + +   D   P +     + + +ID+NDN PQF  + +   I EN  +    Y++ A D D+    ++ FS +Q +  F+I+   G +SIK  +DRE++  F F ++  D G       +++ + +LD+NDN P+ +    YH  IAEN++   SV Q+   D D               ++  F++   G I L   L+   K +Y+      D      L++TA V +++ D N + P F   K +S    +K    D+   T+++T+ ATD+D   NAK++Y +  T    F+ ++  TG I         K   Y  + T +D+G P L +    +I ++  N
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFS----IDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNS---AFSIGEVSGAVTVMKKLDREKV--PTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQ-EEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG----MLSSTALVYVNVTDSNTHAPEF---KRRSYSAEVKE---DASLGTSVLTVLATDRDTGSNAKISYSI-ATLVPEFS-VDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVN 640          

HSP 2 Score: 184.882 bits (468), Expect = 3.422e-47
Identity = 192/760 (25.26%), Postives = 344/760 (45.26%), Query Frame = 1
Query:  190 NISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVN--YVQLNN-KGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQ-SISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP-LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL--DKTNASSFTKINSETGEIYFFY---IDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVL 2418
            ++S++ +  T +  +  ++ ++  N  + +  +  +NL++  Y  ++   G I T R +DR+                     + +F  ++  D  + S+   +++T+N++D ND+ P F+++ Y  +I E       +L  +A D DS  NG   Y I N+  +     I + +  + +  K+D E      +   + A D G         + I + D ND  P F  K  +  I E++ V  +V    A+D D G N  + + +  +SG  +    F +N   G +++  K+DYE  +  +F  +V A D G+  L    TV + ++D+NDN P+ +  H    I EN   G+        D D  +  ++   F ++  L   S+++    I+  +  D E        I   D   P  +    + + ++DINDN P+FSQ +Y+  I EN    T+V Q+ A D D+   N + +SI+  +     F I+P  G++++   ++      + F V  +D G LS+ + VYV + D N +AP+      +  + E+  +  SV  +  TD D   N   ++   I +    F + + +G I     LDREK D Y       DHG    L   + V IHI D+NDN PVF+ P  ++K      +  D      +I + A+D D+ +NA++ Y    +     +FT I+S  G I        + IP+   Y +    +D GTP   + ++  ++L
Sbjct:   28 SVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDRE-------------------FLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPT--YTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEI--VSG--NDMNFFSINRINGEVRVKQKLDYE--MIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQN-DLPF-SINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRCFRINP-QGLITLSCTLNYNTKHVYVFSVSASD-GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYS--IATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHG-IPQLKAKSFVYIHIADVNDNDPVFLKPSYEAK------VREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFT-IDSTQGIIRTLKPLDRETIPE---YELTVVATDQGTPPGQASVKVKVIL 742          

HSP 3 Score: 182.956 bits (463), Expect = 1.257e-46
Identity = 173/629 (27.50%), Postives = 281/629 (44.67%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFP---LILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINC-------LDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ-CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-----KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            S +V V + ++D ND  P F K  Y   I E  + P   L+   +A D D   NG   + I +  N++    I++    + +  K+DYE     +F+ L+ A D G      +T + I + D NDN P F        I EN +VG   Y+  A DKD G N  I +S      P      F +N  TG + +  ++D E      FTF + A D G      +A + + ++DINDN P+    + + SI EN   G  VL     D D    N +       + +   S  D  +RI    +        C +  N        +  +  ++     ++V + D N + P+F +  Y  E++E+  + T+V  + A+D D     K+++SI      F++D   G++    ++DRE+++ + FEV  TD G  QL  KS VY+ I DVNDN P          + E+ +    V ++S +D D  +N       Y  ++N   + T       G I  +K LDRE    Y +  +  D G       +  V + ++D+ D+ P+F    EK  + +  P   D+P R+ +IT++A  QDL+    + Y + + N+     IN  TG I
Sbjct:  215 SATVTVKITLLDVNDCTPQFSKKVYSATIRE--DVPVNQLVTTVRATDCDQGSNGEVFFEIVSG-NDMNFFSINRINGEVRVKQKLDYEMIG--VFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP------FSINENTGGISIKEELDREKVPK--FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-------YSIVSSSGHDRCFRINPQGLITLS----CTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQII---YSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPG-QASVKVKVILEDVKDSPPLF----EKPLYEVTVP--EDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAI 809          

HSP 4 Score: 169.859 bits (429), Expect = 1.270e-42
Identity = 145/474 (30.59%), Postives = 227/474 (47.89%), Query Frame = 1
Query:  841 DNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN---NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFG----LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQ--STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQD 2217
            +N P F   ++   + E+  VG++V    ASD DSG N +I+YS+SP     S +T F ++  TG++     +D E F+DR F F V A D G   L     + + V+D+NDN P  I  +N     I E++  G  VL    +D D  S  ++K     S G     +I  V   +  +   +  D E      +++   D  +P       + + ++D+ND  PQFS+  Y   I E++P+   V  + A+D D     ++ F I+     N+F+I+  NG + +K  +D E I  F+  V   D GQ  L N++ V + ++DVNDNAPQ  S+   T  I EN  + Q   ++   D D   NG  TF    M N+ PF + + +G I + + LDREK   +       D G       TA ++I + DINDN P F      S+      I  +S   T+++ ++A D D
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMS-ATYFSIDQITGVITTKRGLDRE-FLDRHF-FRVKAEDGGEPSLEGYMDLTINVLDVNDNGP--IFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVM---KKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTM-IPENYAVGQEFYRVQAYDKDHGTNGEITFS--FMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKG-VPFKEGTAQITITLLDINDNPPKF------SQEEYHTSIAENSRWGTSVLQVKAIDPD 470          

HSP 5 Score: 140.198 bits (352), Expect = 1.694e-33
Identity = 171/626 (27.32%), Postives = 270/626 (43.13%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIE----SNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNS-ITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID----SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ----CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKIL--DVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF--IYPKEKSKHGLIKP-IFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V + +ID ND+ P F  S +   I E      EF  +   +A D+D   NG   +S      N     I++    ++I  ++D E   +  F F + A D G+   +    I I + D NDN P F  +E    I EN   G+ V Q  A D DSG  +++ YS+   SG       F +N   GL+ L   ++Y      ++ F V A+D     LS++A V V V D N + PE      ++ + E+   G  VLT   TD D  S  ++      S+ +A      SVD+    I +    D E       E+   D+  P +K    +++ I D+NDN P F +  Y  ++ E++     V ++SASD D     ++ +S          FTID   GI+     +DRE I  +   V  TD G    ++ V VK++  DV D+ P     L    + E+T     V  +     D        +   I+  NSP  F +   +G I  +  LD E +  Y +              T  TV ++++DINDN PV    +     + G + P   Y  P         A D D+++  KLT+++ + NA  +  +N+ +GE+
Sbjct:  325 VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRV---QAYDKDHGTNGEITFSF---MQNDLPFSINENTGGISIKEELDREKVPK--FTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-YSIVSSSGHDRC---FRINPQ-GLITLSCTLNYNT--KHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKI------SYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYS--IVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTV----RATLSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIP---------AYDPDVSD--KLTFKVMEGNAKEWVTLNATSGEL 909          

