B9 domain-containing protein 2

Overview
NameB9 domain-containing protein 2
Smed IDSMED30002554
Length (bp)639
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B9 domain-containing protein 2 (SMED30002554) t-SNE clustered cells

Violin plots show distribution of expression levels for B9 domain-containing protein 2 (SMED30002554) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B9 domain-containing protein 2 (SMED30002554) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B9 domain-containing protein 2 (SMED30002554) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002554

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002554SMESG000000764.1 SmedASXL_006117SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002554SMESG000000764.1 dd_Smed_v4_7362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30002554SMESG000000764.1 dd_Smed_v4_7362_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30002554SMESG000000764.1 dd_Smed_v6_7362_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002554SMESG000000764.1 dd_Smed_v4_7362_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Match: B9D2 (B9 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28636])

HSP 1 Score: 235.343 bits (599), Expect = 6.556e-79
Identity = 112/176 (63.64%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGASGF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L FQVW  D  GR +L GYGFC VPSSPG H++   TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ RN DR+G+EC
Sbjct:    1 MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRP-LGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 97.4413 bits (241), Expect = 1.473e-24
Identity = 58/176 (32.95%), Postives = 88/176 (50.00%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQID--DIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + + GQ+  A  FPE + L+CK+   YG  W   +GLEEG +Q+     D      +  PID+   +    GWP++   V+  D  G   + GYG   VP SPG HK  +  + P S+S  ++    F+G  P+   P +V  GE R   +  S G V L  NV+T++M + G + 
Sbjct:   11 LMVNGQVESAQ-FPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMRKLGYDT 185          
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 80.1073 bits (196), Expect = 2.145e-18
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQID--DIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDR 503
            + + GQ+  A  FPE + L+CK+   YG  W   +GLEEG +Q+     D      +  PID+   +    GWP++   V+  D  G   + GYG   VP SPG HK  +  + P S+S  ++    F+G  P+   P +V  GE R
Sbjct:   11 LMVNGQVESAQ-FPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGR 156          
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 80.1073 bits (196), Expect = 3.190e-18
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQID--DIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDR 503
            + + GQ+  A  FPE + L+CK+   YG  W   +GLEEG +Q+     D      +  PID+   +    GWP++   V+  D  G   + GYG   VP SPG HK  +  + P S+S  ++    F+G  P+   P +V  GE R
Sbjct:   11 LMVNGQVESAQ-FPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGR 156          
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Match: B9D1 (B9 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:24123])

HSP 1 Score: 79.7221 bits (195), Expect = 4.599e-18
Identity = 49/147 (33.33%), Postives = 73/147 (49.66%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQID--DIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDR 503
            + + GQ+  A  FPE + L+CK+   YG  W   +GLEEG +Q+     D      +  PID+   +    GWP++   V+  D  G   + GYG   VP SPG HK  +  + P S+S  ++    F+G  P+   P +V  GE R
Sbjct:   11 LMVNGQVESAQ-FPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSWFMGRRPEYTDPKVVAQGEGR 156          
BLAST of B9 domain-containing protein 2 vs. Ensembl Celegans
Match: mksr-2 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q9N423])

HSP 1 Score: 174.866 bits (442), Expect = 1.571e-55
Identity = 84/176 (47.73%), Postives = 112/176 (63.64%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+ + GQI+ A GF +N L  ++ +++GGGWRV+ G  EGQTQ D P + + A+F HPIDLHLAT  +QGWP+L  Q+WHHD  GRQE+ GYG   +P+SPG H +    WRP   S+ EEM H  VGGG QL     +     R  + + S G V   +N+IT+N  R+GI C
Sbjct:    1 MAEVFVSGQILSARGFGDNRLSIRYQLSFGGGWRVVQGESEGQTQTDCPSVFENAHFAHPIDLHLATSSIQGWPRLLLQIWHHDNYGRQEIAGYGTLLLPTSPGKHVLTSGCWRP-KGSWREEMMHKLVGGGLQLTSLSALEDPSIREKIVSVSAGVVKFELNIITKNFQRYGILC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Celegans
Match: mksr-1 (MecKel Syndrome 1 (MKS1)-Related [Source:UniProtKB/TrEMBL;Acc:Q21191])

HSP 1 Score: 60.077 bits (144), Expect = 5.980e-11
Identity = 39/161 (24.22%), Postives = 66/161 (40.99%), Query Frame = 3
Query:   93 IGASGFPENSLFC-KWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMD 572
            +  + FPE S  C K      G W++++G     +       D+  +   P +  L       WP+L    +  D  G+  + GYG   +P+ PG H   V  + P  SS  +++         +   P L  + + R   +T++ G V L INV  +  D
Sbjct:   15 VRTTEFPEESNVCVKLSTVATGDWKIINGETVSLSSFSFRGADNQIFIDLPFECGLKGSSPFMWPRLVLNCFSKDHSGKDCVTGYGMLPIPTEPGKHVCRVHCFLPEPSSTVQQLIAKLRRVNAEFVDPMLPANADGRYACRTSTKGYVDLEINVSIKCSD 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Fly
Match: B9d2 (gene:FBgn0261683 transcript:FBtr0303078)

HSP 1 Score: 152.91 bits (385), Expect = 8.152e-47
Identity = 69/175 (39.43%), Postives = 109/175 (62.29%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQI+ A  F E  L+CKW +  G  WR++ G  +GQ+ V   ++   + F  P+D+HL+T  +QGWP+L  +V+  +   +    GYGF  VPS+PG H++++ TW+ + +  ++ +   F GGG  L + DL+YSG +R  LQT S G V + +N+I R  D +G+E
Sbjct:    1 MAEVHIIGQILKAVDFAEPHLYCKWSLQSGNAWRLVQGEVQGQSHVASHRLQSSSDFAQPLDIHLSTASVQGWPRLLVEVYAVNVLQQSWPVGYGFVHVPSTPGTHRLEIGTWKVAPNGLWQSLRERFGGGGAALSKTDLLYSGVERYKLQTLSSGKVIVELNLIFRKFDEYGVE 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Fly
Match: B9d1 (gene:FBgn0038342 transcript:FBtr0083145)

