Multifunctional fusion protein

Overview
NameMultifunctional fusion protein
Smed IDSMED30002558
Length (bp)2787
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multifunctional fusion protein (SMED30002558) t-SNE clustered cells

Violin plots show distribution of expression levels for Multifunctional fusion protein (SMED30002558) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multifunctional fusion protein (SMED30002558) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multifunctional fusion protein (SMED30002558) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002558

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30002558SMESG000052650.1 SMESG000052648.1 dd_Smed_v4_6388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002558SMESG000052650.1 SMESG000052648.1 dd_Smed_v4_6388_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multifunctional fusion protein vs. Ensembl Human
Match: ALDH4A1 (aldehyde dehydrogenase 4 family member A1 [Source:HGNC Symbol;Acc:HGNC:406])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 295/533 (55.35%), Postives = 387/533 (72.61%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE +L + QGS ER  L+  L +   +   +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ +L AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGPLFG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+++V   T+RS+FEY GQKCSACSRLYVP S+WP +K +++   +++K+  P     TFFSAVID  +F RIK ++++A ++  LTI  GGKCDDSVGYF+ P I+ + DP + IMKEEIFGPVL+VYVYPD   + TL LVDSTT YGLTGA+FS D+  V+ A   LR++ GN YIN +STGS+VGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W   +M+
Sbjct:   31 KVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 563          
BLAST of Multifunctional fusion protein vs. Ensembl Human
Match: ALDH4A1 (aldehyde dehydrogenase 4 family member A1 [Source:HGNC Symbol;Acc:HGNC:406])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 295/533 (55.35%), Postives = 387/533 (72.61%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE +L + QGS ER  L+  L +   +   +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ +L AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGPLFG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+++V   T+RS+FEY GQKCSACSRLYVP S+WP +K +++   +++K+  P     TFFSAVID  +F RIK ++++A ++  LTI  GGKCDDSVGYF+ P I+ + DP + IMKEEIFGPVL+VYVYPD   + TL LVDSTT YGLTGA+FS D+  V+ A   LR++ GN YIN +STGS+VGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W   +M+
Sbjct:   31 KVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 563          
BLAST of Multifunctional fusion protein vs. Ensembl Human
Match: ALDH4A1 (aldehyde dehydrogenase 4 family member A1 [Source:HGNC Symbol;Acc:HGNC:406])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 285/500 (57.00%), Postives = 371/500 (74.20%), Query Frame = 1
Query:  310 VPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ +L AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGPLFG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+++V   T+RS+FEY GQKCSACSRLYVP S+WP +K +++   +++K+  P     TFFSAVID  +F RIK ++++A ++  LTI  GGKCDDSVGYF+ P I+ + DP + IMKEEIFGPVL+VYVYPD   + TL LVDSTT YGLTGA+FS D+  V+ A   LR++ GN YIN +STGS+VGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W   +M+
Sbjct:    4 IPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 503          
BLAST of Multifunctional fusion protein vs. Ensembl Human
Match: ALDH4A1 (aldehyde dehydrogenase 4 family member A1 [Source:HGNC Symbol;Acc:HGNC:406])

HSP 1 Score: 518.464 bits (1334), Expect = 7.657e-175
Identity = 259/534 (48.50%), Postives = 342/534 (64.04%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVID-KNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE +L + QGS ER  L+  L +   +   +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ +L AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGPLFG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+++V   T+RS+FEY GQKCSACSRLYVP S+WP +K +++   +++K+  P     TFFSAVID K  F  + S   Y  +  K T++                                                    LVDSTT YGLTGA+FS D+  V+ A   LR++ GN YIN +STGS+VGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W   +M+
Sbjct:   31 KVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKEIFGPVLSVYVYPDDKYKETLQ----------------------------------------------------LVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 512          
BLAST of Multifunctional fusion protein vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 436.417 bits (1121), Expect = 5.630e-144
Identity = 205/274 (74.82%), Postives = 236/274 (86.13%), Query Frame = -2
Query: 1959 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKA 2780
            +KK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      + SG TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKD++RGNV  DSKN P + A  F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV MVP KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V+KKA
Sbjct:  157 IKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKA 424          
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Match: alh-6 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q6A593])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 280/530 (52.83%), Postives = 369/530 (69.62%), Query Frame = 1
Query:  220 NENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYA-SNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            NE IL Y++GSKER  LE  L+ Y     EVP+ IGD+++ +     Q  P DH  TLA + Y+  + + +AI  +L+AR  W++ PLK+RA+I L+AADL +  YR  L A+TMLGQGK I QAEIDAA ELIDF RFN   A  +  Y PIS     N + +RG EGF AAI PFNFTAIGGNL  +PALMGN  LWKP+++A+LSNY IY +L E+ +PPG+++F+P DGP+FG  IT +P+L+ +NFTGSV TF+ +   V +N   Y++FP+LIGECGGKNFHFVH SA +D V+  T RS++EY+GQKCSACSR+Y P+SIWP + EK+  I  ++K+        F SAVID  AF R+K+YID+A +  +   +  GGKCDD  GYFI PT+I  +DP  K++ EE+FGPV+ V VY DS ++  L  V   TPYGLTGA+FS D++F+  A + LR + GN+Y+N +STGS+VGQQPFGGSRLSGTNDKAGGP+Y L++ S  ++K        WK   ME
Sbjct:   34 NEPILEYRKGSKERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQIQEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFLYRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVSLTDWKYPSME 563          
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Match: alh-6 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q6A593])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 280/530 (52.83%), Postives = 369/530 (69.62%), Query Frame = 1
Query:  220 NENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYA-SNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            NE IL Y++GSKER  LE  L+ Y     EVP+ IGD+++ +     Q  P DH  TLA + Y+  + + +AI  +L+AR  W++ PLK+RA+I L+AADL +  YR  L A+TMLGQGK I QAEIDAA ELIDF RFN   A  +  Y PIS     N + +RG EGF AAI PFNFTAIGGNL  +PALMGN  LWKP+++A+LSNY IY +L E+ +PPG+++F+P DGP+FG  IT +P+L+ +NFTGSV TF+ +   V +N   Y++FP+LIGECGGKNFHFVH SA +D V+  T RS++EY+GQKCSACSR+Y P+SIWP + EK+  I  ++K+        F SAVID  AF R+K+YID+A +  +   +  GGKCDD  GYFI PT+I  +DP  K++ EE+FGPV+ V VY DS ++  L  V   TPYGLTGA+FS D++F+  A + LR + GN+Y+N +STGS+VGQQPFGGSRLSGTNDKAGGP+Y L++ S  ++K        WK   ME
Sbjct:   34 NEPILEYRKGSKERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQIQEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFLYRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVSLTDWKYPSME 563          
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Match: alh-6 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q6A593])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 280/530 (52.83%), Postives = 369/530 (69.62%), Query Frame = 1
Query:  220 NENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYA-SNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            NE IL Y++GSKER  LE  L+ Y     EVP+ IGD+++ +     Q  P DH  TLA + Y+  + + +AI  +L+AR  W++ PLK+RA+I L+AADL +  YR  L A+TMLGQGK I QAEIDAA ELIDF RFN   A  +  Y PIS     N + +RG EGF AAI PFNFTAIGGNL  +PALMGN  LWKP+++A+LSNY IY +L E+ +PPG+++F+P DGP+FG  IT +P+L+ +NFTGSV TF+ +   V +N   Y++FP+LIGECGGKNFHFVH SA +D V+  T RS++EY+GQKCSACSR+Y P+SIWP + EK+  I  ++K+        F SAVID  AF R+K+YID+A +  +   +  GGKCDD  GYFI PT+I  +DP  K++ EE+FGPV+ V VY DS ++  L  V   TPYGLTGA+FS D++F+  A + LR + GN+Y+N +STGS+VGQQPFGGSRLSGTNDKAGGP+Y L++ S  ++K        WK   ME
Sbjct:   34 NEPILEYRKGSKERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQIQEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFLYRARDVLRDAVGNMYLNDKSTGSIVGQQPFGGSRLSGTNDKAGGPHYGLRWTSPLTIKETSVSLTDWKYPSME 563          
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Match: alh-6 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q6A593])

HSP 1 Score: 510.76 bits (1314), Expect = 3.050e-172
Identity = 240/457 (52.52%), Postives = 318/457 (69.58%), Query Frame = 1
Query:  220 NENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYA-SNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFV 1587
            NE IL Y++GSKER  LE  L+ Y     EVP+ IGD+++ +     Q  P DH  TLA + Y+  + + +AI  +L+AR  W++ PLK+RA+I L+AADL +  YR  L A+TMLGQGK I QAEIDAA ELIDF RFN   A  +  Y PIS     N + +RG EGF AAI PFNFTAIGGNL  +PALMGN  LWKP+++A+LSNY IY +L E+ +PPG+++F+P DGP+FG  IT +P+L+ +NFTGSV TF+ +   V +N   Y++FP+LIGECGGKNFHFVH SA +D V+  T RS++EY+GQKCSACSR+Y P+SIWP + EK+  I  ++K+        F SAVID  AF R+K+YID+A +  +   +  GGKCDD  GYFI PT+I  +DP  K++ EE+FGPV+ V VY DS ++  L  V   TPYGLTGA+FS D++F+
Sbjct:   34 NEPILEYRKGSKERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQIQEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFL 490          
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Match: alh-6 (ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;Acc:Q6A593])

HSP 1 Score: 510.76 bits (1314), Expect = 3.050e-172
Identity = 240/457 (52.52%), Postives = 318/457 (69.58%), Query Frame = 1
Query:  220 NENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYA-SNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFV 1587
            NE IL Y++GSKER  LE  L+ Y     EVP+ IGD+++ +     Q  P DH  TLA + Y+  + + +AI  +L+AR  W++ PLK+RA+I L+AADL +  YR  L A+TMLGQGK I QAEIDAA ELIDF RFN   A  +  Y PIS     N + +RG EGF AAI PFNFTAIGGNL  +PALMGN  LWKP+++A+LSNY IY +L E+ +PPG+++F+P DGP+FG  IT +P+L+ +NFTGSV TF+ +   V +N   Y++FP+LIGECGGKNFHFVH SA +D V+  T RS++EY+GQKCSACSR+Y P+SIWP + EK+  I  ++K+        F SAVID  AF R+K+YID+A +  +   +  GGKCDD  GYFI PT+I  +DP  K++ EE+FGPV+ V VY DS ++  L  V   TPYGLTGA+FS D++F+
Sbjct:   34 NEPILEYRKGSKERQDLEAALAFYSKNITEVPLRIGDKKITNKLEQKQVIPSDHRSTLAKYTYATGEQIQEAIDVALQARGAWERKPLKERAEILLRAADLAAGKYRMKLNASTMLGQGKNIIQAEIDAACELIDFFRFNAVFAMELEHYEPISTKITKNTMQFRGMEGFVAAIAPFNFTAIGGNLPTAPALMGNVSLWKPSNTAVLSNYIIYELLEEAGMPPGILSFLPSDGPVFGDVITASPHLSAVNFTGSVPTFKTIWRKVAENLDNYVTFPKLIGECGGKNFHFVHPSAHVDAVAAGTARSAWEYSGQKCSACSRMYAPKSIWPKILEKISAIHKEIKLGDVRDGSVFLSAVIDDKAFARLKAYIDFAKTGADGANVVLGGKCDDKTGYFIEPTLITVTDPKSKLLTEEMFGPVVTVLVYEDSKVDEVLATVKDATPYGLTGAVFSQDKEFL 490          
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Match: P5CDh1 (gene:FBgn0037138 transcript:FBtr0078446)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/550 (53.82%), Postives = 393/550 (71.45%), Query Frame = 1
Query:  139 TKILNAVVN--KLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            T+ L +V+   KLK F +AN          E IL Y + SKER  LE  L    +   ++PI IG +E K+ ++ +Q  P DH   LA+F+Y+D+K++ KAIKT++E + KWD+  + DR KI+ KAADL+++TYR  L A TMLGQ KT  QAEID+AAELIDF+R N      VTKY+PIS    +  N + +RG +GF AA++PFNFTAIGGNL+ +PALMGN VLWKP+D+A+LSN+ I++I+RE+ +P GV+NFVP DGP+FG TIT +P+LAGINFTGSV TF  L + VG N   Y++FPRL GECGGKNFHF+H SAD+++V  ST+RS+FEY GQKCSACSR+YVPES+WP +KE ++    ++KI       +F SAVID  AF RI  YI++A  +  L I  GG   DS GYF++PTI+ + DP D+IM EEIFGPVL++YVY +S +  T+ LV ++T + LTGA+F  DE FV+ A  + + + GN YIN +STGSVVGQQPFGG R+SGTNDKAGGP+Y+L++ S QS+K    P
Sbjct:   24 TRCLGSVIPDLKLKDFPIAN----------EPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQSIKETFVP 563          
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Match: P5CDh1 (gene:FBgn0037138 transcript:FBtr0303031)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/550 (53.82%), Postives = 393/550 (71.45%), Query Frame = 1
Query:  139 TKILNAVVN--KLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            T+ L +V+   KLK F +AN          E IL Y + SKER  LE  L    +   ++PI IG +E K+ ++ +Q  P DH   LA+F+Y+D+K++ KAIKT++E + KWD+  + DR KI+ KAADL+++TYR  L A TMLGQ KT  QAEID+AAELIDF+R N      VTKY+PIS    +  N + +RG +GF AA++PFNFTAIGGNL+ +PALMGN VLWKP+D+A+LSN+ I++I+RE+ +P GV+NFVP DGP+FG TIT +P+LAGINFTGSV TF  L + VG N   Y++FPRL GECGGKNFHF+H SAD+++V  ST+RS+FEY GQKCSACSR+YVPES+WP +KE ++    ++KI       +F SAVID  AF RI  YI++A  +  L I  GG   DS GYF++PTI+ + DP D+IM EEIFGPVL++YVY +S +  T+ LV ++T + LTGA+F  DE FV+ A  + + + GN YIN +STGSVVGQQPFGG R+SGTNDKAGGP+Y+L++ S QS+K    P
Sbjct:   24 TRCLGSVIPDLKLKDFPIAN----------EPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQSIKETFVP 563          
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Match: P5CDh1 (gene:FBgn0037138 transcript:FBtr0332813)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/550 (53.82%), Postives = 393/550 (71.45%), Query Frame = 1
Query:  139 TKILNAVVN--KLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            T+ L +V+   KLK F +AN          E IL Y + SKER  LE  L    +   ++PI IG +E K+ ++ +Q  P DH   LA+F+Y+D+K++ KAIKT++E + KWD+  + DR KI+ KAADL+++TYR  L A TMLGQ KT  QAEID+AAELIDF+R N      VTKY+PIS    +  N + +RG +GF AA++PFNFTAIGGNL+ +PALMGN VLWKP+D+A+LSN+ I++I+RE+ +P GV+NFVP DGP+FG TIT +P+LAGINFTGSV TF  L + VG N   Y++FPRL GECGGKNFHF+H SAD+++V  ST+RS+FEY GQKCSACSR+YVPES+WP +KE ++    ++KI       +F SAVID  AF RI  YI++A  +  L I  GG   DS GYF++PTI+ + DP D+IM EEIFGPVL++YVY +S +  T+ LV ++T + LTGA+F  DE FV+ A  + + + GN YIN +STGSVVGQQPFGG R+SGTNDKAGGP+Y+L++ S QS+K    P
Sbjct:   24 TRCLGSVIPDLKLKDFPIAN----------EPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQSIKETFVP 563          
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Match: P5CDh1 (gene:FBgn0037138 transcript:FBtr0078447)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/550 (53.82%), Postives = 393/550 (71.45%), Query Frame = 1
Query:  139 TKILNAVVN--KLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            T+ L +V+   KLK F +AN          E IL Y + SKER  LE  L    +   ++PI IG +E K+ ++ +Q  P DH   LA+F+Y+D+K++ KAIKT++E + KWD+  + DR KI+ KAADL+++TYR  L A TMLGQ KT  QAEID+AAELIDF+R N      VTKY+PIS    +  N + +RG +GF AA++PFNFTAIGGNL+ +PALMGN VLWKP+D+A+LSN+ I++I+RE+ +P GV+NFVP DGP+FG TIT +P+LAGINFTGSV TF  L + VG N   Y++FPRL GECGGKNFHF+H SAD+++V  ST+RS+FEY GQKCSACSR+YVPES+WP +KE ++    ++KI       +F SAVID  AF RI  YI++A  +  L I  GG   DS GYF++PTI+ + DP D+IM EEIFGPVL++YVY +S +  T+ LV ++T + LTGA+F  DE FV+ A  + + + GN YIN +STGSVVGQQPFGG R+SGTNDKAGGP+Y+L++ S QS+K    P
Sbjct:   24 TRCLGSVIPDLKLKDFPIAN----------EPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQSIKETFVP 563          
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Match: P5CDh1 (gene:FBgn0037138 transcript:FBtr0078445)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 296/550 (53.82%), Postives = 393/550 (71.45%), Query Frame = 1
Query:  139 TKILNAVVN--KLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            T+ L +V+   KLK F +AN          E IL Y + SKER  LE  L    +   ++PI IG +E K+ ++ +Q  P DH   LA+F+Y+D+K++ KAIKT++E + KWD+  + DR KI+ KAADL+++TYR  L A TMLGQ KT  QAEID+AAELIDF+R N      VTKY+PIS    +  N + +RG +GF AA++PFNFTAIGGNL+ +PALMGN VLWKP+D+A+LSN+ I++I+RE+ +P GV+NFVP DGP+FG TIT +P+LAGINFTGSV TF  L + VG N   Y++FPRL GECGGKNFHF+H SAD+++V  ST+RS+FEY GQKCSACSR+YVPES+WP +KE ++    ++KI       +F SAVID  AF RI  YI++A  +  L I  GG   DS GYF++PTI+ + DP D+IM EEIFGPVL++YVY +S +  T+ LV ++T + LTGA+F  DE FV+ A  + + + GN YIN +STGSVVGQQPFGG R+SGTNDKAGGP+Y+L++ S QS+K    P
Sbjct:   24 TRCLGSVIPDLKLKDFPIAN----------EPILGYLKDSKERKALEQALKGTASSCEDIPIVIGGKEYKTPEVRYQVMPHDHQHKLASFYYADKKLIEKAIKTAVETQPKWDRVSIADRLKIWEKAADLMATTYRQDLNAATMLGQSKTAIQAEIDSAAELIDFIRMNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNGVLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVPTFNRLWKQVGNNIDNYVNFPRLTGECGGKNFHFIHASADVESVVTSTIRSAFEYCGQKCSACSRMYVPESLWPQIKEGLVCEAAKLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTSTKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAGGPHYILRWTSPQSIKETFVP 563          
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Match: aldh4a1 (aldehyde dehydrogenase 4 family, member A1 [Source:NCBI gene;Acc:394133])