HSP 6 Score: 100.138 bits (248), Expect = 3.774e-21
Identity = 124/492 (25.20%), Postives = 202/492 (41.06%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP--ELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLD-------------NASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLE 1893
            +S +  V VN+ D N   P F++  Y   + E       +L   A DRD+  N    YSI           +D+   ++   G +D E      + F + ATD G+ + K K+ ++IHI D NDN P F       ++ E+I  G  V +  ASD D G N+ I YS +     +     F ++ST G+++ +  +D E   +  +   V+ATD G      S  V V + D+ D+ P  E  +++  ++ E+ P    V+T         +K+Q   D     G+        I R  S QVFD   N      +  LD               SP   +   + V + DINDN P          ++E        Y++ A D D SD  KL F +++ N   + T++  +G LS+   +                  Q S  + + + + D    A  + ++M   +   T++ Q   QL   D + LE
Sbjct:  523 LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEF---SVDETTGVIKTAGSLDREKVDT--YRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGT---FTIDSTQGIIRTLKPLDRETIPE--YELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYE-VTVPEDTPPRSPVITVK-------AKSQ---DLSPETGMMYS-----IVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFTET-TVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSD--KLTFKVMEGNAKEWVTLNATSGELSVNKKLI-----------------QASKPANIKIAVTDGLRTASATGSIMMTSV--TTEMIQQSIQLEIDDMEVLE 966          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 177.948 bits (450), Expect = 8.736e-46
Identity = 153/558 (27.42%), Postives = 264/558 (47.31%), Query Frame = 1
Query:  493 VTVNIIDENDSLPFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWI-----EINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVA------QLSFTDNDKLENGTFTFKEYIMSNN-SPFKLTKSGKIILMKH-LDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPV 2112
            V ++++D ND+ P F  S     I E+      +    A D DS +NG   +SI++     F   I +   ++ ++G +D E  ++ ++   + A D   +  +    + + + D NDN P F      +++ E ++VGS++    A+D D G N+ I YS+S           F +NS TG + +   +D E    + ++F V A D G L   ++  V V++ D NDN P+   V     + +  P G IVL  +  D D  +   +    Y    L    V D    I ++   D E      +      ++  D+          L++ + D NDN PQF+Q++Y   + EN+P+ T V  ++A D D+   +++ +S+   +  F+I+P+ G + ++  I+RE  EN+H  +  +D G   LS+ +KV+V +LDVNDN P    + T  + E T  + + A      Q++ TD D   NG  T+   IM      F + ++  +I  +  L+RE KD Y +  +  D G  V      T+ +H+ D NDN P+
Sbjct:  320 VVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKF--EIGRSDGVVRVSGSLDRE--AKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS--------YPGFAINSNTGSVTITRPLDRE--TKQAYSFTVHARDGGGLE--SNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVT---YAILILPFIIVPD-TGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPP----VFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYT--IMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQG-AVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 2 Score: 173.326 bits (438), Expect = 2.131e-44
Identity = 184/725 (25.38%), Postives = 311/725 (42.90%), Query Frame = 1
Query:  325 NKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQA--PILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDI-FIHITDANDNYPNFDFKEKTIEILENISVG---SIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLV----NKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDEL----------SKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLM-TYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK-SGKIILMKHLDREKKDLY-LIPFI----VYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFI 2412
            N G IKT R ++R                  Q  F  N +         S S +  V++ + D ND+ P F  + Y   + E++     LL   A D DS  N    YS+    ++     + K +    + + G +D E      ++  + ATD G+   +    I  + I D NDN P F     T  I EN   G    +    +A+D+D   N+ ++Y L+      S S +F +N  TG++         +D+E   +  +TF VIA D       + A V++ V+D NDN P  I     ++I+E    G+ V   +  D D            S ++ K +  RS         DG+ R++ +   D E      + ++ +D +    +    + V + D+NDN P+F++  +  ++ E + + + +   +A+D D      + +S+     F I+   G ++I   +DRE  + + F V   D G L +   V V+I D NDN+PQ  T+     + + T +   V  ++  D D   NG  T+   I+    PF +   +G I     LDRE++ LY L+ ++    V DHG     T+ A ++I + D NDN+P F     +S++     +  + P  T +  + A D+D   N+++ Y L  T       I   TG+I             Y +  T SD GTP L+S  +  +
Sbjct:   62 NTGMIKTARNLER------------------QQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDRE--VNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLN-----GSDSIQFAVNPRTGVITTRVSPPPSLDHERTTN--YTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRS---------DGVVRVSGS--LDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG-FAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL----PFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHG-VTQFTSFALLNISVTDFNDNQPQF----NQSEYSAT--VLENMPVGTKVTMVTARDEDSGINSQIMYSL--TGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHV 734          

HSP 3 Score: 167.162 bits (422), Expect = 1.971e-42
Identity = 162/623 (26.00%), Postives = 283/623 (45.43%), Query Frame = 1
Query:  499 VNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKA-----IDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITG--KIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSF-GLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREE-----IENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKS-GKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF---IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            V I+D ND++P F  ++Y    I+ N  P + +  A      DRD   N    Y ++ + +  F V          ++    +D+E ++   FH +  A D      +   ++ IH+ DANDN P F        I E  S+G  V +  A+D DSG+N  I +S++  SG +    KF +  + G++++   +D E     ++   V A D          TV V + D+NDN P+      N  ++E    G +++  + TD D+ S   +   +  S+ G AI+S       +  T+  D E  +     ++  D     ++    ++V I D NDN PQF   +Y  ++ +  P+ T V  ++A D D  +   + ++I+    F I P  G ++  + +DRE+     + ++   + +TD G  Q ++ + + + + D NDN PQ + +  +  + EN  +   V  ++  D D   N    +   +   +  F +  S G+I L K ++RE K+ Y +     D G  V L++ A V +H+ D+NDN PVF   +Y +  S+       F        ++ + ATD D+  N  +TY +       FT IN  TG I
Sbjct:  211 VRILDRNDNVPKFSHARY-TGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVI--AADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSIN--SGSEG---KFEIGRSDGVVRVSGSLDRE--AKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAIT--YSMSYPGFAINS---NTGSVTITRPLDRETKQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL-PFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYS--LTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPV-LSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEF--------VVQVNATDADVERNGHVTYTIMHGALGMFT-INETTGVI 803          

HSP 4 Score: 145.591 bits (366), Expect = 1.482e-35
Identity = 167/659 (25.34%), Postives = 279/659 (42.34%), Query Frame = 1
Query:  529 PFFQKSKYDINIIE--SNEFPLILLPKAIDRDSLVNGVRHYSI------DNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLS--GPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSG-RLHLSTSATVIVKVMDINDNVPELI-VHQNNSITENEPSG---KIVLTFSFTDLDELSKNQLKCDFYR-----SFGLAIDSVDDGI-YRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQC--NYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK---SKVYVKILDVNDNAPQSTT-LMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRL---------DKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSW 2397
            P F  + Y+    E  S    LI   KA D D   NG   YSI      D   N+ F   +D    ++     ++ + +    ++  + A D GL  F   T + I + D NDN P F+    +  + EN  VG+ +    A+D DSG N+ + YS++     G     TK    S  G +++   +D E  ++  +   + ATD G  +  +  A  +V+++D NDNVP+        SI EN   G   ++  +   TD D  S   ++   YR     S   A++     I  R++     D E        +   D A    + L  + + ++D NDN P+F  +     I E   I  +V +++A+D D+    ++ FSI       F I  ++G++ +  ++DRE    +   V   D G  S +     V V + DVNDN P+ T       ++E   +   +   + TD D+  N   T   Y MS       + +G + + + LDRE K  Y       D G    L +   V++ I D NDN P F  P  + +  +I      +P  T ++ + A D+D+  N  +TY +         D  N ++ +K++ E   +Y            Y +  +V+D+G    TS+
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFT--LDPNTGMIKTARNLERQQTFS--YNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKV---SNHGTIEVAGNLDRE--VNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVR---YRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAID-GSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAIT---YSMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG---GLESNVAVNVEIGDENDNSPQF--PTVQYQTDVID----RTPVGTIVLAVNAEDRDVGNNGHVTYAILILPFIIVPDTGNINTSSKLDREQQSLYTLV--------HYVLNLSVTDHGVTQFTSF 626          