HSP 1 Score: 51.6026 bits (122), Expect = 9.301e-8
Identity = 37/182 (20.33%), Postives = 77/182 (42.31%), Query Frame = 3
Query:   72 IHILGQIIGAS---GFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQ---IDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVP------SSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFG 581
            + I+GQI+ A+   G  +  +F ++ +  G  W++ SG + G TQ+   +    ++   F  PI++   +    GWP++   V+     GR+ L GY    +P       +    ++      P   +   ++    +   P+LK P ++        L   S G++   ++ + R   + G
Sbjct:   55 LSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMMADITSWLLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLG 236          
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 236.884 bits (603), Expect = 9.734e-80
Identity = 110/175 (62.86%), Postives = 137/175 (78.29%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQIIGA+GFP+NSLFCKWG++ GG WR+LSGL EGQTQVD+PQ  D+AY+ HPIDLH  T GLQGWPKL  QVWH D  GR +LYGYG+  VPSSPG H++  +TWRP   S+ ++++  FVGGGPQL+ PDL+YSG DR  L T  MGTV L + +I R+ DR+G+E
Sbjct:    1 MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRP-LGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 236.884 bits (603), Expect = 9.734e-80
Identity = 110/175 (62.86%), Postives = 137/175 (78.29%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQIIGA+GFP+NSLFCKWG++ GG WR+LSGL EGQTQVD+PQ  D+AY+ HPIDLH  T GLQGWPKL  QVWH D  GR +LYGYG+  VPSSPG H++  +TWRP   S+ ++++  FVGGGPQL+ PDL+YSG DR  L T  MGTV L + +I R+ DR+G+E
Sbjct:    1 MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRP-LGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:554150])

HSP 1 Score: 91.6633 bits (226), Expect = 1.254e-22
Identity = 53/175 (30.29%), Postives = 87/175 (49.71%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIP-QIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + + GQI  A  FPE + L+CK+   YG  W   SGLEEG +Q+    ++     +  P+D+   +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P S+S  ++     +G  P+   P +V  GE R   +  S G V L  N++T++M + G + 
Sbjct:   11 LMVNGQIESAD-FPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRLSQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGYDT 184          
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:554150])

HSP 1 Score: 73.9442 bits (180), Expect = 2.313e-16
Identity = 39/142 (27.46%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  168 LSGLEEGQTQVDIP-QIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + GLEEG +Q+    ++     +  P+D+   +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P S+S  ++     +G  P+   P +V  GE R   +  S G V L  N++T++M + G + 
Sbjct:    1 MRGLEEGISQITSKGRLSQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPESTSRLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGYDT 142          
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 71.633 bits (174), Expect = 3.157e-14
Identity = 47/179 (26.26%), Postives = 82/179 (45.81%), Query Frame = 3
Query:   78 ILGQIIGASGFPENSLFCKWGINYGGGWR-----VLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL-------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLV-----YSGE--DRLYLQTASMGTVHLAINVI 557
            + G+I+ A G+  ++L+  + ++    W       LSG+ +      I + +D+A+F +P            +   L  WP L+F+V   D+  R    GYG+  +PS+ G H++   TWR        E+   F+GG P+L+    V     + GE   R   +T + G+V   +N I
Sbjct:  312 VNGEIVSAQGYEYDNLYVHFFVDLPNNWSSVSSHCLSGVTQTCRTRSIEK-EDVAFFSYPFSFETFFHKEDESDGSLPQWPVLYFKVLSLDFWQRFRTEGYGYLVIPSTAGRHRMTCRTWRAVQRGTVAELRRFFIGGAPELEDISYVRIPGTFKGERLSRFGFRTQTTGSVTFTLNCI 489          
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Match: cdh13 (cadherin 13 [Source:Xenbase;Acc:XB-GENE-5752189])

HSP 1 Score: 233.417 bits (594), Expect = 3.205e-78
Identity = 108/176 (61.36%), Postives = 134/176 (76.14%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+HI+GQIIGASGFP++SLFCKWG++ GG W++LSG+ EGQTQVD PQ DD+A++ HPID+H AT GLQGWPKL  QVWH D  GR ELYGY F  +PS+PG H +   TWRP   ++ E++   FVGGGPQLK   L+Y G DR  LQT +MG VHL + VI RN +R+G+EC
Sbjct:    1 MAEVHIIGQIIGASGFPQHSLFCKWGVHTGGAWKLLSGVVEGQTQVDRPQNDDMAFWSHPIDMHFATKGLQGWPKLHLQVWHQDTFGRNELYGYSFLHIPSTPGTHSLLSPTWRP-LGTWQEQICQMFVGGGPQLKSSSLIYGGSDRYRLQTVAMGQVHLQLTVILRNFERYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Match: b9d1 (B9 protein domain 1 [Source:NCBI gene;Acc:549063])