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 298/555 (53.69%), Postives = 398/555 (71.71%), Query Frame = 1
Query:  142 KILNAVVNKLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            ++ +AV    K F   +  A+E +  NE +L +K+GSKER +LE  L     KT E+P  IG+EE+ +  I  Q  PF+H   +A F Y+D+ +LNKAI+ S+ AR +WD  P+ DRA+IF KAAD+IS   R  ++A TM+GQGKT+ QAEIDAA ELIDF RFN + A  +   +P+   G  N +++RG EGF AA+ PFNFTAIGGNLA +PALMGN VLWKP+D+A+ ++Y +Y+ILRES LPP +I FVP DGP+FG T+T + +LAGINFTGSV TF+ L + V +N   Y +FPR+ GECGGKNFHFVH+SAD+ +V   T+RS+FEY GQKCSACSR+YVP+S+WP +++ ++ +  Q+K+  P+    TFFSAVID  +F+RIK ++++A ++  L I  GG CDD  GYF+ PTII T+DP +KIM EEIFGPVL VYVYP++  +  L L+D+T+PY LTGAIFS D+  +E A   LR++ GN YIN +STGS+V QQPFGG+R SGTNDK GGP+YVL++ S Q VK    P   WK  +M
Sbjct:    3 RVRSAVSQSWKGFKTFSCAAVEVK--NEPVLGFKEGSKERAELEEALRNLKGKTEEIPCVIGNEEVWTKDIRFQLSPFNHSHQVAKFCYADKDLLNKAIEASVAARREWDLKPVSDRAQIFFKAADIISGPKRAEVLAKTMIGQGKTVVQAEIDAAPELIDFFRFNAKHAIELEDQQPLDSDGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRLWKQVAQNLDIYRNFPRVAGECGGKNFHFVHKSADVRSVVTGTIRSAFEYGGQKCSACSRMYVPDSLWPQIRQGLLDVHKQIKVGDPVEDFSTFFSAVIDDKSFSRIKGWLEHARSSPHLKIIAGGNCDDKKGYFVEPTIIETTDPQEKIMNEEIFGPVLTVYVYPENDYKKVLHLIDNTSPYALTGAIFSQDKSVIEEAGKALRNAAGNYYINDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVKQTHVPLTEWKYPYM 555          
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Match: eef1a1l1 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 435.261 bits (1118), Expect = 2.028e-143
Identity = 204/274 (74.45%), Postives = 237/274 (86.50%), Query Frame = -2
Query: 1959 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKA 2780
            +KK+GYNP SVAFVPISGW GDNM+  S+NM WFKGW I+RK G      + SG TLL+A+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHES+ EA PGDNVGFNVKNVSVKDI+RGNV  DSKN P + A +F AQVI++NHPGQI +GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AI+ M+P KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V+KKA
Sbjct:  178 IKKIGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEG------NASGTTLLDALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAANFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKALKSGDAAIILMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKAVDKKA 445          
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Match: eef1a1l1 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 433.721 bits (1114), Expect = 7.019e-143
Identity = 205/273 (75.09%), Postives = 235/273 (86.08%), Query Frame = -2
Query: 1962 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKK 2780
            +KK+GYNP SVAFVPISGW GDNM+  S+NM WFKGW I+RK G      + SG TLL+A+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHES+ EA PGDNVGFNVKNVSVKDI+RGNV  DSKN P + A +F AQVI++NHPGQI +GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV MVP KPMCVE+F  +PPLGRFAVRDM+QTVAVGVIK+V KK
Sbjct:  178 IKKIGYNPASVAFVPISGWHGDNMLEASSNMGWFKGWKIERKEG------NASGTTLLDALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPANVTTEVKSVEMHHESLTEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAANFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKALKSGDAAIVEMVPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVEKK 444          
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Match: eef1a1b (eukaryotic translation elongation factor 1 alpha 1b [Source:ZFIN;Acc:ZDB-GENE-050417-327])

HSP 1 Score: 433.335 bits (1113), Expect = 9.676e-143
Identity = 203/273 (74.36%), Postives = 233/273 (85.35%), Query Frame = -2
Query: 1962 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKK 2780
            +KK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK+G++      SG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPG+VV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKDI+RGNV  DSKN P   A  F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV M+P KPMCVE+F E+PPLGRFAVRDM+QTVAVGVIK V KK
Sbjct:  178 IKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVEKK 444          
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Match: eef1a1l2 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 433.335 bits (1113), Expect = 9.676e-143
Identity = 203/273 (74.36%), Postives = 233/273 (85.35%), Query Frame = -2
Query: 1962 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKK 2780
            +KK+GYNPD+VAFVPISGW GDNM+  S NM WFKGW I RK+G++      SG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPG+VV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKDI+RGNV  DSKN P   A  F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV M+P KPMCVE+F E+PPLGRFAVRDM+QTVAVGVIK V KK
Sbjct:  178 IKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS------SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVEKK 444          
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:100124732])

HSP 1 Score: 461.455 bits (1186), Expect = 2.653e-152
Identity = 243/533 (45.59%), Postives = 326/533 (61.16%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            E  NE IL ++ GS ER  L+  L E    T E+P  +G EE+ +  + +Q  PF H   +A + Y+D+++LNKAI  ++  R +WD  P++DRA+IF KAADL+S   R  ++A TM+GQGKT  QAEIDAAAELIDF RFN + A  +T  +PIS     N +V+RG E     +   N  +      A P               I +     RI      PP   N+     PL       NPN        +V+    L + V +N   Y +FPRL GECGGKNFHF+H SAD+++    T+RS+FEY GQKCSACSRLYVP+S+WP +K +++    ++K+  P     +FFSAVID+ +F RI+ +I +A ++  L I  GGKCDDS GY++ PTII + +P +KIM EEIFGPVLAVYVYP+S     L L+DST+PYGLTGA+F+ D+  +  A   LRH+ GN YIN +STG+VV QQPFGGSR SGTNDK GGP+Y+L++ S Q VK    P   WK  +M+
Sbjct:   39 EVKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCYADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEIDAAAELIDFFRFNAKYALELTHEQPISIPVSTNSMVYRGLE-----VRDANCNS--ETQGAEPE--------------ICNGVPRARISTHPKSPP---NWPSGWAPL-------NPNPISSWLLCAVH----LWKQVAQNLDVYRTFPRLAGECGGKNFHFIHASADVESTVNGTIRSAFEYGGQKCSACSRLYVPDSLWPRIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAGGKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVFAQDKNVLREATQILRHTAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGGPHYILRWTSPQVVKETHVPLTEWKYPYMQ 536          
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:100124732])

HSP 1 Score: 457.988 bits (1177), Expect = 3.128e-151
Identity = 239/533 (44.84%), Postives = 325/533 (60.98%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            E  NE IL ++ GS ER  L+  L E    T E+P  +G EE+ +  + +Q  PF H   +A + Y+D+++LNKAI  ++  R +WD  P++DRA+IF KAADL+S   R  ++A TM+GQGKT  QAEIDAAAELIDF RFN + A  +T  +PIS     N +V+RG E     +   N  +      A P +                          + +P   I+  P   P +      NPN        +V+    L + V +N   Y +FPRL GECGGKNFHF+H SAD+++    T+RS+FEY GQKCSACSRLYVP+S+WP +K +++    ++K+  P     +FFSAVID+ +F RI+ +I +A ++  L I  GGKCDDS GY++ PTII + +P +KIM EEIFGPVLAVYVYP+S     L L+DST+PYGLTGA+F+ D+  +  A   LRH+ GN YIN +STG+VV QQPFGGSR SGTNDK GGP+Y+L++ S Q VK    P   WK  +M+
Sbjct:   30 EVKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCYADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEIDAAAELIDFFRFNAKYALELTHEQPISIPVSTNSMVYRGLE-----VRDANCNS--ETQGAEPEIC-------------------------NGVPRAQISTHPKSPPNWPSG--WNPNPISSWLLCAVH----LWKQVAQNLDVYRTFPRLAGECGGKNFHFIHASADVESTVNGTIRSAFEYGGQKCSACSRLYVPDSLWPRIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAGGKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVFAQDKNVLREATQILRHTAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGGPHYILRWTSPQVVKETHVPLTEWKYPYMQ 524          
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:100124732])

HSP 1 Score: 447.973 bits (1151), Expect = 1.249e-147
Identity = 234/537 (43.58%), Postives = 318/537 (59.22%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRIL--RESNLPPGVINFVP--CDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            E  NE IL ++ GS ER  L+  L E    T E+P  +G EE+ +  + +Q  PF H   +A + Y+D+++LNKAI  ++  R +WD  P++DRA+IF KAADL+S   R  ++A TM+GQGKT  QAEIDAAAELIDF RFN + A  +T                                                   +P    + +N  +YR L  R++N         P  C+G      +  NPN        +V+    L + V +N   Y +FPRL GECGGKNFHF+H SAD+++    T+RS+FEY GQKCSACSRLYVP+S+WP +K +++    ++K+  P     +FFSAVID+ +F RI+ +I +A ++  L I  GGKCDDS GY++ PTII + +P +KIM EEIFGPVLAVYVYP+S     L L+DST+PYGLTGA+F+ D+  +  A   LRH+ GN YIN +STG+VV QQPFGGSR SGTNDK GGP+Y+L++ S Q VK    P   WK  +M+
Sbjct:   22 EVKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCYADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEIDAAAELIDFFRFNAKYALELTHE-------------------------------------------------QPISIPVSTNSMVYRGLEVRDANCNSETQGAEPEICNG------VPRNPNPISSWLLCAVH----LWKQVAQNLDVYRTFPRLAGECGGKNFHFIHASADVESTVNGTIRSAFEYGGQKCSACSRLYVPDSLWPRIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAGGKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVFAQDKNVLREATQILRHTAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGGPHYILRWTSPQVVKETHVPLTEWKYPYMQ 499          
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:100124732])