HSP 5 Score: 113.235 bits (282), Expect = 1.745e-25
Identity = 108/350 (30.86%), Postives = 165/350 (47.14%), Query Frame = 1
Query:  487 VNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLP-KAIDRDSLVNGVRHYSIDNNYNNL---FIVYIDKQAPILNITGKIDYEDSS-QRLFHFLL--FATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKL---VNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELI--VHQNNSITENEPSGKIVLTFSFTDLD-ELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYP 1497
            V V V I DEND+ P F   +Y  ++I+      I+L   A DRD   NG   Y+I      L   FI+  D     +N + K+D E  S   L H++L    TD G+ +F     + I +TD NDN P F+  E +  +LEN+ VG+ V    A D+DSG+NS I YSL+   G       F +  +TG ++L   +N+   EN     +   + A+D G   LS+ A V V V+D+NDN P     V++      N  +G+ V+  + TD D E + +      + + G+   +   G+ R  +  V + E   F  + +   D  +        + V +ID NDN P
Sbjct:  521 VAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI------LILPFIIVPDTGN--INTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDG------VFSIEPSTGQIRLQKAINREAKEN-----YHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIR--TQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 215.312 bits (547), Expect = 5.573e-57
Identity = 212/777 (27.28%), Postives = 349/777 (44.92%), Query Frame = 1
Query:  163 ATIYSHKSFNISDNIQANTFIGHIP--LTEKEALENYQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDN--NYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQN--NSITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDD--GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK--VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
              + S+  + +S+    NT IG +   L   ++   Y+L  G         Y+++++K GEI T    IDR+        L  C+ +     C ++FE++ + +  +       R +   + ++D ND+ P F      ++I E ++   L  +P A+DRDS  NGV  Y++    + N LF + +    D++ P + + G +D E      +   +   D G         + I +TD NDN P F+  +   E+ EN   G  V Q  A+D D+G N  I YSL   S   ++     ++ +TG++ +   VD E   D +  F V+A D G    S+ A V + + D NDN P        L++HQN   +I+E+ P G  V     +D DE     + C    D       A +S +D    Y + +T + D E  +   IEI  +D+ +P +     L V + DINDN P FS A       E+      V  + A+D D+    +L +SII+    + F I+   G + ++  +DRE++E + F V   D G  S      V + + D NDN P+   +  ++ + EN      V  ++ +D DK EN   T   ++  +N  F +   +G I+     DREK+  Y       D G+    ++   V+I++ D NDN P    P   S +  +KP    SP  T +  ++A D D   NA+L Y +   N     +I+  +GEI           G++ +   VSD G P
Sbjct:   35 GAVPSNNIYKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGSP-------YLRVDSKTGEIYTTEIPIDRET-------LSDCRNLFEDDKCFLEFEVSITDM--VKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDS--YDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQAS--DTVQRLLRIDRSTGIIYVKGLVDREE--DNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTL--FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGD-PPRSSYVGVTINVLDENDNAPYVTKPA-NSSYTHLKP---SSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKP 782          

HSP 2 Score: 134.035 bits (336), Expect = 2.225e-31
Identity = 129/450 (28.67%), Postives = 202/450 (44.89%), Query Frame = 1
Query: 1150 IVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKN------QLKCDFYRSFGLAI-DSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAP----QSTTLMTYH-----IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGK----------IILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY-DSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            I++V+DINDN P+        SI EN  +G +       D D  S            D  + FGL + + VD+ I ++      D E      + I  +D   P       L + + D NDN P+F + +Y  E+ EN P   +V Q+ A+D D      +++S+ Q +        ID + GI+ +K  +DREE     F V   D G    S+K++V + I D NDNAP    +   L+ +      I+E+  I   VA +  +D D+ EN   T    +++ + PF+L  + +          +     LD E+   Y I  +  D GN  AL++T ++ + + DINDN P F          L++  F  D+     +I + ATD D   NA+L Y + +++A+S  +INS TGEI             Y      +D G PS T 
Sbjct:  138 IIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTC---VVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGN-PALSSTNSLKVQVTDINDNTPSF-------SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTG 576          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 214.927 bits (546), Expect = 1.246e-56
Identity = 212/777 (27.28%), Postives = 349/777 (44.92%), Query Frame = 1
Query:  163 ATIYSHKSFNISDNIQANTFIGHIP--LTEKEALENYQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIE-SNEFPLILLPKAIDRDSLVNGVRHYSIDN--NYNNLFIVYI----DKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQN--NSITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDD--GIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQ---CNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSK--VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
              + S+  + +S+    NT IG +   L   ++   Y+L  G         Y+++++K GEI T    IDR+        L  C+ +     C ++FE++ + +  +       R +   + ++D ND+ P F      ++I E ++   L  +P A+DRDS  NGV  Y++    + N LF + +    D++ P + + G +D E      +   +   D G         + I +TD NDN P F+  +   E+ EN   G  V Q  A+D D+G N  I YSL   S   ++     ++ +TG++ +   VD E   D +  F V+A D G    S+ A V + + D NDN P        L++HQN   +I+E+ P G  V     +D DE     + C    D       A +S +D    Y + +T + D E  +   IEI  +D+ +P +     L V + DINDN P FS A       E+      V  + A+D D+    +L +SII+    + F I+   G + ++  +DRE++E + F V   D G  S      V + + D NDN P+   +  ++ + EN      V  ++ +D DK EN   T   ++  +N  F +   +G I+     DREK+  Y       D G+    ++   V+I++ D NDN P    P   S +  +KP    SP  T +  ++A D D   NA+L Y +   N     +I+  +GEI           G++ +   VSD G P
Sbjct:   35 GAVPSNNIYKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGSP-------YLRVDSKTGEIYTTEIPIDRET-------LSDCRNLFEDDKCFLEFEVSITDM--VKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDS--YDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQAS--DTVQRLLRIDRSTGIIYVKGLVDREE--DNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTL--FVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGD-PPRSSYVGVTINVLDENDNAPYVTKPA-NSSYTHLKP---SSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKP 782          

HSP 2 Score: 133.65 bits (335), Expect = 3.888e-31
Identity = 129/450 (28.67%), Postives = 202/450 (44.89%), Query Frame = 1
Query: 1150 IVKVMDINDNVPELIVH-QNNSITENEPSGKIVLTFSFTDLDELSKN------QLKCDFYRSFGLAI-DSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN-----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAP----QSTTLMTYH-----IAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGK----------IILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFY-DSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTS 2394
            I++V+DINDN P+        SI EN  +G +       D D  S            D  + FGL + + VD+ I ++      D E      + I  +D   P       L + + D NDN P+F + +Y  E+ EN P   +V Q+ A+D D      +++S+ Q +        ID + GI+ +K  +DREE     F V   D G    S+K++V + I D NDNAP    +   L+ +      I+E+  I   VA +  +D D+ EN   T    +++ + PF+L  + +          +     LD E+   Y I  +  D GN  AL++T ++ + + DINDN P F          L++  F  D+     +I + ATD D   NA+L Y + +++A+S  +INS TGEI             Y      +D G PS T 
Sbjct:  138 IIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTC---VVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGN-PALSSTNSLKVQVTDINDNTPSF-------SPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTG 576          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 202.216 bits (513), Expect = 6.977e-53
Identity = 219/778 (28.15%), Postives = 343/778 (44.09%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSIS-RSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVYI--DKQA--PILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEI---EENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK--SKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            + + +    NT IG   L     L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ ++    C ++FE++ +     D  Q+ S R +   + + D ND+ P F  S   I++ E+     L  +P A DRDS  NGV  Y++    +   LF + +  D+    P L + G +D E  DS    +   + A D G  +   +  + + +TDANDN P F+      E+ EN  VG  V Q  A D D G N  I+YSL     P  +     ++ TTG++ +   +D E       +F V+A D G    S+   V ++V D NDN P        L+ H     +I+E+ P G  V     +D DE     + C    D       A DS  D    Y + +T   D E  +   +EI  +D+ +P +     L V + D+NDN P FS     FE+   EEN P  T +  ++A+D D+    +L ++I+  +Y    F IDP  G +  +T +DRE  E + F V   D G   +K  + V +K+LD NDN P+   +  ++ + EN      V  ++  D DK EN        +  +   F +   +G I+     DREK+  Y       D G     ++   V+I++ D NDN PV   P   S   L  P+   SP  + +  + A D D   NA L + +   N     +I+  +GEI           G++ +   VSD G P
Sbjct:   26 YRVQEEQPPNTLIGS--LAADHGLPDSGHLYKLEVGAP-------YLRVDGKTGDIFTTEIPIDRET-------LRDCRSLVKGKPCYLEFEVSVT-----DLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDS----YDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP--VPKLLRIDRTTGIIYVKGPLDREEI--NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPT--IFEVDFAEENQPGET-ILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS--VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE-PPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQL-SPVA--SPD-SHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKP 764          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 202.601 bits (514), Expect = 1.275e-52
Identity = 219/778 (28.15%), Postives = 343/778 (44.09%), Query Frame = 1
Query:  187 FNISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNK-GEIKTIR-KIDRDDEKNICGPLQCCKIVL----CQIQFEINFSPIQTIDNFQSIS-RSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYN--NLFIVYI--DKQA--PILNITGKIDYE--DSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPE-------LIVHQNN--SITENEPSGKIVLTFSFTDLDELSKNQLKC----DFYRSFGLAIDSVDDG--IYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEI---EENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY----FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNK--SKVYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTP 2382
            + + +    NT IG   L     L +    Y+L  G         Y++++ K G+I T    IDR+        L+ C+ ++    C ++FE++ +     D  Q+ S R +   + + D ND+ P F  S   I++ E+     L  +P A DRDS  NGV  Y++    +   LF + +  D+    P L + G +D E  DS    +   + A D G  +   +  + + +TDANDN P F+      E+ EN  VG  V Q  A D D G N  I+YSL     P  +     ++ TTG++ +   +D E       +F V+A D G    S+   V ++V D NDN P        L+ H     +I+E+ P G  V     +D DE     + C    D       A DS  D    Y + +T   D E  +   +EI  +D+ +P +     L V + D+NDN P FS     FE+   EEN P  T +  ++A+D D+    +L ++I+  +Y    F IDP  G +  +T +DRE  E + F V   D G   +K  + V +K+LD NDN P+   +  ++ + EN      V  ++  D DK EN        +  +   F +   +G I+     DREK+  Y       D G     ++   V+I++ D NDN PV   P   S   L  P+   SP  + +  + A D D   NA L + +   N     +I+  +GEI           G++ +   VSD G P
Sbjct:  103 YRVQEEQPPNTLIGS--LAADHGLPDSGHLYKLEVGAP-------YLRVDGKTGDIFTTEIPIDRET-------LRDCRSLVKGKPCYLEFEVSVT-----DLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDS----YDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP--VPKLLRIDRTTGIIYVKGPLDREEI--NSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPT--IFEVDFAEENQPGET-ILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLS--VEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGE-PPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQL-SPVA--SPD-SHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKP 841          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: celsr3 (cadherin EGF LAG seven-pass G-type receptor 3 [Source:NCBI gene;Acc:101169110])