HSP 1 Score: 91.2781 bits (225), Expect = 2.762e-22
Identity = 53/173 (30.64%), Postives = 86/173 (49.71%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQI--DDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFG 581
            +++ GQI  A  FPE + L+CK+   YG  W   SG+EEG +Q+            +  PI++   +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P SSS  +     F+G  P+   P +V  GE R   +  S G V ++ NV+T+++ + G
Sbjct:   15 LNVSGQIESAE-FPEFDDLYCKYSFVYGHDWAPTSGVEEGISQITSKSQGGKQALVWNFPIEITFKSTNPFGWPQIVISVYGPDAFGNDVVRGYGAVHLPFTPGRHARTIPMFVPESSSRLQRFTSWFMGRRPEFTDPKVVAQGEGREVTRVRSQGCVTVSFNVVTKDLKKLG 186          
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 72.4034 bits (176), Expect = 2.637e-14
Identity = 44/150 (29.33%), Postives = 70/150 (46.67%), Query Frame = 3
Query:   72 IHILGQIIGASGFPENSLFCKWGINYGGGW-----RVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVY 488
            + I G+I+ A  F  ++L+  + +     W     + LSG+ +   +      D +AYFC+P +  L       +      P LFF+V   D+  R  + GYG   +P +PG H +   TWRP       E+   F+GG P+L+  DL Y
Sbjct:  313 VFINGEIVSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQT-CRTKTRARDSVAYFCYPFNFELFLSEEADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELE--DLTY 459          
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 72.0182 bits (175), Expect = 2.943e-14
Identity = 44/150 (29.33%), Postives = 70/150 (46.67%), Query Frame = 3
Query:   72 IHILGQIIGASGFPENSLFCKWGINYGGGW-----RVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVY 488
            + I G+I+ A  F  ++L+  + +     W     + LSG+ +   +      D +AYFC+P +  L       +      P LFF+V   D+  R  + GYG   +P +PG H +   TWRP       E+   F+GG P+L+  DL Y
Sbjct:  313 VFINGEIVSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQT-CRTKTRARDSVAYFCYPFNFELFLSEEADSEETTQLPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELE--DLTY 459          
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Match: hnrnpr (heterogeneous nuclear ribonucleoprotein R [Source:Xenbase;Acc:XB-GENE-5726055])

HSP 1 Score: 68.9366 bits (167), Expect = 2.967e-13
Identity = 41/137 (29.93%), Postives = 65/137 (47.45%), Query Frame = 3
Query:   93 IGASGFPENSLFCKWGINYGGGW-----RVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVY 488
            + A  F  ++L+  + +     W     + LSG+ +   +      D +AYFC+P +  L     +  P LFF+V   D+  R  + GYG   +P +PG H +   TWRP       E+   F+GG P+L+  DL Y
Sbjct:  187 VSAQEFEYDNLYVHFFVELPKNWSSPGFQELSGVTQT-CRTKTRARDSVAYFCYPFNFELFLS--EELPVLFFEVLSLDFWQRYRVEGYGSVVLPGTPGMHVLTAQTWRPVELGVLTELKRFFIGGSPELE--DLTY 318          
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 233.802 bits (595), Expect = 1.499e-78
Identity = 110/176 (62.50%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGA+GF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L  QVW  D  GR +L GYGFC VPSSPG H++D  TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ R+ DR+G+EC
Sbjct:    1 MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRP-LGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 233.802 bits (595), Expect = 1.499e-78
Identity = 110/176 (62.50%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGA+GF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L  QVW  D  GR +L GYGFC VPSSPG H++D  TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ R+ DR+G+EC
Sbjct:    1 MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRP-LGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 114.005 bits (284), Expect = 2.986e-32
Identity = 56/96 (58.33%), Postives = 70/96 (72.92%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGF 350
            MAE+H++GQIIGA+GF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQG  ++        W G  +L G G 
Sbjct:    1 MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGGYRM------TGWGGAVKLRGAGL 90          
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Match: B9d2 (B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:2387643])

HSP 1 Score: 98.2117 bits (243), Expect = 1.248e-26
Identity = 47/72 (65.28%), Postives = 57/72 (79.17%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQG 278
            MAE+H++GQIIGA+GF E+SLFCKWGI+        +G+ EGQTQVD PQI D+AY+ HPIDLH AT GLQG
Sbjct:    1 MAEVHVIGQIIGATGFSESSLFCKWGIH--------TGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQG 64          
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Match: B9d1 (B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:1351471])

HSP 1 Score: 98.9821 bits (245), Expect = 1.910e-25
Identity = 59/176 (33.52%), Postives = 88/176 (50.00%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQID--DIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + I GQ+  A  FPE + L+CK+   YG  W   +GLEEG +Q+     D      +  PID+   +    GWP++   V+  D  G   + GYG   VP SPG HK  +  + P S+S  ++    F+G  P+   P +V  GE R   +  S G V L  NV+T++M + G + 
Sbjct:   11 LMITGQVESAQ-FPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGRHKRTIPMFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGYDT 185          
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q6DGZ1|B9D2_DANRE (B9 domain-containing protein 2 OS=Danio rerio OX=7955 GN=b9d2 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 7.348e-79
Identity = 110/175 (62.86%), Postives = 137/175 (78.29%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQIIGA+GFP+NSLFCKWG++ GG WR+LSGL EGQTQVD+PQ  D+AY+ HPIDLH  T GLQGWPKL  QVWH D  GR +LYGYG+  VPSSPG H++  +TWRP   S+ ++++  FVGGGPQL+ PDL+YSG DR  L T  MGTV L + +I R+ DR+G+E
Sbjct:    1 MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRP-LGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9BPU9|B9D2_HUMAN (B9 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=B9D2 PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 3.148e-78
Identity = 112/176 (63.64%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGASGF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L FQVW  D  GR +L GYGFC VPSSPG H++   TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ RN DR+G+EC
Sbjct:    1 MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRP-LGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q3UK10|B9D2_MOUSE (B9 domain-containing protein 2 OS=Mus musculus OX=10090 GN=B9d2 PE=1 SV=2)