HSP 1 Score: 445.277 bits (1144), Expect = 6.651e-147
Identity = 233/537 (43.39%), Postives = 315/537 (58.66%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRIL--RESNLPPGVINFVP--CDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            E  NE IL ++ GS ER  L+  L E    T E+P  +G EE+ +  + +Q  PF H   +A + Y+D+++LNKAI  ++  R +WD  P++DRA+IF KAADL+S   R  ++A TM+GQGKT  QAEIDAAAELIDF RFN + A  +T                                                   +P    + +N  +YR L  R++N         P  C+G  FG     N +L                + V +N   Y +FPRL GECGGKNFHF+H SAD+++    T+RS+FEY GQKCSACSRLYVP+S+WP +K +++    ++K+  P     +FFSAVID+ +F RI+ +I +A ++  L I  GGKCDDS GY++ PTII + +P +KIM EEIFGPVLAVYVYP+S     L L+DST+PYGLTGA+F+ D+  +  A   LRH+ GN YIN +STG+VV QQPFGGSR SGTNDK GGP+Y+L++ S Q VK    P   WK  +M+
Sbjct:   11 EVKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCYADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEIDAAAELIDFFRFNAKYALELTHE-------------------------------------------------QPISIPVSTNSMVYRGLEVRDANCNSETQGAEPEICNG--FGAIWAHNKHL---------------WKQVAQNLDVYRTFPRLAGECGGKNFHFIHASADVESTVNGTIRSAFEYGGQKCSACSRLYVPDSLWPRIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAGGKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVFAQDKNVLREATQILRHTAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGGPHYILRWTSPQVVKETHVPLTEWKYPYMQ 481          
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:100124732])

HSP 1 Score: 444.891 bits (1143), Expect = 1.428e-146
Identity = 233/537 (43.39%), Postives = 315/537 (58.66%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRIL--RESNLPPGVINFVP--CDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            E  NE IL ++ GS ER  L+  L E    T E+P  +G EE+ +  + +Q  PF H   +A + Y+D+++LNKAI  ++  R +WD  P++DRA+IF KAADL+S   R  ++A TM+GQGKT  QAEIDAAAELIDF RFN + A  +T                                                   +P    + +N  +YR L  R++N         P  C+G  FG     N +L                + V +N   Y +FPRL GECGGKNFHF+H SAD+++    T+RS+FEY GQKCSACSRLYVP+S+WP +K +++    ++K+  P     +FFSAVID+ +F RI+ +I +A ++  L I  GGKCDDS GY++ PTII + +P +KIM EEIFGPVLAVYVYP+S     L L+DST+PYGLTGA+F+ D+  +  A   LRH+ GN YIN +STG+VV QQPFGGSR SGTNDK GGP+Y+L++ S Q VK    P   WK  +M+
Sbjct:   24 EVKNEPILEFRSGSAERAALQQALHELKATTEEIPCVVGGEEVWTKDVRYQVSPFKHSHRVAKYCYADKELLNKAINAAMGVRKEWDLKPVQDRAQIFFKAADLLSGPRRAEILAKTMIGQGKTAIQAEIDAAAELIDFFRFNAKYALELTHE-------------------------------------------------QPISIPVSTNSMVYRGLEVRDANCNSETQGAEPEICNG--FGAIWAHNKHL---------------WKQVAQNLDVYRTFPRLAGECGGKNFHFIHASADVESTVNGTIRSAFEYGGQKCSACSRLYVPDSLWPRIKARLLEEHAKIKVGDPADDFSSFFSAVIDQKSFRRIQGWISHAQSSPDLAILAGGKCDDSEGYYVQPTIIESKNPKEKIMAEEIFGPVLAVYVYPESNYREVLQLIDSTSPYGLTGAVFAQDKNVLREATQILRHTAGNFYINDKSTGAVVAQQPFGGSRASGTNDKPGGPHYILRWTSPQVVKETHVPLTEWKYPYMQ 494          
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Match: Aldh4a1 (aldehyde dehydrogenase 4 family, member A1 [Source:MGI Symbol;Acc:MGI:2443883])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 384/533 (72.05%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE IL + QGS ER  L+  L +   +   +P  +GDEE+ +  I +Q  PF+H   +A F Y+D+ +LN+AI  +L AR +WD  P+ DRA++FLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGP FG T+T + +L GINFTGSV TF+ L   V +N   + +FPRL GECGGKNFHFVH SAD+D+V   T+RS+FEY GQKCSACSRLYVP+S+WP +K +++   +++K+  P     TFFSAVID  AF RIK ++++A ++  L+I  GG+C++SVGY++ P II + DP + IMKEEIFGPVL VYVYPD     TL LVDSTT YGLTGA+F+ D+  V+ A   LR++ GN YIN +STGSVVGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W+  +M+
Sbjct:   30 KVTNEPILAFSQGSPERDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLQLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ 562          
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 437.573 bits (1124), Expect = 2.361e-144
Identity = 206/274 (75.18%), Postives = 236/274 (86.13%), Query Frame = -2
Query: 1959 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKA 2780
            +KK+GYNPD+VAFVPISGW GDNM+ PS NMPWFKGW + RK+G      S SG TLLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKD++RGNV  DSKN P + A  F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV MVP KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V+KKA
Sbjct:  178 IKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG------SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKA 445          
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Match: Eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:MGI Symbol;Acc:MGI:1096317])

HSP 1 Score: 430.254 bits (1105), Expect = 1.940e-141
Identity = 200/274 (72.99%), Postives = 235/274 (85.77%), Query Frame = -2
Query: 1959 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKA 2780
            +KK+GYNP +V FVPISGW GDNM+ PS NMPWFKGW ++RK G      + SGV+LLEA+D I PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+++PGMVV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKDI+RGNVC DSK  P   A  F +QVI++NHPGQI  GY+PV+DCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV MVP KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIKNV KK+
Sbjct:  178 IKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERKEG------NASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKS 445          
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Match: Aldh1a3 (aldehyde dehydrogenase family 1, subfamily A3 [Source:MGI Symbol;Acc:MGI:1861722])

HSP 1 Score: 155.606 bits (392), Expect = 1.369e-39
Identity = 129/461 (27.98%), Postives = 217/461 (47.07%), Query Frame = 1
Query:  409 SDEKILNKAIKTSLEARDK---WDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTE--GFWAAITPFNFTAIGGNLAASPALM-GNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGD-EKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQI 1770
             D+  ++KA++ +  A  +   W +     R ++  + ADL+    R  L     +  GK    A        I   R+    A  + + R I PT   N V +   E  G   AITP+NF  +      +PAL  GN+V+ KP +   L+   +  +++E   PPGV+N VP  GP  G  I+ +P +  I FTGS    +++ EA  ++     +  R+  E GGKN   V   AD+D       +  F   GQ C+A SR++V E ++ +   + +    +  +  P    T     ID+  F++I   I+ +       +E GG   +  G FI PT+        +I KEEIFGPV  +  + +  +E  +   +ST  YGLT A+F+ + +K ++ A       +G ++IN  +  +   Q PFGG ++SG N +  G Y + ++  +++V I++
Sbjct:   66 GDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLADLVERD-RAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAGWADKI-QGRTI-PTD-DNVVCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVREAASRS-----NLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRPVGDPFDAKTEQGPQIDQKQFDKILELIE-SGKKEGAKLECGGSAMEDRGLFIKPTVFSDVTDNMRIAKEEIFGPVQPILKFKN--LEEVIKRANSTD-YGLTAAVFTKNLDKALKLAAA---LESGTVWINCYN--AFYAQAPFGGFKMSG-NGRELGEYALAEYTEVKTVTIKL 507          
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Match: Aldh1a1 (aldehyde dehydrogenase family 1, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353450])