HSP 1 Score: 201.83 bits (512), Expect = 4.685e-52
Identity = 164/610 (26.89%), Postives = 295/610 (48.36%), Query Frame = 1
Query:  475 ISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNE--FPLILLPKAIDRDSLVNG-VRHYSIDNNYNNLFIVY-IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLN--EFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVI-VKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDS---VDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLD-NSDVNKLNFSIIQCNYFTIDPAN--GILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQ----SVAQLSFTDNDKLENGTFTFKEYIMSNNSP-FKLT-KSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTY 2244
            +S +  VT+ + D ND  P F++S+Y   I E+ E  +P++ L +A D DS  N  +R+  + +      + + ID ++ ++   G +D E +     H  + A+D G +         +FI + D NDN P F  K   + + E++   S + +  A+D+D   N+ + Y++  +SG  +   +F ++S TG +++V  +DYE+  +R +T  V A D+GR  LS +  ++ V+V D+NDN P  +      S+ E+ P G  +L     D D     +L+   YR  G   D+   ++     +  + + D E     +  +   D   P +     + + ++D+NDN P+F Q +YY  + E+  + T+V  ++A D D NS V          N F I  A   G+LS+   +D ++   +   V  +D   L +  +V++ I D N + P      + H + +   DQ    +V  +S TD+D  EN   T   Y + +N P F++   +G I L   LD E +  Y +     D+G     + T  V +++ D+NDN P F+ P+ +        +  D+P  T+++ + ATD+D + N ++ Y
Sbjct: 1020 LSGTTMVTITVSDRNDHSPIFEQSEYRETIRENVEEGYPILQL-RAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESNEHYTLH--VEASDQGKDPGPRSATVKVFITVLDENDNVPQFSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNI--ISG--NSRGQFSIDSVTGEIQVVAPLDYES--EREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLE---YRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR-TLHDTCQVHINITDANTHRP---VFQSAHYSVSVNEDQPPGSTVVVISATDDDVGENARIT---YFLEDNIPQFRIDPATGAITLQAELDYEDQMTYTLAITAKDNG-IPQKSDTTYVEVNVNDVNDNSPQFLSPRYQGT------VSEDAPPFTSVLQISATDRDAHANGRVQY 1603          

HSP 2 Score: 190.66 bits (483), Expect = 1.422e-48
Identity = 174/625 (27.84%), Postives = 285/625 (45.60%), Query Frame = 1
Query:  478 SRSVNVTVNIIDENDSLPFFQKSKYDINIIES-NEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIF-IHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQ-NNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY--FTIDPANGILSIKTNIDREEIENFHFEVQITDTG--QLSNKSKVYVKILDVNDNAPQS-TTLMTYHIAENTQIDQSVAQLSFTDNDKLENG--TFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVF------IYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            S +V V + ++DEND++P F + +Y + + E       IL   A DRD   N   HY+I +  N+     ID     + +   +DYE  S+R +   + A D+G       T I  + +TD NDN P F        +LE+  VGS +    A D DSG N+ ++Y    L+G  S  T F +NS TG + + + +D E+ ++  F F V A D G   LS +A+V + VMD+NDN PE +  +    + E+   G  V+T +  D D  S    +     +      S   G   ++     D +  R   + +   D     +     +H+ I D N + P F  A Y   + E+ P  + V  +SA+D D  +  ++ +  ++ N   F IDPA G ++++  +D E+   +   +   D G  Q S+ + V V + DVNDN+PQ  +      ++E+     SV Q+S TD D   NG   +TF+     +        SG +  ++ LDRE    Y +     D G      T   + + + D+NDN PVF      +  KE S  G            + +  + ATD D   NA++ Y++ + N     +++  +GE+
Sbjct: 1131 SATVKVFITVLDENDNVPQFSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISG-NSRGQFSIDSVTGEIQVVAPLDYE--SEREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYR---LTGTGS-DTPFIINSATGWVTVSSILDRES-VEHYF-FGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDVNSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDRT---LHDTCQVHINITDANTHRPVFQSAHYSVSVNEDQPPGSTVVVISATDDDVGENARITY-FLEDNIPQFRIDPATGAITLQAELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPRYQGTVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDRESVPFYELTAYAVDRG-VPPQRTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVG------------SVVSQITATDPDEGANAQIMYQIVEGNIPEIFQMDIFSGEL 1729          

HSP 3 Score: 180.644 bits (457), Expect = 1.845e-45
Identity = 181/664 (27.26%), Postives = 302/664 (45.48%), Query Frame = 1
Query:  529 PFFQKSKYDINIIESNEFPL-ILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVY--IDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTK--FYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSAT--VIVKVMDINDNVPELIVHQN-NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFY--RSFG-LAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHL-HVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNY---FTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSKVYVKILDVNDNAPQSTTLMTY-HIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMK---HLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFF----YIDMIPKPGMYSIKATVSDNGTP--SLTSWMEFFIVLSQANFPK 2439
            P F    Y + + E+      +++  A D D    G   YS+    N+    Y  I     ++  T  +D E     L HF + ATD G       T + I ++D ND+ P F+  E    I EN+  G  + Q  A D DS  N+ I+Y      G  ++  +  F ++  +GL+     VD E+  +  +T  V A+D G+     SAT  V + V+D NDNVP+    +   ++ E+      +L  S TD D+ S   +  +     S G  +IDSV   I  +A     D E  R   + +   DN  P +     +  V + D+NDN P F    +   + E+ P+ +++  + A D D+ D  +L + +        F I+ A G +++ + +DRE +E++ F V+  D G   LS  + V + ++DVNDN P+      Y  + E+  +  SV  ++  D D   N   T++    +  + F ++ +G   L+     LD +++  Y++     D      L  T  V I+I D N ++PVF     +S H  +  +  D P  +T++ + ATD D+ ENA++TY L+  N   F +I+  TG I       Y D +     Y++  T  DNG P  S T+++E  +     N P+
Sbjct:  930 PHFSLYNYQVQVAENQPSSTSVIIMSATDPDPGDPGRMSYSMAPLMNSRSSDYFQIHPNTGLITTTQMLDREHMD--LHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSPIFEQSEYRETIRENVEEGYPILQLRAKDSDSPSNANIRYR---FVGDTAVMARVAFEIDPRSGLITTRGSVDRES--NEHYTLHVEASDQGKDPGPRSATVKVFITVLDENDNVPQFSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIQVVAP---LDYESEREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRDV--NSAVTYQITGGNTRNRFAISTAGGAGLLSLALPLDYKQERRYVLTVTASDR----TLHDTCQVHINITDANTHRPVF-----QSAHYSVS-VNEDQPPGSTVVVISATDDDVGENARITYFLED-NIPQF-RIDPATGAITLQAELDYEDQM----TYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQ 1565          