HSP 1 Score: 233.802 bits (595), Expect = 1.049e-77
Identity = 110/176 (62.50%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGA+GF E+SLFCKWGI+ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L  QVW  D  GR +L GYGFC VPSSPG H++D  TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ R+ DR+G+EC
Sbjct:    1 MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRP-LGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P0C5J3|B9D2_RAT (B9 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=B9d2 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 8.108e-77
Identity = 109/176 (61.93%), Postives = 133/176 (75.57%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGA+GF E SLFCKWGI+ G  W++LSG+ EGQTQVD PQ  D+AY+ HPIDLH AT GLQGWP+L  QVW  D  GR +L GYGFC VPSSPG H++D  TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L TA+ GTVHL I ++ R+ DR+G+EC
Sbjct:    1 MAEVHVIGQIIGATGFSEGSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQTGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRP-LGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q56JY9|B9D2_BOVIN (B9 domain-containing protein 2 OS=Bos taurus OX=9913 GN=B9D2 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 2.368e-76
Identity = 107/176 (60.80%), Postives = 135/176 (76.70%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQI+GA+GF E+SLFCKWG++ G  W++LSG+ EGQTQVD PQI D+AY+ HPIDLH AT GLQGWP+L  QVW  D  GR +L GYGFC VPSSPG H++D  TWRP   S+ E++A  FVGGGPQL   D +YSG DR  L T S GTVHL ++++ R+ DR+G+EC
Sbjct:    1 MAEVHVIGQIMGATGFSESSLFCKWGVHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRP-LGSWREQLARAFVGGGPQLLHGDAIYSGADRYRLHTTSGGTVHLELSLLLRHFDRYGVEC 175          
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Match: A0A2C9K5E9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051996 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.845e-83
Identity = 118/176 (67.05%), Postives = 140/176 (79.55%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGASGFP++SLFCKWGI+ GGGW++LSGL EGQTQVDIPQ  + AYF HPIDLHLAT G+QGWP++ FQVWH D  GR ELYGYGF  +P+SPG H+ID  TWRP   +F E +   F+GGGP LK PDL+YSG DR  LQT +MG VHL I +I RN D+FGIEC
Sbjct:    1 MAEVHVIGQIIGASGFPDHSLFCKWGIHLGGGWKILSGLREGQTQVDIPQSHEAAYFAHPIDLHLATKGIQGWPRMHFQVWHQDAFGRNELYGYGFVHLPTSPGTHEIDCPTWRP-VGTFMESVTQFFLGGGPHLKNPDLIYSGADRYRLQTIAMGKVHLRIGIILRNFDKFGIEC 175          
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Match: A0A210PW12 (B9 domain-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09887 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.987e-83
Identity = 117/176 (66.48%), Postives = 140/176 (79.55%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQ++GASGFPE+SLFCKWGI+ GG W+VLSGL EGQTQVD PQ  + AY+ HPIDLHLAT GLQGWPK+ FQVWH D  GR ELYGYGFC +P+SPG H ID  TWRP +  F E+++  F+GGGPQLK PDL+YSG DR  L T +MG VHL + V+ RN DR+GIEC
Sbjct:    1 MAEVHVIGQLVGASGFPEHSLFCKWGIHIGGAWKVLSGLREGQTQVDNPQNQEAAYWSHPIDLHLATKGLQGWPKIHFQVWHQDSFGRNELYGYGFCHLPTSPGIHDIDCPTWRP-AGEFREQVSQHFLGGGPQLKNPDLIYSGADRYRLHTVAMGKVHLQLGVVLRNFDRYGIEC 175          
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Match: K1Q1C8 (B9 domain-containing protein 2 OS=Crassostrea gigas OX=29159 GN=CGI_10009435 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 5.622e-83
Identity = 116/176 (65.91%), Postives = 141/176 (80.11%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+HI+GQI+GASGFP++SLFCKWGIN GG W+ L+GL EGQTQVD PQ  D AY+ HPID+H AT GLQGWPK+ FQVWH D  GR ELYGYGFC VP++PG H+I+  TWRP S SF E+++  F+GGGPQLK PDL+YSG DR  L T +MG+VH+ + VI RN D++GIEC
Sbjct:   23 MAEVHIVGQIVGASGFPDHSLFCKWGINTGGAWKALAGLREGQTQVDTPQQHDAAYWAHPIDIHYATKGLQGWPKIHFQVWHQDSFGRNELYGYGFCHVPTTPGMHEIECPTWRP-SGSFKEQVSQYFLGGGPQLKNPDLIYSGADRYRLHTIAMGSVHVRLGVILRNFDKYGIEC 197          
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Match: A0A433U5N1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003078 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.740e-82
Identity = 115/176 (65.34%), Postives = 140/176 (79.55%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++GQIIGASGFP++SLFCKWGI+ GGGW++LSGL EGQTQVD PQ +D AYF HPID+H AT G+QGWP++ FQVWH D  GR ELYGYGF  +P+SPG H ID  TWRP + +F E ++  F+GGGP LK PDL+YSG DR  LQT +MG +HL I +I RN D+FGIEC
Sbjct:    1 MAEVHVIGQIIGASGFPDHSLFCKWGIHSGGGWKILSGLREGQTQVDNPQSEDAAYFAHPIDIHFATKGIQGWPRMHFQVWHQDAFGRNELYGYGFVHLPTSPGQHDIDCPTWRP-TGTFMESVSQFFLGGGPHLKNPDLIYSGADRYKLQTIAMGKIHLRIGIILRNFDKFGIEC 175          
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Match: A0A504YXX2 (B9 domain-containing protein 2 OS=Fasciola gigantica OX=46835 GN=FGIG_02115 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.581e-82
Identity = 111/175 (63.43%), Postives = 140/175 (80.00%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+H++GQI GASGFPE SLFCKWG+N GG WR+L G  +GQTQVD P + ++AYFCHPIDLH AT GLQGWPKL FQ+WH+DW GR ++YGYGFC +P+SPG+H+IDV  WRP  ++  + +  TF+GGGP L+R ++VY+  DR YLQT SMG VHL +NVI RN D+FG+E
Sbjct:    1 MAELHVIGQIHGASGFPEKSLFCKWGVNSGGAWRLLEGTPDGQTQVDCPVVGEVAYFCHPIDLHFATKGLQGWPKLHFQIWHYDWVGRYDIYGYGFCHLPTSPGYHEIDVAMWRPVGTA-IDHICSTFIGGGPHLRRLEIVYNPTDRFYLQTESMGYVHLKLNVILRNFDKFGVE 174          
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:103043513])