HSP 1 Score: 152.525 bits (384), Expect = 1.096e-38
Identity = 126/465 (27.10%), Postives = 217/465 (46.67%), Query Frame = 1
Query:  409 SDEKILNKAIKTSLEA---RDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTM--LGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPAL-MGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQS 1785
             D+  ++KA+K + +A      W      +R ++  K ADL+    R  L+  TM  L  GK    A +      I  L++    A  +   + I   G I     R   G    I P+NF  +       PAL  GN+V+ KP +   L+   +  +++E+  PPGV+N VP  GP  G  I+ + ++  + FTGS    +++ EA GK+     +  R+  E GGK+   V   AD+D          F + GQ C A SR++V ES++ +  ++ +    +  + +PL         IDK   ++I   I+ +       +E GG    + G+F+ PT+        +I KEEIFGPV  +  +   ++++ +   ++TT YGL   +F+ D        + L+   G +++N     S   Q PFGG ++SG N +  G + + ++  L++V ++I+   S
Sbjct:   55 GDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLME---RDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHG-QTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKS-----NLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIE-SGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKF--KSVDDVIKRANNTT-YGLAAGLFTKDLDKAITVSSALQ--AGVVWVNCYMMLSA--QCPFGGFKMSG-NGRELGEHGLYEYTELKTVAMKISQKNS 501          
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Match: sp|A7YWE4|AL4A1_BOVIN (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ALDH4A1 PE=2 SV=1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 298/562 (53.02%), Postives = 396/562 (70.46%), Query Frame = 1
Query:  127 IMQRTKILNAVVNKLKRFS-LANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +++   +  A++ +  R + L        +  NE +L + QGS ER  L+  L E   +T  +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +L++AI  +L AR +WD  P+ DRA++FLKAADL+S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +P+S     N +++RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGP FG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+D+V   T+RS+FEY GQKCSACSRLY P S+WP +K +++  L  +K+ +P     TFFSAVID  +F RI+ ++++A ++  LTI  GG CDDSVGYF+ P I+ T DP D IMKEEIFGPVLAVYVYPD   + TL LVDSTT YGLTGA+F+ D+  +  A   LRH+ GN YIN +STGSVVGQQPFGG+R SGTNDK GGP+YVL++ S Q +K    P   W+  +M+
Sbjct:    2 LLRSAALCRALLARRGRAAGLCRRCVSSLQVANEPVLAFTQGSPERDALQKALKELKGRTEAIPCVVGDEEVWTSDVRYQASPFNHGHKVAKFCYADKALLHRAIGAALAARKEWDLKPVADRAQVFLKAADLLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAMELEGEQPLSVPPSTNSMLYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFRTFPRLAGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYAPRSLWPQIKGRLLEELGGIKVGNPAEDFGTFFSAVIDAKSFGRIRKWLEHARSSPSLTILAGGHCDDSVGYFVEPCIVETKDPQDPIMKEEIFGPVLAVYVYPDEEYKETLRLVDSTTSYGLTGAVFAQDKDVLREATELLRHAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYVLRWTSPQVIKETHGPLGDWRYPYMQ 563          
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Match: sp|P30038|AL4A1_HUMAN (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH4A1 PE=1 SV=3)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 295/533 (55.35%), Postives = 387/533 (72.61%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE +L + QGS ER  L+  L +   +   +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ +L AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGPLFG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+++V   T+RS+FEY GQKCSACSRLYVP S+WP +K +++   +++K+  P     TFFSAVID  +F RIK ++++A ++  LTI  GGKCDDSVGYF+ P I+ + DP + IMKEEIFGPVL+VYVYPD   + TL LVDSTT YGLTGA+FS D+  V+ A   LR++ GN YIN +STGS+VGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W   +M+
Sbjct:   31 KVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSACSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGKCDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYAYMQ 563          
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Match: sp|Q7SY23|AL4A1_DANRE (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=aldh4a1 PE=2 SV=1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 297/552 (53.80%), Postives = 395/552 (71.56%), Query Frame = 1
Query:  151 NAVVNKLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            +AV    K F   +  A+E +  NE +L +K+GSKER +LE  L     KT E+P  IG+EE+ +  I  Q  PF+H   +A F Y+D+ +LNKAI+ S+ AR +WD  P+ DRA+IF KAAD+IS   R  ++A TM+GQGKT+ QAEIDAA ELIDF RFN + A  +   +P+   G  N +++RG EGF AA+ PFNFTAIGGNLA +PALMGN VLWKP+D+A+ ++Y +Y+ILRES LPP +I FVP DGP+FG T+T + +LAGINFTGSV TF+ L + V +N   Y +FPR+ GECGGKNFHFVH+SAD+ +V   T+RS+FEY GQKCSACSR+YVP+S+WP +++ ++ +  Q+K+  P+    TFFSAVID  +F+RIK ++++A ++  L I  GG CDD  GYF+ PTII T+DP +KIM EEIFGPVL VYVYP++  +  L L+D+T+PY LTGAIF  D+  +E A   LR++ GN YIN +STGS+V QQPFGG+R SGTNDK GGP+YVL++ S Q VK    P   WK  +M
Sbjct:    6 SAVSQSWKGFKTFSCVAVEVK--NEPVLEFKEGSKERAELEEALRNLKGKTEEIPCVIGNEEVWTKDIRFQLSPFNHSHQVAKFCYADKDLLNKAIEASVAARREWDLKPVSDRAQIFFKAADIISGPKRAEVLAKTMIGQGKTVVQAEIDAAPELIDFFRFNAKHAIELEDQQPLDSDGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRLWKQVAQNLDIYKNFPRVAGECGGKNFHFVHKSADVRSVVTGTIRSAFEYGGQKCSACSRMYVPDSLWPQIRQGLLDVYKQIKVGDPVEDFSTFFSAVIDDKSFSRIKGWLEHARSSPHLKIIAGGNCDDKKGYFVEPTIIETTDPQEKIMNEEIFGPVLTVYVYPENDYKKVLHLIDNTSPYALTGAIFPQDKSVIEEAGKALRNAAGNYYINDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVKQTHVPLTEWKYPYM 555          
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Match: sp|Q8CHT0|AL4A1_MOUSE (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh4a1 PE=1 SV=3)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 292/533 (54.78%), Postives = 384/533 (72.05%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            +  NE IL + QGS ER  L+  L +   +   +P  +GDEE+ +  I +Q  PF+H   +A F Y+D+ +LN+AI  +L AR +WD  P+ DRA++FLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N  V+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP +I FVP DGP FG T+T + +L GINFTGSV TF+ L   V +N   + +FPRL GECGGKNFHFVH SAD+D+V   T+RS+FEY GQKCSACSRLYVP+S+WP +K +++   +++K+  P     TFFSAVID  AF RIK ++++A ++  L+I  GG+C++SVGY++ P II + DP + IMKEEIFGPVL VYVYPD     TL LVDSTT YGLTGA+F+ D+  V+ A   LR++ GN YIN +STGSVVGQQPFGG+R SGTNDK GGP+Y+L++ S Q +K    P   W+  +M+
Sbjct:   30 KVTNEPILAFSQGSPERDALQKALKDLKGQMEAIPCVVGDEEVWTSDIQYQLSPFNHAHKVAKFCYADKALLNRAIDAALAARKEWDLKPMADRAQVFLKAADMLSGPRRAEVLAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWRQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPKSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLQLVDSTTSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ 562          
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Match: sp|P0C2X9|AL4A1_RAT (Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh4a1 PE=1 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 290/543 (53.41%), Postives = 384/543 (70.72%), Query Frame = 1
Query:  184 LANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIK-DTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPN-QSWKQIHME 1806
            L    A   +  NE IL + QGS ER  L+  L++  ++T  +P  +GDEE+ +  + +Q  PF+H   +A F Y+D+ +LNKAI+ ++ AR +WD  P+ DRA+IFLKAAD++S   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  +   +PIS     N VV+RG EGF AAI+PFNFTAIGGNLA +PALMGN VLWKP+D+A+L++Y +YRILRE+ LPP VI FVP DGP FG T+T + +L GINFTGSV TF+ L + V +N   + +FPRL GECGGKNFHFVH SAD+D+V   T+RS+FEY GQKCSACSRLYVP+S+WP +K +++   +++K+ +P     TFFSAVID  AF RIK ++++A ++  L+I  GG+C++SVGYF+ P II + DP + IMKEEIFGPVL VYVYPD     TL LVDSTT YGLTGA+F+ D+  V+ A   LR++ GN YIN +STGSVVGQQPFGG+R SG  D  G P  V  +       + ++P    W+  +M+
Sbjct:   21 LRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVVGDEEVWTSDVRYQLSPFNHGHKVAKFCYADKALLNKAIEAAVLARKEWDLKPVADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELEGEQPISVPPSTNHVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNVIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPQSLWPQIKGRLLEEHSRIKVGNPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNESVGYFVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDEKYRETLQLVDSTTSYGLTGAVFAQDKTIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGERDIPGQPRLVQLWTEPPFTPLAVSPPLGDWRYSYMQ 563          
BLAST of Multifunctional fusion protein vs. TrEMBL
Match: A0A210PKZ4 (Multifunctional fusion protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21320 PE=3 SV=1)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 317/534 (59.36%), Postives = 404/534 (75.66%), Query Frame = 1
Query:  208 YEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVI--NEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            Y AVNE +  Y  GSKE+ +L+  L++Y N   ++PI IGDEE++++Q+ HQ  PFDH KT+A F Y+   ++ K I TSL  R  W++ PL +RA+IFLKAADL+S  YR  L+ATTM+GQ K + QAEIDAAAELIDFLRFN Q A  +T+Y+P+SPT  I  N  V+RG EGFWAAITPFNFTAIGG+LA++PA+MGN   WKP+D+A+LSNYT+++I RE+ +P GVINFVP DGP+FG TIT + +LAGINFTGSV TF  L + VG+N   + ++PRLIGECGGKNFHFVH +AD+D+V   TVRS+FE+ GQKCSACSR Y+P S+WP +KE MI I  Q+K+ SPL  DTF SAVID  +FNRIK Y+D+A  +  L +  GG CDDS GYF+ PTII TSDP DKIM+EEIFGPV+AVYVYPD+  +    +V  T+P+ LTGAI++ +E   +     L+ S GN YIN +STGSVVGQQPFGG+RLSGTNDKAGGP+Y+LKF S+QSVK  + P++ W+   M
Sbjct:   28 YVAVNEPMPEYAPGSKEKKELDACLAKYQNHVEDIPIVIGDEEIRTNQVHHQVAPFDHQKTIAKFTYASADLIQKGIDTSLRVRRDWERRPLYERAEIFLKAADLMSGKYRMDLLATTMMGQAKNVVQAEIDAAAELIDFLRFNAQFAQDITRYQPLSPTANITKNSTVYRGMEGFWAAITPFNFTAIGGHLASAPAMMGNVCQWKPSDTAMLSNYTVFKIFREAGVPAGVINFVPADGPVFGNTITSSHDLAGINFTGSVKTFHHLWKQVGQNLENFRTYPRLIGECGGKNFHFVHPTADVDSVVNGTVRSAFEFGGQKCSACSRAYIPASLWPKIKEGMINIHKQIKVGSPLDNDTFLSAVIDDKSFNRIKGYLDHAKTSPNLKVVAGGSCDDSKGYFVEPTIIETSDPKDKIMQEEIFGPVVAVYVYPDNKYKEVTKMVTETSPFALTGAIYAQEENVKQELVEMLKDSAGNFYINDKSTGSVVGQQPFGGARLSGTNDKAGGPHYLLKFVSVQSVKETMVPSKEWRYPSM 561          
BLAST of Multifunctional fusion protein vs. TrEMBL
Match: C1LG62 (Multifunctional fusion protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 316/533 (59.29%), Postives = 407/533 (76.36%), Query Frame = 1
Query:  208 YEAVNENILTYKQGSKERIQLENTLSEY-INKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            ++AVNE +L YK GS ER++L++TL    +     VPICIG  EL S+    Q +PF+H KTLANF+Y+ E+ +N AI++ L ARD W +T   +RAKIFLKAADLISS +R  L+A+T+LGQ KTIFQAEIDAAAEL DFLRFN Q A+    YRPI+    IN+VV+R  EGFWAAI PFNFTAI GNL ++PALMGN+V+WKP+D+A+ SNY +YR+ R++ LPPGVINFVP DGP FGK +  +P LAGINFTGS +T+R +L+ +G N   +  +PR IGECGGKN+HF+H SA+++  +L T+RS+FEY+GQKCSACSRLYVP+S+WP  K  ++   NQ+KI SPL  DTF SAVID  AFN+I +Y+ YAS++    +  GG  DDS+GYFI PTI+ T +P DK+MK+++FGP++  Y+Y +  IE TLDL+D+TT Y LTG+IF+ DEKF+ YA ++L ++ GN Y+NVQSTGSVVGQQPFGG+RLSGTNDKAGGP YVL+F S  S+K QI P  SWKQ HM
Sbjct:   24 FKAVNEPVLLYKPGSMERLRLDSTLGTMKLTAPHRVPICIGSSELSSEHPRKQVWPFEHSKTLANFYYASEEQINSAIQSCLAARDSWSRTSFDERAKIFLKAADLISSEHREELLASTILGQAKTIFQAEIDAAAELADFLRFNVQFASEALLYRPINTKDAINKVVYRPNEGFWAAIPPFNFTAIAGNLVSAPALMGNAVIWKPSDTAVYSNYLVYRLFRKAGLPPGVINFVPADGPTFGKIVCKHPQLAGINFTGSTSTYRTILKMIGSNLDIFRGYPRTIGECGGKNYHFIHPSANLEEAALGTIRSAFEYSGQKCSACSRLYVPKSLWPRFKHLLLDHYNQLKIGSPLDSDTFTSAVIDHAAFNKISNYLRYASSSPDTEVIAGGHGDDSIGYFIQPTILLTKNPTDKLMKDDVFGPIVCTYLYDEKEIEKTLDLIDTTTDYALTGSIFAQDEKFITYASDRLINTAGNFYVNVQSTGSVVGQQPFGGARLSGTNDKAGGPQYVLRFTSPLSIKTQIKPIPSWKQAHM 556          
BLAST of Multifunctional fusion protein vs. TrEMBL
Match: A0A4Z2DSL8 (Multifunctional fusion protein OS=Schistosoma japonicum OX=6182 GN=EWB00_008750 PE=3 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 316/533 (59.29%), Postives = 407/533 (76.36%), Query Frame = 1
Query:  208 YEAVNENILTYKQGSKERIQLENTLSEY-INKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            ++AVNE +L YK GS ER++L++TL    +     VPICIG  EL S+    Q +PF+H KTLANF+Y+ E+ +N AI++ L ARD W +T   +RAKIFLKAADLIS+ +R  L+A+T+LGQ KTIFQAEIDAAAEL DFLRFN Q A+    YRPI+    IN+VV+R  EGFWAAI PFNFTAI GNL ++PALMGN+V+WKP+D+A+ SNY +YR+ R++ LPPGVINFVP DGP FGK +  +P LAGINFTGS +T+R +L+ +G N   +  +PR IGECGGKN+HF+H SA+++  +L T+RS+FEY+GQKCSACSRLYVP+S+WP  K  ++   NQ+KI SPL  DTF SAVID  AFN+I +Y+ YAS++    +  GG  DDS+GYFI PTI+ T +P DK+MK++IFGP++  Y+Y +  IE TLDL+D+TT Y LTG+IF+ DEKF+ YA ++L ++ GN Y+NVQSTGSVVGQQPFGG+RLSGTNDKAGGP YVL+F S  S+K QI P  SWKQ HM
Sbjct:   24 FKAVNEPVLLYKSGSMERLRLDSTLGTMKLTAPHRVPICIGSSELSSEHPRKQVWPFEHSKTLANFYYASEEQINSAIQSCLAARDSWSRTSFDERAKIFLKAADLISNEHREELLASTILGQAKTIFQAEIDAAAELADFLRFNVQFASEALLYRPINTKDAINKVVYRPNEGFWAAIPPFNFTAIAGNLVSAPALMGNAVIWKPSDTAVYSNYLVYRLFRKAGLPPGVINFVPADGPTFGKIVCKHPQLAGINFTGSTSTYRTILKMIGSNLDIFRGYPRTIGECGGKNYHFIHPSANLEEAALGTIRSAFEYSGQKCSACSRLYVPKSLWPRFKHLLLDHYNQLKIGSPLDSDTFTSAVIDHAAFNKISNYLRYASSSPDTEVIAGGHGDDSIGYFIQPTILLTKNPTDKLMKDDIFGPIVCTYLYDEKEIEKTLDLIDTTTDYALTGSIFAQDEKFITYASDRLINTAGNFYVNVQSTGSVVGQQPFGGARLSGTNDKAGGPQYVLRFTSPLSIKTQIKPIPSWKQAHM 556          
BLAST of Multifunctional fusion protein vs. TrEMBL
Match: A0A1I8HPQ7 (Multifunctional fusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018145g1 PE=3 SV=1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 316/527 (59.96%), Postives = 395/527 (74.95%), Query Frame = 1
Query:  208 YEAVNENILTYKQGSKERIQLENTLSEYI-NKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPL-IKDTFFSAVIDKNAFNRIKSYIDY--ASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAP 1776
            YEA NE  L Y QGSKER  +E  LS++  + T+++PICIGD E+  D    Q  PFDH +TLA F Y+   ++ +AI   LEAR++W+ TP ++RAK+ L+AAD+++   R ++VA TMLGQ KT++QAEIDAAAELIDFLRFN    A + +Y+PIS     N +V+RG EGFWAA+TPFNFTAIGGNLAASPA  GNS +WKPTDSA+LSNY  Y++LRE+ LPPGV+NFVP DGP FG  IT  P LAG+NFTGSV TFR +   V  N   Y +FPRLIGECGGKNFHFVH SAD++ V+ ST+RS++EY+GQKCSACSRLYVP S+WP L+++++ +   +K  SPL I  TF SAVID  AF R+  Y      S++  L +  GGKCDDSVGYF+ PTII T DP  +IM+EEIFGPVLAVY YPD+ ++  L+LVDST+PY LTGA+FS DE+FV+ A  +LR +TGN YINVQSTGSVVGQQPFGG+R SGTNDKAGGP+Y+LKF S  ++K    P
Sbjct:   38 YEAKNEPALEYTQGSKERKDVEAALSKFASDGTIKIPICIGDREIHLDGAKRQVAPFDHKRTLATFDYAPPALIQEAIDNCLEARERWEATPWEERAKVMLRAADMLAGPMRANIVAATMLGQAKTVYQAEIDAAAELIDFLRFNVGNMAKLAQYQPISTKTAENTMVYRGMEGFWAAVTPFNFTAIGGNLAASPAFAGNSTVWKPTDSALLSNYLAYKVLREAGLPPGVVNFVPADGPQFGAEITKRPELAGVNFTGSVPTFRSIWSGVAANLANYRTFPRLIGECGGKNFHFVHPSADLEQVANSTIRSAYEYSGQKCSACSRLYVPASMWPKLRDRLLELRASLKFGSPLDIGSTFSSAVIDDKAFRRVSGYASELPKSDSANLQLLGGGKCDDSVGYFVEPTIIETRDPRHRIMQEEIFGPVLAVYAYPDNQVDEALNLVDSTSPYALTGAVFSTDEEFVKLASRRLRQATGNFYINVQSTGSVVGQQPFGGARQSGTNDKAGGPHYLLKFLSPMAIKRATKP 564          
BLAST of Multifunctional fusion protein vs. TrEMBL
Match: K1RGD1 (Multifunctional fusion protein OS=Crassostrea gigas OX=29159 GN=CGI_10003285 PE=3 SV=1)