HSP 4 Score: 179.104 bits (453), Expect = 6.199e-45
Identity = 183/747 (24.50%), Postives = 333/747 (44.58%), Query Frame = 1
Query:  130 KIFFTIGISND-ATIYSHKSF--NISDNIQANTFIGHIPLTEKEALEN----YQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEF-PLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNST--TGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPEL-IVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN----YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVK--ILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSP--FKLTK-SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYD-SPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEI 2304
            K+F T+   ND    +S K +   + ++++ ++ I  +  T+++   N    Y ++ G +  +  ++ V     GEI+ +  +D + E+              +++ + N  P   + N   I     V+V + D ND+ P F  + +  +++ES      IL  +AID DS  N    Y +    ++   + I+     + ++  +D E  S   + F + A D G+        + I + D NDN P F  KE    + E+ +VG+ V    A D+D  VNS + Y ++      +   +F +++    GLL L   +DY+   +R +   V A+D     L  +  V + + D N + P     H + S+ E++P G  V+  S TD D++ +N  +  ++    +    +D     I      D E      + I   DN  P      ++ V + D+NDN PQF   +Y   + E+ P +T+V Q+SA+D D     ++ ++          FTI+P +GI+     +DRE +  +       D G    ++ V+++  +LDVNDNAP          + EN+ +   V+Q++ TD D+  N    ++  I+  N P  F++   SG++  +  LD E ++ Y+I            L + ATV I + D NDN+P       +  H +      + S S  + +  R    D + + +L Y +D+ N      +N  +GEI
Sbjct: 1135 KVFITVLDENDNVPQFSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSV----TGEIQVVAPLDYESEREYT----------LRVRAQDNGRP--PLSNNTGI-----VSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFI-INSATGWVTVSSILDRE--SVEHYFFGVEARDYGMPPLSATASVTITVMDVNDNRPEFLQKEYYGRLNEDAAVGTSVVTVTAVDRD--VNSAVTYQITG----GNTRNRFAISTAGGAGLLSLALPLDYKQ--ERRYVLTVTASDRT---LHDTCQVHINITDANTHRPVFQSAHYSVSVNEDQPPGSTVVVISATD-DDVGENA-RITYFLEDNIPQFRIDPATGAITLQAELDYEDQMTYTLAITAKDNGIPQKSDTTYVEVNVNDVNDNSPQFLSPRYQGTVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDRESVPFYELTAYAVDRGVPPQRTPVHIQVTVLDVNDNAPVFPADDFEVLVKENSAVGSVVSQITATDPDEGANAQIMYQ--IVEGNIPEIFQMDIFSGELTSLIDLDYEARNEYVIVV----QATSAPLVSRATVRIRLVDQNDNRPTL-----QDFHIIFNNFVSNRSNSFPSGVIGRVPAHDPDVSDRLYYTIDRGNELHLLLLNHTSGEI 1833          

HSP 5 Score: 163.31 bits (412), Expect = 4.109e-40
Identity = 133/508 (26.18%), Postives = 238/508 (46.85%), Query Frame = 1
Query:  835 ANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQN---NSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAID---SVDDGIYRIASTQVFDAEFNRFCWIEINCLDNA------SPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN---YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQ--LSNKSK-VYVKILDVNDNAPQ-STTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKL-TKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETG 2298
            A + +P+F      +++ EN    + V    A+D D G    + YS++PL   +S S  F ++  TGL+     +D E+    +  F V ATD G   LS +  V + V D ND+ P  I  Q+    +I EN   G  +L     D D  S   ++  F     +       +D     I +    D E N    + +   D        S  +K    + + ++D NDN PQFS+ +Y   ++E++  ++ + ++SA+D D      ++++II  N    F+ID   G + +   +D E    +   V+  D G+  LSN +  V V++ DVNDN P   +T     + E+  +  S+  +   D D  +N    ++     +++PF + + +G + +   LDRE  + Y       D+G    L+ TA+V+I + D+NDN+P F+   +K  +G +     D+   T+++T+ A D+D+  N+ +TY++   N  +   I++  G
Sbjct:  925 AANRHPHFSLYNYQVQVAENQPSSTSVIIMSATDPDPGDPGRMSYSMAPLMNSRS-SDYFQIHPNTGLITTTQMLDREHM--DLHHFRVTATDHGSPRLSGTTMVTITVSDRNDHSP--IFEQSEYRETIRENVEEGYPILQLRAKDSDSPSNANIRYRFVGDTAVMARVAFEIDPRSGLITTRGSVDRESNEHYTLHVEASDQGKDPGPRSATVK----VFITVLDENDNVPQFSEKRYVVAVKEDVRPHSEILRVSATDRDKDSNAAVHYNIISGNSRGQFSIDSVTGEIQVVAPLDYESEREYTLRVRAQDNGRPPLSNNTGIVSVQVTDVNDNPPIFVSTPFQASVLESAPVGSSILHIQAIDTDSGDNARLEYRLTGTGSDTPFIINSATGWVTVSSILDRESVEHYFFGVEARDYG-MPPLSATASVTITVMDVNDNRPEFL---QKEYYGRLNE---DAAVGTSVVTVTAVDRDV--NSAVTYQITGGNTRNRFAISTAGG 1414          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000046595.1 (SMESG000046595.1)