HSP 1 Score: 239.58 bits (610), Expect = 7.597e-81
Identity = 111/175 (63.43%), Postives = 138/175 (78.86%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQI+GASGFP++SLFCKWG++ GG WR+LSGL+EGQTQVD+PQI D AY+ HPIDLH  T GLQGWPKL  QVW+ D  GR ELYGYG+C +PSSPG H++   TWRP   ++ E++A  FVGGGPQL+ PDL+YSG DR  L T +MG V L + VI R+ DR+G+E
Sbjct:    1 MAELHIIGQIVGASGFPQSSLFCKWGVHTGGAWRLLSGLKEGQTQVDMPQIGDTAYWSHPIDLHYTTKGLQGWPKLHLQVWYQDSFGRCELYGYGYCHIPSSPGQHRLQCATWRP-LGTWQEQLAQMFVGGGPQLRSPDLIYSGADRYRLHTVAMGNVELDLCVILRHFDRYGVE 174          
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 89.7373 bits (221), Expect = 5.360e-22
Identity = 55/176 (31.25%), Postives = 85/176 (48.30%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFC--HPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + I GQI GA  FPE + L+CK+   YG  W   SGLEEG +Q+               P+D+   +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P S+S  ++     +G  P+   P +V  GE R   +  S G V L  ++IT++M + G + 
Sbjct:   11 LMISGQIEGAQ-FPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRGSTQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLQFSIITKDMKKLGYDT 185          
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:103038659])

HSP 1 Score: 84.7297 bits (208), Expect = 3.356e-20
Identity = 49/164 (29.88%), Postives = 78/164 (47.56%), Query Frame = 3
Query:  108 FPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFC--HPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            FPE + L+CK+   YG  W   SGLEEG +Q+               P+D+   +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P S+S  ++     +G  P+   P +V  GE R   +  S G V L  ++IT++M + G + 
Sbjct:    5 FPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRGSTQSLVWNFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTRTIPMFVPESTSRLQKFTSWLMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLQFSIITKDMKKLGYDT 168          
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 77.0258 bits (188), Expect = 3.518e-16
Identity = 47/175 (26.86%), Postives = 82/175 (46.86%), Query Frame = 3
Query:   69 EIHILGQIIGASGFPENSLFCKWGINYGGGW-----RVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL-------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVI 557
            +  ++G+   A G+  ++L+  + +     W     + LSG+ +      + + D++A+F +P            +   L  WP L+F+V   D+  R    GYG+  VPSSPG+H++   TWRP  +    E+   F+GG P+L+       G  R    T + G+V   +N I
Sbjct:  292 DFEMVGRSFSAQGYEYDNLYVNFFLELPNSWSSVPFQSLSGVTQTCRTRTLGK-DNVAFFSYPFSFESFFRKEDESEDSLPKWPVLYFKVLSLDFWQRYRTEGYGYLVVPSSPGYHRVTCHTWRPLQTGTVAELRRFFIGGAPELE-------GYHRFGFHTQTTGSVTFNLNCI 458          
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 73.1738 bits (178), Expect = 8.745e-15
Identity = 47/175 (26.86%), Postives = 81/175 (46.29%), Query Frame = 3
Query:   90 IIGASGFPENSLFCKWGINYGGGW-----RVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL-------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLK-----RPDLVYSGE--DRLYLQTASMGTVHLAINVI 557
            I  A G+  ++L+  + +     W     + LSG+ +      + + D++A+F +P            +   L  WP L+F+V   D+  R    GYG+  VPS+PG+H++   TWRP  +    E+   F+GG P+L+     R    + G+   R    T + G+V   +N I
Sbjct:  291 IFSARGYEYDNLYVNFFLELPNSWSGVPFQSLSGVTQTCRTRTLGK-DNVAFFSYPFSFESFFRKEDESADSLPKWPVLYFKVLSLDFWQRYRTEGYGYLVVPSTPGYHRVTCHTWRPLQTGTVAELRRFFIGGAPELEDISDVRIPGTFKGDHLSRFGFHTQTTGSVTFNLNCI 464          
BLAST of B9 domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: mks1 (MKS transition zone complex subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3813])

HSP 1 Score: 51.6026 bits (122), Expect = 2.267e-8
Identity = 31/128 (24.22%), Postives = 58/128 (45.31%), Query Frame = 3
Query:  216 DDIAYFCHPIDLHL-------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLV-----YSGE--DRLYLQTASMGTVHLAINVI 557
            +++A+F  P            + + L  WP L+ +V   D+  R    GY +  +PS PG+ ++    WRP       E+   F+GG  +L+ P  V     + G+   R   +T + G++ + ++ I
Sbjct:   81 NNVAHFSFPFSFEAFFKKEDESDVSLPHWPTLYMEVVSVDFWHRYRTEGYSYLLIPSMPGYSEVVCQAWRPVQPGLTSELRRFFIGGFNELEDPTYVAIPSTFQGDKLSRYGFKTETTGSITVKLHCI 208          
BLAST of B9 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO46834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 234.958 bits (598), Expect = 1.504e-79
Identity = 104/176 (59.09%), Postives = 139/176 (78.98%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++G++IGASGFP ++L+CKW ++  G W++++GL+EGQTQVD PQ ++ A + HPIDLH AT GL+GWPK  FQVWH D  GR E+YGYG+C VP+SPG HKID +TWRP + S+ E++   FVGG PQLK  D++YSG DR  L+T +MGTVHL + ++TRN D+FGIEC
Sbjct:    1 MAELHVIGEVIGASGFPSHNLYCKWSVHVEGSWKLIAGLKEGQTQVDNPQNEEEAKWGHPIDLHFATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRP-TGSWREQLRTFFVGGAPQLKSSDVIYSGSDRYRLKTEAMGTVHLQLGIVTRNFDKFGIEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO26199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP12])