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 311/538 (57.81%), Postives = 403/538 (74.91%), Query Frame = 1
Query:  181 SLANNEALE-YEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPT-GVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSW 1788
            SL  N   E + A NE + +Y   S ER QL   L++Y + T ++PI IGDEE ++  + +Q  PFDH K  A F+Y+   I+ KAI  SL+AR +W+ TPL+ RA+IF+ AA++IS   R  ++ATTMLGQ K I+QAEIDAAAEL+DFLRFN Q +  +T+Y+P+SP+  V N  ++RG EGFWAAITPFNFTAIGG+L ++PALMGN  LWKP+D+A+LSNYT+++I RE+ LPPGVINFVP DGP+FG  IT +P+LAG+NFTGSV TF+ + + V +N   Y+S+PRLIGECGGKNFHFVH+SAD+ +V++ TVRS+FEY GQKCSACSR+Y+P+S+WP++K+KM+ IL ++++ SPL    F SAVID  AFNRIKSYI+YA N+  L+I  GGKCDDS GYF+ PT+I TSDP DKIM+EEIFGPVL+V+ YPD        +   T+P+ LTGAIF  D    E   +  R S GN YIN +STGSVVGQQPFGG RLSGTNDKAGGP+Y++KF S++ VK    P + W
Sbjct:   25 SLIQNYDFESFVAANEPMPSYGPDSPERKQLYEALNKYKDTTTDIPIVIGDEEFRTKDVRYQVMPFDHQKKTAKFYYATPDIIQKAIDNSLKARKQWELTPLEKRAEIFMTAAEMISKQKRMDVMATTMLGQAKNIWQAEIDAAAELVDFLRFNCQFSRDITRYQPLSPSESVNNSAIYRGCEGFWAAITPFNFTAIGGHLCSAPALMGNVSLWKPSDTAMLSNYTVFKIFREAGLPPGVINFVPADGPVFGDVITKSPHLAGVNFTGSVRTFKTIWKLVAQNLDNYVSYPRLIGECGGKNFHFVHKSADVKSVAVGTVRSAFEYGGQKCSACSRMYIPQSMWPEVKQKMLDILKEIQLGSPLDNKIFLSAVIDDKAFNRIKSYIEYAKNSPNLSIVAGGKCDDSQGYFVQPTVIETSDPQDKIMQEEIFGPVLSVFPYPDDEYFKYAQMASKTSPFALTGAIFVKDSVAREELVDTFRESAGNFYINDKSTGSVVGQQPFGGDRLSGTNDKAGGPHYLMKFVSVKCVKETKTPLKEW 562          
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:103033203])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 294/533 (55.16%), Postives = 393/533 (73.73%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKD--TFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            E  NE IL +++GSKER +LE  L +   KT E+P  +GDE++ +  I +Q  PF+H   +A F Y+D+ +LNKAI  S+ AR +WD  P+ DRA+I  KAAD IS   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  + + +P+   G  N +++RG EGF AA+ PFNFTAIGGNLA +PALMGN VLWKP+D+A+ ++Y +Y+ILRES LPP +I FVP DGP+FG T+T + +LAGINFTGSV TF+ L + VG+N   Y +FPR+ GECGGKNFHFVH+SAD+ +V+  T+RS+FEY GQKCSACSR+YVP+S+WP +K++++ I  Q+K+  P ++D  TFFSAVID+ +F+RIK ++++A  +  LT+  GG CDD  GY++ PTII T DP DKIM EEIFGPVL VYVYP++  +  L L+DST+PY LTGA+F+ D+  V+ A   LR++ GN Y+N +STGS+V QQPFGG+R SGTNDK GGP+YVL++ S Q VK    P   WK  +M
Sbjct:   24 EVKNEPILGFREGSKERAELEKALQDLKGKTEEIPCVVGDEQVWTKDIRYQLSPFNHSHKVAKFCYADKDLLNKAILASVAARREWDLKPVADRAQILFKAADAISGPRRAEVLAKTMIGQGKTVVQAEIDAAAELIDFFRFNAKHAIELEQQQPLDSDGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRLWKQVGQNLDIYRNFPRVAGECGGKNFHFVHKSADVHSVATGTIRSAFEYGGQKCSACSRMYVPDSLWPQIKQELLDIHKQIKLGDP-VEDFGTFFSAVIDEKSFSRIKGWLNHAKTSPSLTVIAGGNCDDKKGYYVEPTIIETKDPKDKIMNEEIFGPVLTVYVYPENDYKKVLSLIDSTSPYALTGAVFAKDKSVVDEAAKVLRNAAGNYYVNDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVKETHVPLTDWKYPYM 555          
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:103033203])

HSP 1 Score: 632.484 bits (1630), Expect = 0.000e+0
Identity = 294/533 (55.16%), Postives = 393/533 (73.73%), Query Frame = 1
Query:  211 EAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKD--TFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            E  NE IL +++GSKER +LE  L +   KT E+P  +GDE++ +  I +Q  PF+H   +A F Y+D+ +LNKAI  S+ AR +WD  P+ DRA+I  KAAD IS   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  + + +P+   G  N +++RG EGF AA+ PFNFTAIGGNLA +PALMGN VLWKP+D+A+ ++Y +Y+ILRES LPP +I FVP DGP+FG T+T + +LAGINFTGSV TF+ L + VG+N   Y +FPR+ GECGGKNFHFVH+SAD+ +V+  T+RS+FEY GQKCSACSR+YVP+S+WP +K++++ I  Q+K+  P ++D  TFFSAVID+ +F+RIK ++++A  +  LT+  GG CDD  GY++ PTII T DP DKIM EEIFGPVL VYVYP++  +  L L+DST+PY LTGA+F+ D+  V+ A   LR++ GN Y+N +STGS+V QQPFGG+R SGTNDK GGP+YVL++ S Q VK    P   WK  +M
Sbjct:   24 EVKNEPILGFREGSKERAELEKALQDLKGKTEEIPCVVGDEQVWTKDIRYQLSPFNHSHKVAKFCYADKDLLNKAILASVAARREWDLKPVADRAQILFKAADAISGPRRAEVLAKTMIGQGKTVVQAEIDAAAELIDFFRFNAKHAIELEQQQPLDSDGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPALMGNVVLWKPSDTAMSASYAVYKILRESGLPPNIIQFVPADGPVFGDTVTSSEHLAGINFTGSVPTFKRLWKQVGQNLDIYRNFPRVAGECGGKNFHFVHKSADVHSVATGTIRSAFEYGGQKCSACSRMYVPDSLWPQIKQELLDIHKQIKLGDP-VEDFGTFFSAVIDEKSFSRIKGWLNHAKTSPSLTVIAGGNCDDKKGYYVEPTIIETKDPKDKIMNEEIFGPVLTVYVYPENDYKKVLSLIDSTSPYALTGAVFAKDKSVVDEAAKVLRNAAGNYYVNDKSTGSIVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVKETHVPLTDWKYPYM 555          
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Match: ENSAMXT00000032787.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 439.499 bits (1129), Expect = 3.237e-145
Identity = 207/277 (74.73%), Postives = 239/277 (86.28%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G      + SG TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHES+PEA PGDNVGFNVKNVSVKDI+RGNV  DSKN P + A  F AQVI++NHPGQI +GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AI+ M+P KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V+KKA  T
Sbjct:  178 IKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEG------NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHESLPEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAGSFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIITMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKAVDKKAATT 448          
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Match: ENSAMXT00000021279.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 437.958 bits (1125), Expect = 1.261e-144
Identity = 207/274 (75.55%), Postives = 237/274 (86.50%), Query Frame = -2
Query: 1959 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKA 2780
            +KK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G      + SG TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHES+PEA PGDNVGFNVKNVSVKDI+RGNV  DSKN P + A  F AQVI++NHPGQI +GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV M+P KPMCVE+F  +PPLGRFAVRDM+QTVAVGVIK+V KKA
Sbjct:  178 IKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEG------NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHESLPEATPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMEAGSFNAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIVEMIPGKPMCVESFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKA 445          
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Match: ENSAMXT00000053636.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 436.802 bits (1122), Expect = 3.640e-144
Identity = 205/277 (74.01%), Postives = 240/277 (86.64%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KK+GYNP +VAFVPISGW GDNM+ PS+NM WFKGW I+RK G      + SG TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHES+ EA+PGDNVGFNVKNVSVK+I+RGNV  DSKN P + A +F AQVI++NHPGQI +GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AI+ M+P KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V+KKA  T
Sbjct:  178 IKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERKEG------NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVAVTTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPMEAGNFTAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIITMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKAVDKKAATT 448          
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011427.1 (pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene:ENSPMAG00000010399.1 transcript:ENSPMAT00000011427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 431.024 bits (1107), Expect = 1.328e-142
Identity = 205/277 (74.01%), Postives = 239/277 (86.28%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KK+GYNP +V FVPISGW GDNM+  STNMPWFKGW ++RK+G      + SG TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHE++ EAVPGDNVGFNVKNVSVKD++RGNV  DSKN P + A  F AQVIV+NHPGQI+ GY+PV+DCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+A+V MVP KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIK V KKA  T
Sbjct:  178 IKKIGYNPAAVGFVPISGWHGDNMLEASTNMPWFKGWKVERKDG------NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGVFTAQVIVLNHPGQINAGYSPVVDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAMVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVEKKAATT 448          
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Match: hbs1l (HBS1-like translational GTPase [Source:ZFIN;Acc:ZDB-GENE-030131-2987])

HSP 1 Score: 129.028 bits (323), Expect = 4.724e-31
Identity = 77/273 (28.21%), Postives = 131/273 (47.99%), Query Frame = -2
Query: 1971 LKKVGYNPDSVAFVPISGWVGDNMVLPSTN---MPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNV 2780
            LK+ G+    V ++P SG  G+N+ + S +     W+                  SG  LL+ +D+  PP RP +KP RL + DV+K  G G    G+VE G ++ G  +   P      VK + +H E +  A  GD+V  NV  + +  +  G+V  D K  P   +    A++++ N    I  G+  +L   T        + +  + + TG+ V+  P+ L+ G +A+V +   +P+C+E + +F  LGRF +R    T+A GV+  +
Sbjct:  429 LKQAGFKESDVTYIPTSGLSGENLAMRSKDEKLTSWY------------------SGPCLLDCIDSFRPPQRPVDKPCRLCVSDVFKDVGAGFSVAGKVEAGYVQTGDRLVVMPANEMCTVKGITLHDEPMDWAAAGDHVTLNVTGMDMIKVGVGSVVCDPKE-PIRASTRVRARILIFNIDLPITRGFPVLLHYQTVSEPAVIKKLISVLHKSTGEVVKTKPRCLQKGQNAMVELQMQRPVCLERYKDFRELGRFMLRYSGSTIAAGVVTEI 682          
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004609.1 (pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 gene:ENSPMAG00000004155.1 transcript:ENSPMAT00000004609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.79 bits (312), Expect = 3.809e-30
Identity = 116/467 (24.84%), Postives = 213/467 (45.61%), Query Frame = 1
Query:  424 LNKAIKTSLEA-RDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQA--EIDAAAELIDFLR--FNTQAAAHVT------KYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPAL-MGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKC---DDSV--GYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIA 1773
            +  A+K + EA    W      +R++  L+A+ +I    R  L    +   GK +++A  ++D+  + +++      T A  H+        Y    P GV               I  +NF        ++PAL  GN++++KP+    L+   +  I  E+ LPPG+ N V  DG   G+ +  + ++A ++ TGSV T   +L+      +     P  + E GGK+   V    D+DN   + +  +F   GQ CS  +R++V  S+     E+++  ++ ++I  P    T   A+I ++  +R+ +Y+  A       +  G K    D S+  G+F+ P ++       + ++EEIFGPV+AV  +     E  L   ++T  +GL   +F+ D          L+   G+ YIN  +   V+ + PFGG ++SG   +  G   V  +  L++V +++ 
Sbjct:   81 VQAAVKDAREAFEGSWRGLSGSERSQHLLRASAIIKER-REELAVMEVKDTGKPVYEARMDVDSGWQCLEYFAGLAPTIAGQHIQLPGGSFMYSRREPLGVC------------VGIGAWNFPFQIACWKSAPALACGNAMVFKPSPLTPLTAVALAEIYTEAGLPPGLFNIVQGDGET-GQLLCSHNDVAKVSCTGSVGTGVKVLQQTAPRIK-----PVTL-ELGGKSPLIVFSDCDLDNAVKAALMGNFLSQGQVCSNATRVFVQRSVCERFLERLLDRVSAIRIGDPQRDSTTMGALISQSHLDRVLAYVQRAVQEGAKLVCGGKKYVPEDPSLKGGFFMTPCVLAECRDDMQAVREEIFGPVMAVLAFDTE--EEVLQRANATD-FGLAAGVFTKDLTRAHRVIAALQ--AGSCYIN--NYNVVLMEMPFGGYKMSGFG-RENGMATVDYYTQLKTVYVEMG 519          
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Match: aldh7a1 (aldehyde dehydrogenase 7 family, member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-6129])

HSP 1 Score: 114.005 bits (284), Expect = 1.417e-26
Identity = 120/470 (25.53%), Postives = 194/470 (41.28%), Query Frame = 1
Query:  370 PFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYR--PHLVATTM--LG-QGKTIFQAEIDAAAELIDFLRF--------NTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNF-TAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRI-----LRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLS--FPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAG 1716
            P  H +      Y D       +K + EA   W   P   R +I  +  D +    +   +LV+  M  +G +G    Q  +D     +   R              A + ++ P+   GVI               T FNF  A+ G   A   + GN  LWK   +  L++  + RI     + ESN  PG I  +   G   G  I  +  +  ++FTGS          VGK     +   F   + E GG N   V + AD++ V  + + ++   AGQ+C+   RL + ESI   + E ++    QV+I  PL  +T +  +  K +    K+ ++ A      T+E GGK  D  G F+ PTII        I+ +E F PVL  YV    A E  +   ++    GL+ +IF+ D   +           G + +N+ ++G+ +G   FGG + +G   ++G
Sbjct:   76 PIAHVRQATLADYED------TVKKANEAWKVWADIPAPKRGEIVRQIGDALRKKIKVLGNLVSLEMGKIGVEGLGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALIEQWNPVGLVGVI---------------TAFNFPVAVYGWNNALALVCGNCCLWKGAPTTPLTSVAVTRIRIVAEVLESNNLPGAICSLTTGGADIGTAIARDERIPLVSFTGST--------PVGKQVALMVQERFGNKLLELGGNNAIIVMDDADLNLVIPAVLFAAVGTAGQRCTTTRRLILHESIHDKVVESLVKAYKQVRIGDPLDANTLYGPLHTKQSVEMYKAAVEQAVKQGG-TVECGGKVIDRPGNFVEPTIITGLKHDAAIVHQETFAPVL--YVLKFKAFEEAIAW-NNEVKQGLSSSIFTQDLGRIFTWLGPKGSDCGIVNVNIPTSGAEIGGA-FGGEKHTGGGRESG 511          
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 107.842 bits (268), Expect = 4.168e-25
Identity = 95/337 (28.19%), Postives = 154/337 (45.70%), Query Frame = 1
Query:  724 GFWAAITPFNFTA------IGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPC---DGPLFGKTITLNPNLAGINFTGSVNTFRILL-EAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMI-GILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSY-IDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSG 1698
            G  A ITP+NF        +G  LAA     G + + KP +   LS   + ++  E+ LPPGV+N VPC   +    G+ +  +P+++ I+FTGS  T ++L+  AVG   R  +       E GG     V ESAD+D      + S F ++GQ C   +R+ V ES+      ++   +  Q+++            +I+++A  +++ + +D  S   ++ +  GG      G F  PT++    P     +EE FGP+  +  +     E  + L +ST   GL G  FS D   V      L    G +  N     +V  + PFGG + SG
Sbjct:   79 GVAAMITPWNFPVAMITRKVGAALAA-----GCTAVVKPAEDTPLSALALAQLAVEAGLPPGVLNVVPCSRANVAAVGELLCTHPSVSKISFTGSTATGKVLMAHAVGTVKRVSM-------ELGGHAPFIVFESADLDAAVRGLLSSKFRFSGQTCVCPNRMLVQESVHDAFVSRLAHAVSTQLRVGPGADTGNTLGPLINEHALEKVERHVVDAVSQGARVVV--GGARHALGGSFFQPTVLADVTPNMLCAREETFGPLAPIIKFKTE--EEAIALANSTA-MGLAGYFFSRDVAQVWRVSEALE--VGMVGANEGLLSAV--EAPFGGIKQSG 394          
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Match: PUT2 (Delta-1-pyrroline-5-carboxylate dehydrogenase; nuclear-encoded mitochondrial protein involved in utilization of proline as sole nitrogen source; deficiency of human homolog ALDH4A1 causes type II hyperprolinemia (HPII), an autosomal recessive inborn error of metabolism; human homolog ALDH4A1 can complement yeast null mutant [Source:SGD;Acc:S000001079])