HSP 1 Score: 1933.69 bits (5008), Expect = 0.000e+0
Identity = 975/981 (99.39%), Postives = 976/981 (99.49%), Query Frame = 1
Query:   85 YFSIEKNLFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQNGQMIDSPDLCNYISMXXXXXXXXXXXXXXXISEKPINKNVNKFNETANSISPDLIFIDHLIQTTTSNWNGTLCAFPQSSNNLKYISKPYHTINSHSHPFINSSNPILNQDPCIFLQSQCLINNEICGESTTRSALLERRYPNFKNVYLDN 3027
            + S  KNLFAIYFFSKIFFTIGI NDATIYSHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVP LIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQNGQMIDSPDLCNYISMHEDELLHNHENNTLNISEKPINKNVNKFNETANSISPDLIFIDHLIQTTTSNWNGTLCAFPQSSNNLKYISKPYHTINSHSHPFINSSNPILNQDPCIFLQSQCLINNEICGESTTRSALLERRYPNFKNVYLDN
Sbjct:   77 WVSGSKNLFAIYFFSKIFFTIGIPNDATIYSHKSFNISDNIQANTFIGHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPVLIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDMIPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQRNFFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQNGQMIDSPDLCNYISMHEDELLHNHENNTLNISEKPINKNVNKFNETANSISPDLIFIDHLIQTTTSNWNGTLCAFPQSSNNLKYISKPYHTINSHSHPFINSSNPILNQDPCIFLQSQCLINNEICGESTTRSALLERRYPNFKNVYLDN 1057          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 368.622 bits (945), Expect = 1.120e-110
Identity = 263/833 (31.57%), Postives = 426/833 (51.14%), Query Frame = 1
Query:  133 IFFTIGISNDATIYSHK-SFNISDNIQANTFIGHI--PLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR-LDKTNASSFTKINSETGEIYFFY------IDMIPKPGMYSIKATVSDNGTPSLTSWM-EFFIVLSQANFPKSSSNNLLTKQRN-FFSNVVIFSLIIVFSTALISTLIAVVVWVRSK 2571
            + F I ++ DA    H  +  ++DN+  +T +G+I   L  +   ENY ++ G ++F     + +L   G+I T + IDRD+ + ICGPL CC   +C+ Q          I N+QS   +VN  +N  IIDEND+ P F + K++IN++E  +   + LP A D DS +NGV +YS+  N+   F + I+K  P L I   +++E+ ++R FH  L A D G  +F+  + +FI   D NDN P F      KT++  EN +    + Q  A D D G N  I Y    L+ P+ I+ KF LN  TG +KL+ K+DYE + D++  F + A D G   LS S  + +   DINDN P + + +N SI EN+     +++    D D+   N++KC+   +    + S  +    I   + FD E +    I+I C D+  P +     L + IID NDN+P F++A++ ++I E+  +   ++Q SA+DLD+ +  K+ + +       F I+ + G + +  ++DRE  E   F V  TD G L    KV + ++D+NDN P+  +     + EN  I   +  +   D D  EN   T +  +  N   +   K  + KI +   +DREK     +   + DHG    LT+  T++I I DINDN P+  YP E         I+ ++   + I+TL A D D +EN K+ +R +D  N S + ++N  +G IY  +          P  G+Y +   + D+ +  + S    F++ + +     S++ +LL    N FF NVVI  +I+VFS  L   L+  +VW R++
Sbjct:    6 VIFCISLA-DAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQ-------ANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG-GQFETMS-LFITTIDRNDNKPIFTDILYRKTVK--ENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR-PKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREY----SANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTR 819          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 369.007 bits (946), Expect = 1.452e-110
Identity = 263/833 (31.57%), Postives = 426/833 (51.14%), Query Frame = 1
Query:  133 IFFTIGISNDATIYSHK-SFNISDNIQANTFIGHI--PLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR-LDKTNASSFTKINSETGEIYFFY------IDMIPKPGMYSIKATVSDNGTPSLTSWM-EFFIVLSQANFPKSSSNNLLTKQRN-FFSNVVIFSLIIVFSTALISTLIAVVVWVRSK 2571
            + F I ++ DA    H  +  ++DN+  +T +G+I   L  +   ENY ++ G ++F     + +L   G+I T + IDRD+ + ICGPL CC   +C+ Q          I N+QS   +VN  +N  IIDEND+ P F + K++IN++E  +   + LP A D DS +NGV +YS+  N+   F + I+K  P L I   +++E+ ++R FH  L A D G  +F+  + +FI   D NDN P F      KT++  EN +    + Q  A D D G N  I Y    L+ P+ I+ KF LN  TG +KL+ K+DYE + D++  F + A D G   LS S  + +   DINDN P + + +N SI EN+     +++    D D +  N++KC+   +    + S  +    I   + FD E +    I+I C D+  P +     L + IID NDN+P F++A++ ++I E+  +   ++Q SA+DLD+ +  K+ + +       F I+ + G + +  ++DRE  E   F V  TD G L    KV + ++D+NDN P+  +     + EN  I   +  +   D D  EN   T +  +  N   +   K  + KI +   +DREK     +   + DHG    LT+  T++I I DINDN P+  YP E         I+ ++   + I+TL A D D +EN K+ +R +D  N S + ++N  +G IY  +          P  G+Y +   + D+ +  + S    F++ + +     S++ +LL    N FF NVVI  +I+VFS  L   L+  +VW R++
Sbjct:    6 VIFCISLA-DAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQ-------ANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG-GQFETMS-LFITTIDRNDNKPIFTDILYRKTVK--ENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR-PKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREY----SANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTR 819          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 368.237 bits (944), Expect = 1.652e-110
Identity = 263/833 (31.57%), Postives = 426/833 (51.14%), Query Frame = 1
Query:  133 IFFTIGISNDATIYSHK-SFNISDNIQANTFIGHI--PLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR-LDKTNASSFTKINSETGEIYFFY------IDMIPKPGMYSIKATVSDNGTPSLTSWM-EFFIVLSQANFPKSSSNNLLTKQRN-FFSNVVIFSLIIVFSTALISTLIAVVVWVRSK 2571
            + F I ++ DA    H  +  ++DN+  +T +G+I   L  +   ENY ++ G ++F     + +L   G+I T + IDRD+ + ICGPL CC   +C+ Q          I N+QS   +VN  +N  IIDEND+ P F + K++IN++E  +   + LP A D DS +NGV +YS+  N+   F + I+K  P L I   +++E+ ++R FH  L A D G  +F+  + +FI   D NDN P F      KT++  EN +    + Q  A D D G N  I Y    L+ P+ I+ KF LN  TG +KL+ K+DYE + D++  F + A D G   LS S  + +   DINDN P + + +N SI EN+     +++    D D+   N++KC+   +    + S  +    I   + FD E +    I+I C D+  P +     L + IID NDN+P F++A++ ++I E+  +   ++Q SA+DLD+ +  K+ + +       F I+ + G + +  ++DRE  E   F V  TD G L    KV + ++D+NDN P+  +     + EN  I   +  +   D D  EN   T +  +  N   +   K  + KI +   +DREK     +   + DHG    LT+  T++I I DINDN P+  YP E         I+ ++   + I+TL A D D +EN K+ +R +D  N S + ++N  +G IY  +          P  G+Y +   + D+ +  + S    F++ + +     S++ +LL    N FF NVVI  +I+VFS  L   L+  +VW R++
Sbjct:    6 VIFCISLA-DAIAEEHSINMKLNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQ-------ANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG-GQFETMS-LFITTIDRNDNKPIFTDILYRKTVK--ENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHD-DDSVHNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR-PKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREY----SANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTR 819          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000008875.1 (SMESG000008875.1)