HSP 1 Score: 234.958 bits (598), Expect = 1.504e-79
Identity = 104/176 (59.09%), Postives = 139/176 (78.98%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAE+H++G++IGASGFP ++L+CKW ++  G W++++GL+EGQTQVD PQ ++ A + HPIDLH AT GL+GWPK  FQVWH D  GR E+YGYG+C VP+SPG HKID +TWRP + S+ E++   FVGG PQLK  D++YSG DR  L+T +MGTVHL + ++TRN D+FGIEC
Sbjct:    1 MAELHVIGEVIGASGFPSHNLYCKWSVHVEGSWKLIAGLKEGQTQVDNPQNEEEAKWGHPIDLHFATKGLKGWPKFHFQVWHQDAYGRNEIYGYGYCHVPTSPGSHKIDCVTWRP-TGSWREQLRTFFVGGAPQLKSSDVIYSGSDRYRLKTEAMGTVHLQLGIVTRNFDKFGIEC 175          
BLAST of B9 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO44485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP3])

HSP 1 Score: 107.071 bits (266), Expect = 6.542e-29
Identity = 61/176 (34.66%), Postives = 92/176 (52.27%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDD--IAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + + GQI  AS FPE + L+CK+G  YG  W V SG EEG +QV    +D   I  +  PID+   +    GWP++    +  D   R  + GYG   VP++PG H  ++  + P SSS  +++    +G  P+   P +V  GE R   +  S G V +  NV+TR+M + G + 
Sbjct:   11 VMVSGQIESAS-FPEFDDLYCKFGFVYGQDWVVTSGWEEGISQVTKKSMDKRQIVVWNFPIDITFKSTSPFGWPQIVISCYGLDMFNRDVVRGYGAIHVPTTPGSHSREIPMFVPESSSKLQKLTSWLLGRRPEFVDPKVVAQGEGREVTRVRSQGRVKVTFNVVTRDMKKLGYDT 185          
BLAST of B9 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO39397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA52])

HSP 1 Score: 79.337 bits (194), Expect = 1.871e-17
Identity = 51/181 (28.18%), Postives = 85/181 (46.96%), Query Frame = 3
Query:   69 EIHILGQIIGASGFPENSLFCKWGINYGGGWR-----VLSGLEEGQTQVDIPQIDDIAYFCHPIDLHL------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDL----VYSGED---RLYLQTASMGTVHLAINVI 557
             + + G+I+ A GF  + L+  + +     W      ++SG+      V     DD+A+FC P +  L      +      WP LF +V   D   R    GYG+  +P+  G H+I + TWRP  +    E+   F+GG P+L+ P      V + E    + Y +TA+ G+V + +NV+
Sbjct:  189 RLDLFGEIVSAKGFEYDGLYVHFFLESPSEWTFEGSPIMSGVTH-TCNVKAYGEDDVAHFCFPFEYSLVYDARHSPDAFVKWPLLFVEVMSLDSWERHRTEGYGYTVIPNKAGSHEIVINTWRPIGNGPVPELRRFFIGGSPELEDPTYPQQPVATEEKVLSKFYFRTATSGSVTIRLNVV 368          
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Match: b9d2 (B9 domain containing 2 [Source:NCBI gene;Acc:436667])

HSP 1 Score: 240.736 bits (613), Expect = 6.874e-81
Identity = 111/175 (63.43%), Postives = 139/175 (79.43%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIE 587
            MAE+HI+GQI+GA GFP+NSLFCKWG++ GG WR+LSGL+EGQTQVDIPQ  ++AY+ HPIDL  AT GLQGWPKL  QVWH D  GR +LYGYG+C VP SPG H+I+ +TWRP   S+ E++   FVGGGPQL+ PDL+YSG DR  LQT +MGTV L + VI R+ D++G++
Sbjct:   30 MAELHIIGQILGARGFPQNSLFCKWGVHTGGAWRLLSGLKEGQTQVDIPQTGNMAYWSHPIDLQFATKGLQGWPKLHLQVWHQDSFGRCQLYGYGYCHVPCSPGTHRIECVTWRP-LGSWQEQITQMFVGGGPQLRSPDLIYSGADRYRLQTEAMGTVELELGVIMRHFDKYGVD 203          
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:101164060])

HSP 1 Score: 87.0409 bits (214), Expect = 4.896e-21
Identity = 50/175 (28.57%), Postives = 87/175 (49.71%), Query Frame = 3
Query:   72 IHILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQ-IDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            + + GQI GA+ FPE +SL+CK+   YG  W + +GLEEG TQ+     +     +  P++    +    GWP++   V+  D  G   + GYG   +P +PG H   +  + P  +   ++     +G  P+   P +V  GE R   +  S G V ++ ++ T++M + G + 
Sbjct:   11 LTVNGQIEGAN-FPEYDSLYCKYSYVYGHDWAITTGLEEGITQITCKSSLSRTLVWNFPLETTFKSTNPSGWPQIVISVYGPDVFGNDVVRGYGATHIPITPGQHTKTIPMFVPEPTWRLQKFTGWLLGRRPEYTDPKVVAQGEGREVTRVRSQGFVTVSFHITTKDMKKMGYDT 184          
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Match: mks1 (MKS transition zone complex subunit 1 [Source:NCBI gene;Acc:101171431])

HSP 1 Score: 67.0106 bits (162), Expect = 1.109e-12
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 3
Query:   84 GQIIGASGFPENSLFCKWGINYGGGWRVL---SGLEEGQT-QVDIPQIDDIAYFCHPIDLHLATM-------GLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYS 491
            G+I+ A GF  ++L+  + +     W  L   S  E  QT +    + +D+A+F +P       M       G+  WP ++F+V   D+  R    GYG+   P++PG H +   TWRP  +     M   F+GG  +L+    V +
Sbjct:  318 GEIVSAQGFEYDNLYIHFFLELPNNWSSLPSQSLSEVTQTCRTKSLEKEDVAFFSYPFTFEALYMKQKDGEEGIPQWPVIYFKVLSLDFWQRYRTEGYGYLLFPATPGKHTMTCHTWRPVQTGTVSAMKRFFIGGSAELEDDSYVRT 464          
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Match: mks1 (MKS transition zone complex subunit 1 [Source:NCBI gene;Acc:101171431])