HSP 1 Score: 422.935 bits (1086), Expect = 4.546e-138
Identity = 223/513 (43.47%), Postives = 316/513 (61.60%), Query Frame = 1
Query:  268 LENTLSEYINKTVEVPICIGDEELKSDQ---ILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPI-SPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTRE--YLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKI------DSPLIKDT---FFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVK 1761
            L  +L ++ + ++EVP+ I  E +  +    +  QT P +H + LAN   + EK +  A+K + +A+  W   P  DR+ IFLKAADLIS+ YR  ++A TMLGQGK ++QAEID   EL DF R+  + A+ +   +P+ S  G  N+  +R  EGF  A++PFNFTAI  NL  +PALMGN+V+WKP+ +A LSNY +  +L E+ LP GVINF+P D       +  + +   ++FTGS N F+ L   +     E  Y  +PR+IGE GGKNFH VH SA+I +  LST+R +FE+ GQKCSA SRLY+PES   +    M GIL    +       SP+       F   VI + +F+++   I+ A  + +L I YGG+ D S G+F+ PT+I+   P    M  E FGP+L VY YPD+      D++D+T+ Y LTGAIF+ D K +EYA  KL+ S GN YIN + TG+VV QQ FGG+R+SGT+DKAGGP  + +F S+++ K
Sbjct:   47 LRASLMKFKSSSLEVPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLPFYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDLYAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAALSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQSGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKKDPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDIIDNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTDDKAGGPNILSRFVSIRNTK 559          
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Match: TEF1 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; may also have a role in tRNA re-export from the nucleus; TEF1 has a paralog, TEF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006284])

HSP 1 Score: 417.157 bits (1071), Expect = 1.618e-137
Identity = 198/272 (72.79%), Postives = 229/272 (84.19%), Query Frame = -2
Query: 1965 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNK 2780
            +KKVGYNP +V FVPISGW GDNM+  +TN PW+KGW  + K G  K      G TLLEA+DAI+ P+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV+FAP G+TTEVKSVEMHHE + + VPGDNVGFNVKNVSVK+I+RGNVC D+KN P  G   F A VIV+NHPGQI  GY+PVLDCHTAHIAC+F E L+K DRR+GK++ED PK LKSGD+A+V+ VPSKPMCVE F E+PPLGRFAVRDM+QTVAVGVIK+V+K
Sbjct:  176 IKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVK------GKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK 441          
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Match: TEF2 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; TEF2-RFP levels increase during replicative aging; may also have a role in tRNA re-export from the nucleus; TEF2 has a paralog, TEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000000322])

HSP 1 Score: 417.157 bits (1071), Expect = 1.618e-137
Identity = 198/272 (72.79%), Postives = 229/272 (84.19%), Query Frame = -2
Query: 1965 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNK 2780
            +KKVGYNP +V FVPISGW GDNM+  +TN PW+KGW  + K G  K      G TLLEA+DAI+ P+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV+FAP G+TTEVKSVEMHHE + + VPGDNVGFNVKNVSVK+I+RGNVC D+KN P  G   F A VIV+NHPGQI  GY+PVLDCHTAHIAC+F E L+K DRR+GK++ED PK LKSGD+A+V+ VPSKPMCVE F E+PPLGRFAVRDM+QTVAVGVIK+V+K
Sbjct:  176 IKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVK------GKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDK 441          
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Match: ALD3 (Cytoplasmic aldehyde dehydrogenase; involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose [Source:SGD;Acc:S000004779])

HSP 1 Score: 152.91 bits (385), Expect = 9.198e-40
Identity = 135/460 (29.35%), Postives = 212/460 (46.09%), Query Frame = 1
Query:  391 LANFFYSDEKILNKAIKTSLEARDK-WDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNF------TAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQV-----KIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKL----TIEY--GGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAG 1716
            + +F  ++EK ++KA+K +  A D  W KT  + R  I+L     +    +  L A   L  GK          A++I+  R+   A         I  T        +   G  A I P+N+        + G LAA     GN+V+ KP ++  LS      +++++  PPGV+N +P  G + GK +  + ++  I+FTGS      +LEA G++  + ++      ECGGK+   V E AD+D          F  +GQ C+A SR+YV  SI+    EK      +      K D P  +      VI    ++RIKSYI+      KL    T E+  GG    + GYFI PTI        K++++EIFGPV+ V  + +   ++ L L + T  YGL  A+F+ D K        ++   G ++IN   T     + PFGG ++SG   ++G
Sbjct:   49 ITSFQAANEKDVDKAVKAARAAFDNVWSKTSSEQRG-IYLSNLLKLIEEEQDTLAALETLDAGKPFHSNAKQDLAQIIELTRYYAGAVDKFNMGETIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAA-----GNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITL-----ECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFD-PFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGG----AKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTN--YDDALKLANDTC-YGLASAVFTKDVKKAHMFARDIK--AGTVWIN--QTNQEEAKVPFGGFKMSGIGRESG 485          
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Match: ALD2 (Cytoplasmic aldehyde dehydrogenase; involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p [Source:SGD;Acc:S000004780])

HSP 1 Score: 151.754 bits (382), Expect = 2.396e-39
Identity = 136/460 (29.57%), Postives = 212/460 (46.09%), Query Frame = 1
Query:  391 LANFFYSDEKILNKAIKTSLEARDK-WDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFT------AIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQV-----KIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKL----TIEY--GGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAG 1716
            + +F  ++EK ++KA+K +  A D  W KT  + R  I+L     +    +  L A   L  GK          A+++   R+   +A    K   I  T        +   G  A I P+N+        + G LAA     GN+V+ KP ++  LS      +++++  PPGV+N VP  G L G+ +  + ++  I+FTGS      +LEA G++  + ++      ECGGK+   V E AD+D          F  +GQ C+A SR+YV  SI+    EK      +      K D P  +      VI    ++RIKSYI+      KL    T E+  GG    + GYFI PTI        K++++EIFGPV+ V  + +   ++ L L + T  YGL  A+F+ D K        ++   G ++IN  +   V    PFGG ++SG   + G
Sbjct:   49 ITSFQAANEKDVDKAVKAARAAFDNVWSKTSSEQRG-IYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAA-----GNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTKVGGFVLEASGQSNLKDVTL-----ECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFD-PFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGG----AKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTN--YDDALKLANDTC-YGLASAVFTKDVKKAHMFARDIK--AGTVWINSSNDEDVT--VPFGGFKMSGIGRELG 485          
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Match: EDO40398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A5])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 262/514 (50.97%), Postives = 366/514 (71.21%), Query Frame = 1
Query:  256 ERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPI-SPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPL-IKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWK 1791
            +R +++  + +  ++TVE+P+  G E++ +  + +Q  PFDH   +A +  +DE ++ + IK ++ AR  WD+TP ++RAKI LK AD+IS  YR   +A TM+GQGKT+F+A+IDA AEL DF RF    A  + +   +  P GV N++ +RG EGF AA++PFNFTAIGGNLA +PALMGN VLWKP  +AILS Y +  + +E+ LP GVINFVP  G  FG  +T +P+LA +NFTGSV+TF+ +   V  N   Y ++P+L+GECGGKN+HFVH SAD+D V  ST+R++F Y GQKCSACSRLYVP+S WP++KE ++  L   K+ SP+ I +TF +AVID+ +F+ IK+Y+D+  +++++T+  GG CD SVGYF+ PTI+ TS+P +K+MKEEIFGPV+  YVYPD   +  +D+VD+T  + LTGAIF  D  F+E A + LR S GN Y+N + TGSVV QQPFGG+R+SGTNDKAGGP Y+ ++ S  SVK    P  SW+
Sbjct:   35 KRSKIDAAIKKVQSETVELPVLCGGEKVYTGNVKYQVSPFDHSNKIAKYHVADEALVKETIKRAVAARKAWDRTPFEERAKILLKVADMISGKYRFETIANTMVGQGKTVFEADIDAIAELADFYRFAVHYAREMLQGPELHQPKGVSNKLQYRGLEGFVAAVSPFNFTAIGGNLAGTPALMGNVVLWKPASTAILSQYRVMEMFQEAGLPDGVINFVPSSGSTFGNAMTTSPHLAAVNFTGSVDTFKRIWRMVTDNLDTYRTYPKLVGECGGKNYHFVHMSADLDVVVNSTIRAAFGYQGQKCSACSRLYVPKSRWPEIKEALLAELKTAKMGSPVDIDNTFMTAVIDEASFDNIKTYLDFCKSSDEITVLAGGNCDKSVGYFVEPTIVETSNPYNKMMKEEIFGPVVCAYVYPDEKYKEMMDVVDNTNEFSLTGAIFGEDPTFIEEARDALRESCGNFYVNDKCTGSVVAQQPFGGARMSGTNDKAGGPMYLGRWVSPLSVKEAYEPQGSWR 548          
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Match: EF1ALPHA (Elongation factor 1-alpha [Source:UniProtKB/TrEMBL;Acc:A7SSW8])

HSP 1 Score: 424.476 bits (1090), Expect = 1.230e-139
Identity = 202/272 (74.26%), Postives = 234/272 (86.03%), Query Frame = -2
Query: 1965 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNK 2780
            LKKVG+NP +V F+PISG+ GDNM+  S NMPWFK WTI+R + ATKKE + SGVTL E +D+I PP+RP+  PLRLPLQDVYKIGGIGTVPVGRVETGV+KPG VV+F+P  +TTEVKSVEMHHES+ EA+PGDNVGFNVKNVSVKDIKRGNV  D KN P      F AQVIVMNHPG+IH GY+PVLDCHTAHIACKF + L+KIDRR+GK++ED PK +K+GD+A+V M+PSKPMCVETF EFPPLGRFAVRDMKQTVAVGVIK+V+K
Sbjct:  178 LKKVGFNPKAVPFIPISGFHGDNMLEKSENMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVTFSPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNVAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVIKSVDK 449          
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Match: EDO45538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB4])

HSP 1 Score: 147.902 bits (372), Expect = 8.870e-38
Identity = 126/462 (27.27%), Postives = 214/462 (46.32%), Query Frame = 1
Query:  412 DEKILNKAIKTSLEA---RDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPAL-MGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAV-----IDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQI 1770
            D++ ++KA+K + EA      W       R K+  K A LI      +L +   +  GK +F   +       +  R+    A  VT  + I   G           G   AITP+NF     ++  +PAL  GN V+ KP +   L+      +++E+  P GV+N +P  GP  G  IT + ++  ++FTGS    R++ EA  K+     +  RL  E GGK+ + V   +D+D        + F   GQ CSA SR +V ++I+ +  +K +       +  P      F +V     ID+  F++I   I+ +       ++ GG    + G+FI PT+        +I KEEIFGPV  +  +   +++  ++  ++TT YGL   +F+ +        + LR   G ++IN    G+   Q PFGG ++SG   +  G Y VL +  +++V +++
Sbjct:   51 DKEDVDKAVKAAKEAFKLGSAWRTMDASMRGKLLYKLAQLIDRDI-AYLASLETIDSGK-LFSDSVGDMQSSANCFRYYAGWADKVTG-KTIPADGPYFVYTRHEPVGLVGAITPWNFPLNMASVKIAPALACGNVVILKPAEQTPLTALYFCALVKEAGFPAGVVNVIPGYGPTAGAAITTHLDIDKVSFTGSTEVGRLIQEASAKS-----NLKRLTLELGGKSPNIVFADSDMDYAVEMAHEALFFNQGQCCSAGSRTFVQDTIYDEFVKKSVKRAKARTVGDP------FDSVEQGPQIDQEQFDKIMDLIE-SGKKEGAKMQCGGARHGNKGFFIQPTVFSDVTDDMRIAKEEIFGPVQQLIKF--KSVDEVIERANNTT-YGLAAGVFTKNIDTAIAVSSGLR--AGTVWINCYECGAP--QAPFGGYKMSGYG-REWGEYGVLPYCEVKTVTMKV 489          
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Match: EDO36183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJA5])