HSP 1 Score: 366.696 bits (940), Expect = 2.920e-110
Identity = 258/812 (31.77%), Postives = 417/812 (51.35%), Query Frame = 1
Query:  193 ISDNIQANTFIGHI--PLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEKNICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVN--IIDENDSLPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLFIVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIHITDANDNYPNFD--FKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSLSPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRLHLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDELSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLDNASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSASDLDNSDVNKLNFSIIQCN--YFTIDPANGILSIKTNIDREEIENFHFEVQITDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFTDNDKLENGTFTFKEYIMSNNSPFKLTK--SGKIILMKHLDREKKDLYLIPFIVYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSPSRTTIITLRATDQDLNENAKLTYR-LDKTNASSFTKINSETGEIYFFY------IDMIPKPGMYSIKATVSDNGTPSLTSWM-EFFIVLSQANFPKSSSNNLLTKQRN-FFSNVVIFSLIIVFSTALISTLIAVVVWVRSK 2571
            ++DN+  +T +G+I   L  +   ENY ++ G ++F     + +L   G+I T + IDRD+ + ICGPL CC   +C+ Q          I N+QS   +VN  +N  IIDEND+ P F + K++IN++E  +   + LP A D DS +NGV +YS+  N+   F + I+K  P L I   +++E+ ++R FH  L A D G  +F+  + +FI   D NDN P F      KT++  EN +    + Q  A D D G N  I Y    L+ P+ I+ KF LN  TG +KL+ K+DYE + D++  F + A D G   LS S  + +   DINDN P + + +N SI EN+     +++    D D +  N++KC+   +    + S  +    I   + FD E +    I+I C D+  P +     L + IID NDN+P F++A++ ++I E+  +   ++Q SA+DLD+ +  K+ + +       F I+ + G + +  ++DRE  E   F V  TD G L    KV + ++D+NDN P+  +     + EN  I   +  +   D D  EN   T +  +  N   +   K  + KI +   +DREK     +   + DHG    LT+  T++I I DINDN P+  YP E         I+ ++   + I+TL A D D +EN K+ +R +D  N S + ++N  +G IY  +          P  G+Y +   + D+ +  + S    F++ + +     S++ +LL    N FF NVVI  +I+VFS  L   L+  +VW R++
Sbjct:    3 LNDNVPKSTNVGNIFKMLNYQLFNENYHIIVGTSTFTKFHEFFKLFKSGDIITTKFIDRDNREEICGPLSCCSKDICEFQ-------ANAILNYQSTKPAVNFQINFEIIDENDNPPKFNQFKFNINVLEEQKNYRMSLPTAYDLDSSINGVYNYSLSENHKKFFQLSIEKGYPELLILSALNFENVNERKFHLQLTAFDRG-GQFETMS-LFITTIDRNDNKPIFTDILYRKTVK--ENTTYTIPILQVQAKDLDEGENGKISYRFDTLT-PQEINDKFSLNKLTGEIKLLQKLDYEIYSDQLIEFTIEAVDEGSPQLSGSCKIEIHSTDINDNSPRIEILKNVSIPENKRIATPIMSIYVHDDDSV-HNKVKCNKNSNDNFRLHSSQENSLTIYMERTFDYENSSIHQIDIECFDSGIPPMATYKSLFIAIIDENDNFPIFTRAQHIYQISEDSKVNEFLFQCSATDLDSGNFGKITYRLDDAGNKEFVINISTGYIYLYNSLDREVKEMLEFFVYATDGGGLEASVKVSITVMDINDNPPRLKSPKILTVLENEPIGTLIGNVEVFDLDDGENARVTIENEVQENALFYSYLKLDNNKIFIKSLIDREKVSQIFLRLKLVDHGR-PKLTSWETITISIIDINDNDPILEYPSEGDVMNSRSLIYVNTQFNSFILTLLARDSDFDENGKIRFRIMDDCNGSRYFQVNETSGAIYSTWSCRNGQFISCPIAGLYRVNIELKDSSSTIVRSTKSHFYLTIREY----SANYDLLNVNSNSFFKNVVILVMIVVFSIVLAVGLVGAIVWARTR 796          
The following BLAST results are available for this feature:
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAT41.048e-5527.66FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HG... [more]
FAT42.354e-5527.66FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HG... [more]
PCDH11Y2.442e-5426.52protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.756e-5426.62protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y3.168e-5426.62protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.080e-5028.21FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.380e-5028.21FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-13.379e-3526.18Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-13.379e-3526.18Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-15.839e-3025.14CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds7.913e-5528.12gene:FBgn0284247 transcript:FBtr0078045[more]
ds7.913e-5528.12gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.848e-5026.25gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.848e-5026.25gene:FBgn0024836 transcript:FBtr0300578[more]
stan1.948e-5026.25gene:FBgn0024836 transcript:FBtr0304900[more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.11.840e-5527.84protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.12.300e-5527.84protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.13.090e-5527.84protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.13.141e-5527.84protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.14.282e-5527.84protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAT44.367e-6229.24FAT atypical cadherin 4 [Source:NCBI gene;Acc:1001... [more]
pcdh174.020e-5727.40protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.216e-5727.40protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.932e-5727.40protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh177.719e-5727.40protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x3.658e-5426.89protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Celsr14.606e-5426.85cadherin, EGF LAG seven-pass G-type receptor 1 [So... [more]
Pcdh11x9.450e-5426.89protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x9.450e-5426.89protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.008e-5326.89protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6V0I7|FAT4_HUMAN1.130e-5427.66Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT... [more]
sp|Q24292|DS_DROME7.895e-5428.12Protein dachsous OS=Drosophila melanogaster OX=722... [more]
sp|O35161|CELR1_MOUSE3.222e-5326.85Cadherin EGF LAG seven-pass G-type receptor 1 OS=M... [more]
sp|Q9BZA8|PC11Y_HUMAN4.878e-5326.62Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q9BZA7|PC11X_HUMAN6.019e-5326.62Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin alpha-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095ANT62.685e-8928.76Protocadherin alpha-2 OS=Schistosoma haematobium O... [more]
A0A0R3WAJ96.992e-8928.39Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A430QQX41.298e-8728.02Protocadherin delta 1 OS=Schistosoma bovis OX=6184... [more]
A0A4Z2DW291.331e-8728.29Protocadherin-1 OS=Schistosoma japonicum OX=6182 G... [more]
A0A183LHJ72.314e-8627.78Uncharacterized protein OS=Schistosoma margrebowie... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b2.351e-5427.32protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh117.761e-5427.62protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.963e-5327.62protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh114.043e-5227.71protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh7a1.432e-5125.84protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.13.318e-5426.43pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh112.345e-4926.79protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000004042.11.059e-4326.26pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.11.103e-4326.69pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000006996.11.714e-4327.06pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.267e-5727.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404707.663e-5127.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.302e-4727.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.424e-4727.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348158.736e-4627.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b5.573e-5727.28protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b1.246e-5627.28protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a6.977e-5328.15protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a1.275e-5228.15protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
celsr34.685e-5226.89cadherin EGF LAG seven-pass G-type receptor 3 [Sou... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046595.10.000e+099.39SMESG000046595.1[more]
SMESG000008875.11.120e-11031.57SMESG000008875.1[more]
SMESG000008875.11.452e-11031.57SMESG000008875.1[more]
SMESG000008875.11.652e-11031.57SMESG000008875.1[more]
SMESG000008875.12.920e-11031.77SMESG000008875.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002560 ID=SMED30002560|Name=Protocadherin alpha-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3219bp
CTAAAATTAACTTTATTCTCATATTTTATTTAGGAGATAACCCAGATTTT
TGTTCTTTTCATAAACAAGCTATCAATGTTTTATTACTTTTCCATTGAAA
AAAATCTCTTTGCCATTTACTTTTTCTCAAAGATTTTCTTTACAATTGGT
ATTTCAAATGATGCAACTATATATTCTCATAAATCATTCAACATATCTGA
TAACATTCAAGCCAACACTTTCATCGGTCATATTCCGTTAACGGAAAAAG
AAGCCCTGGAAAACTATCAACTCCTATTCGGTAAAACAAGTTTCAGAAAT
CTCGTCAATTATGTTCAACTTAACAATAAAGGTGAAATTAAAACAATTCG
AAAAATCGACCGTGACGATGAGAAAAATATTTGTGGACCCCTTCAATGCT
GTAAAATTGTTCTCTGTCAAATTCAATTTGAAATTAATTTTTCTCCCATT
CAAACAATCGACAATTTTCAATCGATTTCACGAAGTGTAAATGTGACAGT
CAATATCATTGATGAAAATGACAGTCTTCCATTTTTCCAAAAATCCAAAT
ACGACATTAACATCATTGAATCGAATGAGTTCCCATTGATACTTTTACCG
AAAGCCATTGATAGAGATTCTTTAGTCAACGGCGTCAGACATTATTCAAT
CGACAACAATTATAACAATTTGTTTATTGTGTATATCGATAAACAGGCAC
CAATTTTGAATATAACTGGAAAAATAGACTATGAAGATAGCAGTCAACGC
TTGTTTCATTTTTTGCTTTTTGCCACGGATGACGGGTTAAACGAATTCAA
ATGCAAAACAGATATCTTCATTCACATCACCGATGCCAACGATAATTATC
CAAATTTTGATTTCAAGGAGAAGACAATTGAGATTTTAGAAAACATTTCA
GTCGGCTCTATTGTCTATCAATTTGTCGCATCGGATAAAGATTCTGGTGT
AAATTCCTTAATAAAATATAGCTTATCTCCATTGAGTGGTCCGAAGTCAA
TTAGTACAAAGTTTTATCTCAACTCAACGACGGGTCTTCTTAAACTTGTT
AATAAAGTTGACTATGAAAATTTTATAGATAGAATTTTCACTTTTATTGT
TATTGCTACTGACAGTGGGAGATTGCATTTGTCAACTTCAGCCACCGTCA
TTGTGAAAGTGATGGATATCAATGACAATGTACCAGAGTTAATTGTCCAC
CAAAATAATTCAATTACGGAAAATGAACCTTCCGGGAAAATCGTCTTAAC
GTTCTCTTTCACTGATCTTGATGAGTTGTCGAAAAACCAATTAAAATGTG
ATTTTTATAGATCTTTCGGACTGGCAATCGACAGTGTTGACGATGGAATC
TATCGGATTGCATCTACCCAAGTTTTTGATGCGGAATTCAATAGGTTTTG
TTGGATCGAGATCAACTGTTTAGATAATGCGAGTCCAATTATAAAAAAGC
TCTTTCATCTTCATGTACCAATTATCGACATCAATGACAACTATCCACAA
TTTTCTCAAGCGAAATATTACTTTGAAATCGAAGAGAATCTTCCAATTTA
CACAAATGTTTATCAATTGTCTGCGTCTGATTTGGATAACTCGGACGTAA
ACAAACTGAATTTTTCAATTATTCAGTGCAATTATTTCACCATTGATCCG
GCAAATGGAATTTTGTCAATTAAAACAAACATTGATAGAGAGGAAATAGA
GAATTTTCATTTTGAGGTGCAAATAACTGACACGGGTCAGCTTAGTAACA
AAAGTAAGGTTTATGTAAAAATCCTTGACGTAAATGATAATGCACCCCAA
TCAACAACCCTCATGACGTATCATATTGCTGAAAACACCCAAATTGATCA
ATCCGTAGCACAATTGTCCTTCACAGACAATGATAAATTGGAAAATGGTA
CTTTTACTTTTAAAGAATACATCATGTCCAACAACAGTCCATTTAAATTG
ACAAAATCTGGCAAGATTATACTTATGAAGCATTTGGATAGAGAGAAAAA
AGACCTATATCTCATTCCTTTTATAGTATATGATCATGGGAATTTCGTTG
CACTTACAACTACCGCTACGGTTTCGATACATATCCAAGACATTAATGAC
AATAAGCCAGTTTTTATTTATCCGAAAGAGAAAAGCAAACACGGTCTCAT
CAAACCAATCTTCTATGACAGTCCTTCTAGGACAACAATTATCACTTTAA
GGGCTACTGATCAGGATTTAAATGAAAATGCAAAGTTAACCTATCGGCTT
GACAAAACGAATGCGTCATCTTTTACAAAAATTAACAGTGAAACTGGGGA
AATTTATTTTTTCTACATTGATATGATTCCCAAACCAGGAATGTATAGTA
TTAAAGCAACCGTCTCAGATAATGGGACTCCTTCTTTGACTTCTTGGATG
GAGTTTTTTATCGTTCTCTCTCAAGCTAACTTTCCGAAATCTTCATCAAA
TAATTTATTAACTAAGCAAAGAAATTTCTTCAGCAATGTTGTGATTTTTT
CGTTGATCATTGTATTCAGTACAGCGTTGATATCAACGTTAATAGCCGTT
GTAGTTTGGGTACGCTCAAAACAGAACGGTCAAATGATTGACTCTCCAGA
TTTGTGCAATTATATTTCAATGCACGAAGATGAGCTGCTGCACAATCACG
AAAATAATACTCTTAATATTTCCGAAAAACCAATCAATAAAAATGTGAAT
AAATTCAACGAAACTGCAAACTCAATCAGTCCAGATCTCATTTTCATAGA
TCATCTCATTCAAACAACAACTTCCAATTGGAATGGTACATTGTGCGCAT
TTCCTCAATCATCAAACAACCTAAAATATATTTCCAAACCTTATCATACT
ATAAATTCTCATAGTCATCCATTTATAAACTCTTCAAATCCTATTTTAAA
TCAAGACCCTTGCATTTTCTTACAATCTCAATGTCTCATTAACAATGAAA
TATGTGGTGAATCGACAACTCGAAGTGCTTTGCTAGAAAGAAGATATCCG
AATTTCAAGAATGTCTACCTTGATAACTAATGTTGAGGACTTTATTTGGT
GTTATTTAGAGTCTTTTGAATACCTGCAATATCAATCAAAACATATTCCA
TCTTAGATTCGGTAAAGTTAATGAAAGGTTTCTGATAAATCACTGAAATT
AGAGTTGAAATTATTTTAATTATATATTACTTATTCGATGATGCATATAT
AAATGTTTTTGTATCAGAT
back to top