HSP 1 Score: 66.6254 bits (161), Expect = 1.363e-12
Identity = 41/147 (27.89%), Postives = 68/147 (46.26%), Query Frame = 3
Query:   84 GQIIGASGFPENSLFCKWGINYGGGWRVL---SGLEEGQT-QVDIPQIDDIAYFCHPIDLHLATM-------GLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYS 491
            G+I+ A GF  ++L+  + +     W  L   S  E  QT +    + +D+A+F +P       M       G+  WP ++F+V   D+  R    GYG+   P++PG H +   TWRP  +     M   F+GG  +L+    V +
Sbjct:  318 GEIVSAQGFEYDNLYIHFFLELPNNWSSLPSQSLSEVTQTCRTKSLEKEDVAFFSYPFTFEALYMKQKDGEEGIPQWPVIYFKVLSLDFWQRYRTEGYGYLLFPATPGKHTMTCHTWRPVQTGTVSAMKRFFIGGSAELEDDSYVRT 464          
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Match: b9d1 (B9 domain containing 1 [Source:NCBI gene;Acc:101164060])

HSP 1 Score: 63.1586 bits (152), Expect = 4.626e-12
Identity = 51/179 (28.49%), Postives = 78/179 (43.58%), Query Frame = 3
Query:   78 ILGQIIGASGFPE-NSLFCKWGINYGGGWRVLSGLEEGQTQVDIP-QIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDV------LTWR----PSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDR--------LYLQTASMGTVHLAINV 554
            + GQI GA+ FPE +SL+CK+   YG  W + +GLEEG TQ+     +     +  P++    +    GWP++   V+  D  G   + GYG   +P +PG H   +       TWR      + S F    H  +    Q    D +  G  +         +L  AS   +HL +N 
Sbjct:   13 VNGQIEGAN-FPEYDSLYCKYSYVYGHDWAITTGLEEGITQITCKSSLSRTLVWNFPLETTFKSTNPSGWPQIVISVYGPDVFGNDVVRGYGATHIPITPGQHTKTIPMFVPEPTWRLQKFTGNKSSFSRFCHRLLPHHHQRHEEDGLRHGTVQPPDCWWRGRFLTQASNLFIHLYLNA 190          
BLAST of B9 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000000764.1 (SMESG000000764.1)