HSP 1 Score: 140.969 bits (354), Expect = 1.154e-35
Identity = 109/371 (29.38%), Postives = 166/371 (44.74%), Query Frame = 1
Query:  466 WDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPAL-MGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGD 1575
            W       R     K ADL       +L        GK I +A+ID    +I   R+    A  VT  + I   G           G   AITP+NF  +   L  +PAL  G  V+ KP +   L+   +  +++E+  P GV+N +P  GP  G  I+ +  +  I+FTGS    R++ E   K+     +  R+  E GGK+ + V   AD+D     +    F   GQ C A +R++V ESI  +   + +       +  PL + T     +D+  FN+I   I+ +       +E GG    + GYF+ PT+        +I KEEIFGPV+ +  +  + I   +   + TT YGL GA+FS D
Sbjct:   65 WRTMDASARGHFLYKLADLCERDAD-YLARLESYDGGKVINEAKIDVQG-MISCFRYYAGWADKVTG-KTIPADGPFFTYTRHEPVGVVGAITPWNFPLLMEGLKLAPALACGCVVILKPAEQTPLTALYLASLVKEAGFPTGVVNVLPGYGPTAGAAISSHMGIDKISFTGSTEVGRLIQETAAKS-----NLKRVTLELGGKSPNIVFADADLDWAVEMSCLGLFINQGQCCCAGTRIFVEESIHDEFVRQCVARAKARVVGDPLEEKTVQGPQVDEEQFNKILGLIE-SGKQQGAKVECGGGRHGNKGYFVEPTVFSGVQDDMRIAKEEIFGPVMQILKF--NEINEVIRRANDTT-YGLAGAVFSKD 423          
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Match: EDO47653 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS5])

HSP 1 Score: 140.584 bits (353), Expect = 4.364e-35
Identity = 119/466 (25.54%), Postives = 207/466 (44.42%), Query Frame = 1
Query:  412 DEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAEL-IDFLRFNTQAAAHVTK-----------YRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALM-GNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQI 1770
            D  I  KA +++ +    W      DR ++  + ADLI    + +L +   L  GK  +    +   E  I   R+    A  +             Y    P GV+ +V+            P+NF  +       PAL  GN+V+ KP +   L+   +  ++ E+  P GV+N VP  GP  G  I  + ++  I FTGS     I+ ++ G +  + ++      E GGK+ + V   +D+D     +  + F   GQ C A SR +V E I+ +  EK +       + +P    T     +D     +I + I+ +       +E GG      GYFI PT+        +I +EEIFGPV+ ++ + D  + + ++  + TT YGL G++ + + +      N LR   G +++N     ++  Q PFGG ++SG   +  G Y + +++ +++V I I
Sbjct:   81 DVDIAVKAAQSAFKLGSPWRTMDASDRGRLLNRLADLIERD-KAYLASLETLDNGKP-YNDSFNVDLEFTIKCYRYYAGWADKIHGKTIPLDGSFFCYTRHEPVGVVGQVI------------PWNFPLLMQAWKLGPALACGNTVVMKPAEQTPLTALYVASLIAEAGFPEGVVNIVPGFGPTAGGAIASHMDVDKIAFTGSTEVGHIIQQSAGASNLKNVTL-----ELGGKSPNIVLADSDVDFAVDMSHFALFFNQGQCCCAGSRTFVQEGIYDEFVEKSVQRAKNRVVGNPFDLKTQQGPQVDGEQMTKILNLIE-SGRKEGAKLEVGGDRAGDKGYFIQPTVFSDVQDNMRIAQEEIFGPVMQIFRFKD--MNDIIERANKTT-YGLAGSVMTKNLENALMLSNSLR--VGTVWVNCYD--ALSAQAPFGGYKMSGVGREL-GEYGLQQYSEVKTVTIAI 518          
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Match: aldh4a1 (aldehyde dehydrogenase 4 family member A1 [Source:NCBI gene;Acc:101160805])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 288/556 (51.80%), Postives = 394/556 (70.86%), Query Frame = 1
Query:  142 KILNAVVNKLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKD--TFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHM 1803
            ++ +AV    + F      A+E +  NE IL +K+GS ER  L   L     +T EVP  +GDE + +  I +Q  PF+H   +A F Y+D++++NKAI  S+ AR +WD  P++DRA++F KAAD+IS   R  ++A TM+GQGKT+ QAEIDAAAELIDF RFN + A  + K +P+   G  N +++RG EGF AA+ PFNFTAIGGNLA +PA+MGN VLWKP+D+A+ ++Y +Y++LRE  LPP +I F+P DGP+FG  +T + +LAGINFTGSV TF+ L + V +N   Y +FPRL GECGGKNFHFVH SAD+ +V + T+RS+FEY GQKCSACSR+YVP+S+WP ++++++ +   +K+  P ++D  TFFSAVID  +F RI  ++++A  +  L+I  GG CDD  GYF+ PTI+ T DP D IM EEIFGPVL+VYVYPD   +  L L+D T+PY LTGA+F+ D+K ++ A   LR++ GN Y+N +STGSVV QQPFGG+R SGTNDK GGP+YVL++ S Q VK    P + WK  +M
Sbjct:    3 RVRSAVFRSWRGFQTFPCAAVEVK--NEPILGFKEGSPERSDLLKALDSLKERTQEVPCVVGDEHVWTADIRYQLSPFNHSHKVAKFCYADKELINKAILASVAARKEWDLKPVQDRAQVFFKAADVISGPKRAEILANTMIGQGKTVVQAEIDAAAELIDFFRFNAKHAIELEKQQPLDADGSTNTMLYRGLEGFVAAVAPFNFTAIGGNLAGTPAMMGNVVLWKPSDTAVSASYAVYKVLRECGLPPHIIQFLPADGPVFGDAVTSSEHLAGINFTGSVPTFKRLWKQVAQNLDIYRTFPRLAGECGGKNFHFVHTSADVQSVVMGTIRSAFEYGGQKCSACSRMYVPDSLWPQIRQQLLDVHKSIKVGDP-VEDFSTFFSAVIDDKSFARISRWLNHAKTSPNLSIIAGGNCDDRKGYFVEPTIVETKDPQDPIMSEEIFGPVLSVYVYPDKKYQEVLQLIDRTSPYALTGAVFAHDKKVIDEAAKVLRNAAGNYYVNDKSTGSVVAQQPFGGARASGTNDKPGGPHYVLRWTSPQVVKQTHVPLRDWKYPYM 555          
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Match: ENSORLT00000009507.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:101170939])

HSP 1 Score: 436.417 bits (1121), Expect = 5.551e-144
Identity = 205/275 (74.55%), Postives = 237/275 (86.18%), Query Frame = -2
Query: 1956 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAP 2780
            +KK+GYNP +VAFVPISGW GDNM+  S  M WFKGW I+RK G        +GVTLLEA+D+I PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVV+FAP  LTTEVKSVEMHHES+ EA+PGDNVGFN+KNVSVK+I+RGNV  DSKN P L A +F AQVI++NHPGQI +GY PVLDCHTAHIACKFSE  +KIDRR+GK++ED PK LKSGD+AI+ MVP KPMCVE+F ++PPLGRFAVRDM+QTVAVGVIKNV KKAP
Sbjct:  178 IKKIGYNPATVAFVPISGWHGDNMLEASDKMSWFKGWKIERKEGGA------TGVTLLEALDSILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPPNLTTEVKSVEMHHESLTEALPGDNVGFNIKNVSVKEIRRGNVAGDSKNDPPLAAENFTAQVIILNHPGQIAQGYAPVLDCHTAHIACKFSELKEKIDRRSGKKLEDNPKALKSGDAAIITMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKAP 446          
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 434.491 bits (1116), Expect = 2.535e-140
Identity = 207/277 (74.73%), Postives = 234/277 (84.48%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KK+GYNPD+VAFVPISGW GDNM+ PS NM WFKGW I RK G      + SG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKDI+RGNV  DSKN P   A +F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV M+P KPMCVE+F E+PPLGRFAVRDM+QTVAVGVIK V KK   T
Sbjct:  168 IKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEG------NASGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVEKKVSTT 438          
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 433.721 bits (1114), Expect = 3.003e-140
Identity = 207/277 (74.73%), Postives = 234/277 (84.48%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KK+GYNPD+VAFVPISGW GDNM+ PS NM WFKGW I RK G      + SG TLLEA+DAI PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  +TTEVKSVEMHHE++ EA+PGDNVGFNVKNVSVKDI+RGNV  DSKN P   A +F AQVI++NHPGQI  GY PVLDCHTAHIACKF+E  +KIDRR+GK++ED PK LKSGD+AIV M+P KPMCVE+F E+PPLGRFAVRDM+QTVAVGVIK V KK   T
Sbjct:  153 IKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRKEG------NASGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVIKGVEKKVSTT 423          
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Match: eef1a (elongation factor 1 alpha [Source:NCBI gene;Acc:100049188])

HSP 1 Score: 420.624 bits (1080), Expect = 7.657e-138
Identity = 199/273 (72.89%), Postives = 233/273 (85.35%), Query Frame = -2
Query: 1962 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKK 2780
            +KK+GYNP +VAFVPISGW GDNM+  S  M WFKGW I+RK+G      + SG TLLEA+DAI PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVV+FAP  LTTEVKSVEMHHES+PEAVPGDNVGFN+KNVSVK+I+RG V  DSKN P   A  F AQVI++NHPGQI++GY PVLDCHTAHIACKF+E ++KIDRR+GK++ED PK +KSGD+AIV+++P KPM VE F  +PPLGRFAVRDM+QTVAVGVIK V+ K
Sbjct:  178 IKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKGWKIERKDG------NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPPNLTTEVKSVEMHHESLPEAVPGDNVGFNIKNVSVKEIRRGYVAGDSKNDPPKAAASFNAQVIILNHPGQINQGYAPVLDCHTAHIACKFNELIEKIDRRSGKKLEDNPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVIKAVDTK 444          
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Match: SMESG000052650.1 (SMESG000052650.1)

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 556/559 (99.46%), Postives = 557/559 (99.64%), Query Frame = 1
Query:  130 MQRTKILNAVVNKLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 1806
            MQRTKILNAVVNKLKRFSLANNE LEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYS+EKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFS DEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME
Sbjct:    1 MQRTKILNAVVNKLKRFSLANNEVLEYEAVNENILTYKQGSKERIQLENTLSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSNEKILNKAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGKTIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGFWAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESNLPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTREYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSRLYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYIDYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLAVYVYPDSAIENTLDLVDSTTPYGLTGAIFSEDEKFVEYACNKLRHSTGNLYINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPNQSWKQIHME 559          
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Match: SMESG000052648.1 (SMESG000052648.1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 276/277 (99.64%), Postives = 277/277 (100.00%), Query Frame = -2
Query: 1950 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 2780
            +KKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET
Sbjct:  178 IKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPET 454          
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Match: SMESG000078056.1 (SMESG000078056.1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 263/276 (95.29%), Postives = 275/276 (99.64%), Query Frame = -2
Query: 1953 LKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPE 2780
            +KKVGYNP+SVAFVPISGWVGDNMVLPSTNMPWFKGW+IKRKNGATKKEESL+GVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV FAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKN+PA+GAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKF+EF+KKIDRRTGKEVEDAPKQLKSGDSAI++MVPSKPMCVE+FME+PPLGRFAVRDMKQTVAVGVIKNVNKKAPE
Sbjct:  178 IKKVGYNPESVAFVPISGWVGDNMVLPSTNMPWFKGWSIKRKNGATKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVCFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNSPAMGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFAEFIKKIDRRTGKEVEDAPKQLKSGDSAIIKMVPSKPMCVESFMEYPPLGRFAVRDMKQTVAVGVIKNVNKKAPE 453          
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Match: SMESG000061164.1 (SMESG000061164.1)

HSP 1 Score: 466.077 bits (1198), Expect = 1.183e-155
Identity = 216/278 (77.70%), Postives = 249/278 (89.57%), Query Frame = -2
Query: 1953 SDLKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPE 2786
            S LKKVGY PDSVAFVPISGW GDNM+  S+NMPW+KGW + R+N A K+E  ++G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVV+FAP GLTTEVKSVEMHHE++ EA+PGDNVGFN+KNVSVK+I+RGNVCSDSK+ PA  A DF AQVI+MNHPG+IH GY+PVLDCHTAHIACKFSE +KKIDRR+GKE+ED PKQ KSGD+ +VR++PSKPMCVETF E+PPLGRFAVRDMKQTVAVGVIK V KKA E
Sbjct:  176 SYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRN-AKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVIKEVTKKAVE 452          
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Match: SMESG000061099.1 (SMESG000061099.1)