protein sequence of SMED30002560-orf-1

>SMED30002560-orf-1 ID=SMED30002560-orf-1|Name=SMED30002560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=985bp
MFYYFSIEKNLFAIYFFSKIFFTIGISNDATIYSHKSFNISDNIQANTFI
GHIPLTEKEALENYQLLFGKTSFRNLVNYVQLNNKGEIKTIRKIDRDDEK
NICGPLQCCKIVLCQIQFEINFSPIQTIDNFQSISRSVNVTVNIIDENDS
LPFFQKSKYDINIIESNEFPLILLPKAIDRDSLVNGVRHYSIDNNYNNLF
IVYIDKQAPILNITGKIDYEDSSQRLFHFLLFATDDGLNEFKCKTDIFIH
ITDANDNYPNFDFKEKTIEILENISVGSIVYQFVASDKDSGVNSLIKYSL
SPLSGPKSISTKFYLNSTTGLLKLVNKVDYENFIDRIFTFIVIATDSGRL
HLSTSATVIVKVMDINDNVPELIVHQNNSITENEPSGKIVLTFSFTDLDE
LSKNQLKCDFYRSFGLAIDSVDDGIYRIASTQVFDAEFNRFCWIEINCLD
NASPIIKKLFHLHVPIIDINDNYPQFSQAKYYFEIEENLPIYTNVYQLSA
SDLDNSDVNKLNFSIIQCNYFTIDPANGILSIKTNIDREEIENFHFEVQI
TDTGQLSNKSKVYVKILDVNDNAPQSTTLMTYHIAENTQIDQSVAQLSFT
DNDKLENGTFTFKEYIMSNNSPFKLTKSGKIILMKHLDREKKDLYLIPFI
VYDHGNFVALTTTATVSIHIQDINDNKPVFIYPKEKSKHGLIKPIFYDSP
SRTTIITLRATDQDLNENAKLTYRLDKTNASSFTKINSETGEIYFFYIDM
IPKPGMYSIKATVSDNGTPSLTSWMEFFIVLSQANFPKSSSNNLLTKQRN
FFSNVVIFSLIIVFSTALISTLIAVVVWVRSKQNGQMIDSPDLCNYISMH
EDELLHNHENNTLNISEKPINKNVNKFNETANSISPDLIFIDHLIQTTTS
NWNGTLCAFPQSSNNLKYISKPYHTINSHSHPFINSSNPILNQDPCIFLQ
SQCLINNEICGESTTRSALLERRYPNFKNVYLDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 342..361
score: 47.15
coord: 517..543
score: 24.61
coord: 549..566
score: 42.71
coord: 465..478
score: 37.32
coord: 328..340
score: 28.44
coord: 191..210
score: 19.9
coord: 252..281
score: 29.77
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 166..250
e-value: 1.3E-7
score: 41.3
coord: 699..780
e-value: 0.0033
score: 26.7
coord: 588..669
e-value: 1.7E-11
score: 54.2
coord: 274..361
e-value: 3.3E-20
score: 83.1
coord: 489..565
e-value: 1.3E-20
score: 84.5
coord: 384..465
e-value: 1.7
score: 1.4
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 258..353
e-value: 1.8E-12
score: 47.5
coord: 472..557
e-value: 1.8E-13
score: 50.8
coord: 573..662
e-value: 3.4E-9
score: 37.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 248..359
e-value: 3.1E-25
score: 90.9
coord: 463..565
e-value: 2.2E-25
score: 91.4
coord: 21..140
e-value: 8.0E-5
score: 25.0
coord: 141..247
e-value: 1.9E-13
score: 52.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 566..667
e-value: 1.4E-20
score: 75.8
coord: 360..462
e-value: 4.6E-10
score: 41.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 668..773
e-value: 7.1E-13
score: 51.0
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 526..915
coord: 30..547
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 370..467
score: 10.988
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 146..252
score: 15.943
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 23..145
score: 9.783
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 253..363
score: 23.375
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 567..671
score: 21.16
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 468..567
score: 24.339
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 689..780
score: 10.528
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 689..776
e-value: 4.64917E-13
score: 63.8717
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 472..563
e-value: 4.49483E-24
score: 95.4581
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 162..248
e-value: 5.02583E-13
score: 63.8717
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 258..359
e-value: 2.55394E-26
score: 101.621
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 572..667
e-value: 4.6731E-19
score: 81.2057
NoneNo IPR availableTMHMMTMhelixcoord: 798..820
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 351..361
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 659..669
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 356..459
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 455..569
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 555..674
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 139..252
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 240..366
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 664..771