HSP 1 Score: 466.077 bits (1198), Expect = 1.183e-155
Identity = 216/278 (77.70%), Postives = 249/278 (89.57%), Query Frame = -2
Query: 1953 SDLKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVIKNVNKKAPE 2786
            S LKKVGY PDSVAFVPISGW GDNM+  S+NMPW+KGW + R+N A K+E  ++G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVV+FAP GLTTEVKSVEMHHE++ EA+PGDNVGFN+KNVSVK+I+RGNVCSDSK+ PA  A DF AQVI+MNHPG+IH GY+PVLDCHTAHIACKFSE +KKIDRR+GKE+ED PKQ KSGD+ +VR++PSKPMCVETF E+PPLGRFAVRDMKQTVAVGVIK V KKA E
Sbjct:  176 SYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRN-AKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVIKEVTKKAVE 452          
The following BLAST results are available for this feature:
BLAST of Multifunctional fusion protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDH4A10.000e+055.35aldehyde dehydrogenase 4 family member A1 [Source:... [more]
ALDH4A10.000e+055.35aldehyde dehydrogenase 4 family member A1 [Source:... [more]
ALDH4A10.000e+057.00aldehyde dehydrogenase 4 family member A1 [Source:... [more]
ALDH4A17.657e-17548.50aldehyde dehydrogenase 4 family member A1 [Source:... [more]
EEF1A15.630e-14474.82eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alh-60.000e+052.83ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-60.000e+052.83ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-60.000e+052.83ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-63.050e-17252.52ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-63.050e-17252.52ALdehyde deHydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P5CDh10.000e+053.82gene:FBgn0037138 transcript:FBtr0078446[more]
P5CDh10.000e+053.82gene:FBgn0037138 transcript:FBtr0303031[more]
P5CDh10.000e+053.82gene:FBgn0037138 transcript:FBtr0332813[more]
P5CDh10.000e+053.82gene:FBgn0037138 transcript:FBtr0078447[more]
P5CDh10.000e+053.82gene:FBgn0037138 transcript:FBtr0078445[more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh4a10.000e+053.69aldehyde dehydrogenase 4 family, member A1 [Source... [more]
eef1a1l12.028e-14374.45eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l17.019e-14375.09eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1b9.676e-14374.36eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l29.676e-14374.36eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh4a12.653e-15245.59aldehyde dehydrogenase 4 family member A1 [Source:... [more]
aldh4a13.128e-15144.84aldehyde dehydrogenase 4 family member A1 [Source:... [more]
aldh4a11.249e-14743.58aldehyde dehydrogenase 4 family member A1 [Source:... [more]
aldh4a16.651e-14743.39aldehyde dehydrogenase 4 family member A1 [Source:... [more]
aldh4a11.428e-14643.39aldehyde dehydrogenase 4 family member A1 [Source:... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh4a10.000e+054.78aldehyde dehydrogenase 4 family, member A1 [Source... [more]
Eef1a12.361e-14475.18eukaryotic translation elongation factor 1 alpha 1... [more]
Eef1a21.940e-14172.99eukaryotic translation elongation factor 1 alpha 2... [more]
Aldh1a31.369e-3927.98aldehyde dehydrogenase family 1, subfamily A3 [Sou... [more]
Aldh1a11.096e-3827.10aldehyde dehydrogenase family 1, subfamily A1 [Sou... [more]
back to top
BLAST of Multifunctional fusion protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7YWE4|AL4A1_BOVIN0.000e+053.02Delta-1-pyrroline-5-carboxylate dehydrogenase, mit... [more]
sp|P30038|AL4A1_HUMAN0.000e+055.35Delta-1-pyrroline-5-carboxylate dehydrogenase, mit... [more]
sp|Q7SY23|AL4A1_DANRE0.000e+053.80Delta-1-pyrroline-5-carboxylate dehydrogenase, mit... [more]
sp|Q8CHT0|AL4A1_MOUSE0.000e+054.78Delta-1-pyrroline-5-carboxylate dehydrogenase, mit... [more]
sp|P0C2X9|AL4A1_RAT0.000e+053.41Delta-1-pyrroline-5-carboxylate dehydrogenase, mit... [more]
back to top
BLAST of Multifunctional fusion protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PKZ40.000e+059.36Multifunctional fusion protein OS=Mizuhopecten yes... [more]
C1LG620.000e+059.29Multifunctional fusion protein OS=Schistosoma japo... [more]
A0A4Z2DSL80.000e+059.29Multifunctional fusion protein OS=Schistosoma japo... [more]
A0A1I8HPQ70.000e+059.96Multifunctional fusion protein OS=Macrostomum lign... [more]
K1RGD10.000e+057.81Multifunctional fusion protein OS=Crassostrea giga... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh4a10.000e+055.16aldehyde dehydrogenase 4 family member A1 [Source:... [more]
aldh4a10.000e+055.16aldehyde dehydrogenase 4 family member A1 [Source:... [more]
ENSAMXT00000032787.13.237e-14574.73elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000021279.21.261e-14475.55elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000053636.13.640e-14474.01elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011427.11.328e-14274.01pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene... [more]
hbs1l4.724e-3128.21HBS1-like translational GTPase [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000004609.13.809e-3024.84pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 g... [more]
aldh7a11.417e-2625.53aldehyde dehydrogenase 7 family, member A1 [Source... [more]
aldh5a14.168e-2528.19aldehyde dehydrogenase 5 family, member A1 (succin... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PUT24.546e-13843.47Delta-1-pyrroline-5-carboxylate dehydrogenase; nuc... [more]
TEF11.618e-13772.79Translational elongation factor EF-1 alpha; in the... [more]
TEF21.618e-13772.79Translational elongation factor EF-1 alpha; in the... [more]
ALD39.198e-4029.35Cytoplasmic aldehyde dehydrogenase; involved in be... [more]
ALD22.396e-3929.57Cytoplasmic aldehyde dehydrogenase; involved in et... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403980.000e+050.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EF1ALPHA1.230e-13974.26Elongation factor 1-alpha [Source:UniProtKB/TrEMB... [more]
EDO455388.870e-3827.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361831.154e-3529.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476534.364e-3525.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multifunctional fusion protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh4a10.000e+051.80aldehyde dehydrogenase 4 family member A1 [Source:... [more]
ENSORLT00000009507.25.551e-14474.55elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
eef1a1a2.535e-14074.73elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
eef1a1a3.003e-14074.73elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
eef1a7.657e-13872.89elongation factor 1 alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Multifunctional fusion protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052650.10.000e+099.46SMESG000052650.1[more]
SMESG000052648.10.000e+099.64SMESG000052648.1[more]
SMESG000078056.10.000e+095.29SMESG000078056.1[more]
SMESG000061164.11.183e-15577.70SMESG000061164.1[more]
SMESG000061099.11.183e-15577.70SMESG000061099.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002558 ID=SMED30002558|Name=Multifunctional fusion protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2787bp
GTGCAGTTGTTTAAACGACTGAAAAATTTAGAATTTTAAGAGCGTCATTT
ATTTTCGCATTCGAGACTACAGTTTTTAATTGAAATTCAAAATTTTAATT
TTAATGAACTTTTTTTAAAGTAATTTATTATGCAAAGAACTAAAATTTTA
AATGCAGTTGTAAATAAATTAAAGCGTTTCAGTTTAGCAAATAATGAAGC
TTTGGAATATGAAGCTGTAAATGAAAACATATTAACATACAAGCAAGGAA
GTAAAGAACGCATACAATTAGAAAATACTTTATCTGAATACATTAATAAA
ACTGTTGAAGTACCTATTTGTATTGGAGATGAAGAATTAAAAAGTGATCA
AATTCTACATCAGACATATCCATTCGATCACCATAAAACTTTGGCTAATT
TTTTTTATTCCGACGAAAAGATCCTGAATAAAGCAATTAAAACATCTCTT
GAAGCTCGAGACAAATGGGATAAAACTCCTTTGAAAGACAGAGCTAAAAT
ATTTCTTAAGGCCGCTGATTTAATAAGTTCCACTTATAGGCCACATTTAG
TGGCTACAACAATGCTCGGACAAGGAAAAACAATTTTCCAAGCTGAAATC
GACGCGGCAGCAGAATTGATCGACTTTTTACGATTCAACACTCAAGCGGC
AGCTCATGTTACGAAGTACAGACCTATAAGCCCAACTGGAGTTATTAATG
AAGTCGTCTGGCGAGGAACGGAGGGATTTTGGGCAGCAATTACTCCGTTT
AACTTTACTGCTATCGGCGGTAACCTTGCAGCAAGCCCGGCTCTTATGGG
CAACTCGGTTCTGTGGAAACCTACCGATTCAGCTATTTTATCCAATTATA
CAATTTACAGAATCCTGCGCGAAAGTAACTTGCCGCCCGGTGTCATCAAT
TTCGTGCCCTGCGACGGGCCACTGTTTGGCAAAACCATAACTCTCAATCC
TAATTTAGCCGGTATTAATTTCACCGGCAGTGTTAATACATTTCGCATTT
TATTGGAGGCAGTAGGAAAGAATACGAGAGAATATTTATCTTTTCCAAGA
TTAATTGGAGAATGCGGTGGGAAAAATTTCCACTTCGTTCATGAGAGTGC
TGATATAGATAATGTTAGTTTATCAACTGTTAGGAGTTCTTTCGAATATG
CTGGACAAAAGTGTAGTGCTTGCAGTAGACTATATGTTCCGGAGAGCATT
TGGCCAGATTTAAAAGAAAAAATGATCGGAATTTTAAATCAAGTAAAAAT
TGATTCTCCCCTCATTAAGGATACGTTCTTCTCGGCTGTCATTGATAAAA
ATGCGTTTAATAGAATTAAATCATATATTGATTATGCCTCGAATAATAAC
AAGTTGACAATAGAATATGGCGGGAAATGTGATGACTCGGTTGGATACTT
TATACACCCAACAATAATTAGGACTTCCGATCCTGGTGATAAAATTATGA
AAGAGGAGATATTCGGGCCTGTATTGGCTGTTTATGTTTATCCAGATTCG
GCAATAGAAAACACTCTAGATTTGGTCGACTCTACAACTCCTTATGGTTT
AACAGGAGCAATATTTTCTGGGGATGAAAAATTTGTCGAATATGCATGCA
ACAAGTTGCGACATTCAACTGGGAATTTATATATTAATGTTCAATCAACT
GGTTCAGTTGTCGGTCAGCAACCTTTTGGAGGTTCCCGATTGTCAGGAAC
GAATGATAAAGCTGGAGGCCCATATTATGTTCTAAAATTTGCATCTTTAC
AGTCTGTGAAAATACAGATTGCACCAAACCAATCTTGGAAACAAATCCAC
ATGGAATAATTTTCATACTTTTCATATTTTAAAGTTAAAAAATAAAAGTC
ATTGTTTTTAATAAATATCCAAAAAACTAAACAATATTTCCATGCTTCAA
AATTTATTCAAAACATTTACTTTTTACCCTTAACGGCTTTTCCTTTAGCT
GTTTCAGGAGCTTTCTTGTTAACATTCTTGATGACACCGACGGCAACAGT
TTGTTTCATGTCTCTGACGGCAAATCGTCCCAATGGAGGGAATTCCATGA
AGGTTTCAACACACATTGGTTTAGATGGAACCATTCTGACAATGGCTGAG
TCACCTGATTTCAATTGTTTTGGAGCGTCTTCGACTTCTTTACCAGTACG
ACGATCGATCTTTTTCAAGAATTCTGAGAATTTGCATGCAATGTGGGCAG
TATGGCAATCGAGAACTGGGGTGTATCCTTCGTGAATTTGACCTGGGTGA
TTCATTACGATAACTTGAGCTTCAAAGTCAACTGCTCCCAAAGCTGGTGC
GTTTTTGCTATCACTGCAAACGTTTCCTCTTTTGATGTCTTTGACTGAAA
CGTTCTTTACGTTGAATCCAACGTTGTCACCGGGAACTGCTTCAGGGATT
GATTCGTGGTGCATTTCAACTGATTTTACCTCAGTGGTCAAACCGTGTGG
TGCAAAGCTGACAACCATGCCTGGTTTGATGACACCGGTTTCAACTCGGC
CAACTGGGACTGTTCCAATACCTCCAATCTTGTACACATCTTGAAGGGGC
AATCTCAATGGTTTTTCAGTTGGTCTGGCTGGTGGATCAATGGCATCCAT
GGCTTCCAATAGAGTGACTCCGCTAAGGCTTTCTTCCTTTTTGGTTGCTC
CGTTCTTTCTCTTGATGGTCCATCCTTTGAACCATGGCATGTTTGTGCTT
GGGAGGACCATGTTGTCTCCAACCCATCCAGAAATTGGTACGAAAGCAAC
AGAGTCTGGATTGTATCCAACCTTTTTGAGATCGGAA
back to top

protein sequence of SMED30002558-orf-1

>SMED30002558-orf-1 ID=SMED30002558-orf-1|Name=SMED30002558-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=290bp
SDLKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKK
EESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVET
GVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKD
IKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIA
CKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFP
PLGRFAVRDMKQTVAVGVIKNVNKKAPETAKGKAVKGKK*
back to top

protein sequence of SMED30002558-orf-2

>SMED30002558-orf-2 ID=SMED30002558-orf-2|Name=SMED30002558-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=560bp
MQRTKILNAVVNKLKRFSLANNEALEYEAVNENILTYKQGSKERIQLENT
LSEYINKTVEVPICIGDEELKSDQILHQTYPFDHHKTLANFFYSDEKILN
KAIKTSLEARDKWDKTPLKDRAKIFLKAADLISSTYRPHLVATTMLGQGK
TIFQAEIDAAAELIDFLRFNTQAAAHVTKYRPISPTGVINEVVWRGTEGF
WAAITPFNFTAIGGNLAASPALMGNSVLWKPTDSAILSNYTIYRILRESN
LPPGVINFVPCDGPLFGKTITLNPNLAGINFTGSVNTFRILLEAVGKNTR
EYLSFPRLIGECGGKNFHFVHESADIDNVSLSTVRSSFEYAGQKCSACSR
LYVPESIWPDLKEKMIGILNQVKIDSPLIKDTFFSAVIDKNAFNRIKSYI
DYASNNNKLTIEYGGKCDDSVGYFIHPTIIRTSDPGDKIMKEEIFGPVLA
VYVYPDSAIENTLDLVDSTTPYGLTGAIFSGDEKFVEYACNKLRHSTGNL
YINVQSTGSVVGQQPFGGSRLSGTNDKAGGPYYVLKFASLQSVKIQIAPN
QSWKQIHME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006560proline metabolic process
GO:0010133proline catabolic process to glutamate
GO:0055114oxidation-reduction process
GO:0008152metabolic process
GO:0006537glutamate biosynthetic process
GO:0006561proline biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005931P5CDH/ALDH4A1
IPR015590Aldehyde_DH_dom
IPR016163Ald_DH_C
IPR016162Ald_DH_N
IPR029510Ald_DH_CS_GLU
IPR016160Ald_DH_CS_CYS
IPR016161Ald_DH/histidinol_DH
IPR004161EFTu-like_2
IPR004160Transl_elong_EFTu/EF1A_C
IPR027417P-loop_NTPase
IPR009001Transl_elong_EF1A/Init_IF2_C
IPR009000Transl_B-barrel_sf
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0005525GTP binding
GO:00038421-pyrroline-5-carboxylate dehydrogenase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016163Aldehyde dehydrogenase, C-terminalGENE3DG3DSA:3.40.309.10coord: 315..512
e-value: 1.1E-203
score: 679.1
IPR005931Delta-1-pyrroline-5-carboxylate dehydrogenaseTIGRFAMTIGR01236TIGR01236coord: 31..558
e-value: 1.0E-216
score: 718.6
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 76..543
e-value: 5.7E-102
score: 341.6
IPR016162Aldehyde dehydrogenase, N-terminalGENE3DG3DSA:3.40.605.10coord: 35..544
e-value: 1.1E-203
score: 679.1
NoneNo IPR availablePANTHERPTHR145161-PYRROLINE-5-CARBOXYLATE DEHYDROGENASE FAMILY MEMBERcoord: 21..547
NoneNo IPR availablePANTHERPTHR14516:SF6coord: 21..547
IPR016160Aldehyde dehydrogenase, cysteine active sitePROSITEPS00070ALDEHYDE_DEHYDR_CYScoord: 338..349
IPR029510Aldehyde dehydrogenase, glutamic acid active sitePROSITEPS00687ALDEHYDE_DEHYDR_GLUcoord: 310..317
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILYSSF53720ALDH-likecoord: 28..546