HSP 1 Score: 368.237 bits (944), Expect = 7.990e-132
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:   63 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 590
            MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC
Sbjct:    1 MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC 176          
BLAST of B9 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000017059.1 (SMESG000017059.1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.304e-24
Identity = 53/180 (29.44%), Postives = 86/180 (47.78%), Query Frame = 3
Query:   84 GQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQIDD--IAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYLQTASMGTVHLAINVITRNMDRFGIEC*FISLFNIN 617
            GQI  A     + ++C++   YG  W V++G+EE  TQ  +   D+  +  F  PID+   +    GWP++    +  D  G+  + GYG C +P  PG H   +  + P SS    +     +G  P+   P +V +GE R   +  + G V L+ NV+ +NM + G E    +  N N
Sbjct:   16 GQIESAEFPGFDYIWCRYCFEYGKDWNVVAGVEEAHTQTALKTPDERSLHIFNFPIDITFKSCYPSGWPQIIIYAYGVDVFGQDVIRGYGACHIPMQPGKHTRKIAMFVPESSQGLAKFNAWLMGKRPEFVNPRVVATGESRDVTKVRTQGFVTLSFNVVLKNMRKLGYEVVSQNAINSN 195          
BLAST of B9 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.656e-13
Identity = 51/187 (27.27%), Postives = 86/187 (45.99%), Query Frame = 3
Query:   72 IHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEE--GQTQVDIPQIDDIAYFCH---PIDLHL-----------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLY---------LQTASMGTVHLAINVI 557
            + + G+I  A  F   +++ ++ ++    W ++S LE+  G TQ+   +     Y  H   PI+  +           A   ++ WP ++ +V+  D   R    GYG+  +P +PG HK  V  WRP S+S   E+   FVGG  +L+  DL ++     +          +TAS G V L +N I
Sbjct:  285 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 467          
BLAST of B9 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000058562.1 (SMESG000058562.1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.847e-13
Identity = 51/187 (27.27%), Postives = 86/187 (45.99%), Query Frame = 3
Query:   72 IHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEE--GQTQVDIPQIDDIAYFCH---PIDLHL-----------ATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVPSSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLY---------LQTASMGTVHLAINVI 557
            + + G+I  A  F   +++ ++ ++    W ++S LE+  G TQ+   +     Y  H   PI+  +           A   ++ WP ++ +V+  D   R    GYG+  +P +PG HK  V  WRP S+S   E+   FVGG  +L+  DL ++     +          +TAS G V L +N I
Sbjct:  285 LFVSGEIAYAYDFEHQNIYAQYFVDVPEDW-IVSNLEQLTGITQLSRGKTTKTGYLSHFGFPIEFDMLYQKNTYKENEADDSIK-WPVIYIEVFSIDSWTRYRTEGYGYIQIPPTPGVHKRVVPCWRPVSNSITNELRRYFVGGSAELE--DLTFTSIPATFEGKYLSKYGFRTASTGYVVLKMNCI 467          
The following BLAST results are available for this feature:
BLAST of B9 domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B9D26.556e-7963.64B9 domain containing 2 [Source:HGNC Symbol;Acc:HGN... [more]
B9D11.473e-2432.95B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D12.145e-1833.33B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D13.190e-1833.33B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
B9D14.599e-1833.33B9 domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mksr-21.571e-5547.73MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
mksr-15.980e-1124.22MecKel Syndrome 1 (MKS1)-Related [Source:UniProtK... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
B9d28.152e-4739.43gene:FBgn0261683 transcript:FBtr0303078[more]
B9d19.301e-820.33gene:FBgn0038342 transcript:FBtr0083145[more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b9d29.734e-8062.86B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d29.734e-8062.86B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d11.254e-2230.29B9 protein domain 1 [Source:NCBI gene;Acc:554150][more]
b9d12.313e-1627.46B9 protein domain 1 [Source:NCBI gene;Acc:554150][more]
mks13.157e-1426.26MKS transition zone complex subunit 1 [Source:ZFIN... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh133.205e-7861.36cadherin 13 [Source:Xenbase;Acc:XB-GENE-5752189][more]
b9d12.762e-2230.64B9 protein domain 1 [Source:NCBI gene;Acc:549063][more]
hnrnpr2.637e-1429.33heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr2.943e-1429.33heterogeneous nuclear ribonucleoprotein R [Source:... [more]
hnrnpr2.967e-1329.93heterogeneous nuclear ribonucleoprotein R [Source:... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B9d21.499e-7862.50B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d21.499e-7862.50B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d22.986e-3258.33B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d21.248e-2665.28B9 protein domain 2 [Source:MGI Symbol;Acc:MGI:238... [more]
B9d11.910e-2533.52B9 protein domain 1 [Source:MGI Symbol;Acc:MGI:135... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DGZ1|B9D2_DANRE7.348e-7962.86B9 domain-containing protein 2 OS=Danio rerio OX=7... [more]
sp|Q9BPU9|B9D2_HUMAN3.148e-7863.64B9 domain-containing protein 2 OS=Homo sapiens OX=... [more]
sp|Q3UK10|B9D2_MOUSE1.049e-7762.50B9 domain-containing protein 2 OS=Mus musculus OX=... [more]
sp|P0C5J3|B9D2_RAT8.108e-7761.93B9 domain-containing protein 2 OS=Rattus norvegicu... [more]
sp|Q56JY9|B9D2_BOVIN2.368e-7660.80B9 domain-containing protein 2 OS=Bos taurus OX=99... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K5E91.845e-8367.05Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210PW122.987e-8366.48B9 domain-containing protein 2 OS=Mizuhopecten yes... [more]
K1Q1C85.622e-8365.91B9 domain-containing protein 2 OS=Crassostrea giga... [more]
A0A433U5N11.740e-8265.34Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A504YXX22.581e-8263.43B9 domain-containing protein 2 OS=Fasciola giganti... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b9d27.597e-8163.43B9 domain containing 2 [Source:NCBI gene;Acc:10304... [more]
b9d15.360e-2231.25B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
b9d13.356e-2029.88B9 domain containing 1 [Source:NCBI gene;Acc:10303... [more]
mks13.518e-1626.86MKS transition zone complex subunit 1 [Source:ZFIN... [more]
mks18.745e-1526.86MKS transition zone complex subunit 1 [Source:ZFIN... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mks12.267e-824.22MKS transition zone complex subunit 1 [Source:ZFIN... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO468341.504e-7959.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261991.504e-7959.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444856.542e-2934.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393971.871e-1728.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b9d26.874e-8163.43B9 domain containing 2 [Source:NCBI gene;Acc:43666... [more]
b9d14.896e-2128.57B9 domain containing 1 [Source:NCBI gene;Acc:10116... [more]
mks11.109e-1227.89MKS transition zone complex subunit 1 [Source:NCBI... [more]
mks11.363e-1227.89MKS transition zone complex subunit 1 [Source:NCBI... [more]
b9d14.626e-1228.49B9 domain containing 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of B9 domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000000764.17.990e-132100.00SMESG000000764.1[more]
SMESG000017059.14.304e-2429.44SMESG000017059.1[more]
SMESG000058562.15.656e-1327.27SMESG000058562.1[more]
SMESG000058562.15.847e-1327.27SMESG000058562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002554 ID=SMED30002554|Name=B9 domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=639bp
AACAAATATGTATGGCATTTTTTAAAATAAATTTAAATAATTGACTACAA
TTATTCCTTTTAATGGCTGAAATTCACATTTTGGGTCAAATTATTGGAGC
AAGTGGTTTTCCAGAAAATTCATTATTCTGCAAATGGGGGATAAATTATG
GTGGTGGGTGGCGTGTTTTAAGCGGACTAGAAGAAGGCCAAACCCAAGTT
GATATACCTCAGATTGATGATATTGCATATTTCTGCCATCCAATTGACCT
CCATTTAGCTACAATGGGCTTACAAGGATGGCCTAAACTATTTTTCCAAG
TATGGCATCATGATTGGTGTGGAAGACAGGAATTATATGGTTACGGATTT
TGTTCCGTTCCATCTTCACCTGGATTCCACAAAATTGACGTTTTGACATG
GAGACCATCATCGTCGTCATTTTTTGAAGAAATGGCACATACTTTTGTCG
GTGGTGGTCCTCAGTTGAAACGCCCAGATTTGGTTTACAGTGGTGAAGAT
AGACTCTATTTGCAAACGGCCAGCATGGGTACTGTACACCTGGCAATAAA
TGTTATTACAAGGAATATGGACAGATTTGGAATCGAATGTTGATTTATTT
CTCTTTTCAATATAAATATATATTTTGGTATTTTTAAAA
back to top

protein sequence of SMED30002554-orf-1

>SMED30002554-orf-1 ID=SMED30002554-orf-1|Name=SMED30002554-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MAEIHILGQIIGASGFPENSLFCKWGINYGGGWRVLSGLEEGQTQVDIPQ
IDDIAYFCHPIDLHLATMGLQGWPKLFFQVWHHDWCGRQELYGYGFCSVP
SSPGFHKIDVLTWRPSSSSFFEEMAHTFVGGGPQLKRPDLVYSGEDRLYL
QTASMGTVHLAINVITRNMDRFGIEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR010796B9_dom
Vocabulary: biological process
TermDefinition
GO:0001736establishment of planar polarity
GO:0007163establishment or maintenance of cell polarity
GO:0030030cell projection organization
GO:0036372opsin transport
GO:0060271cilium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0005929cilium
GO:0036038MKS complex
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0043015gamma-tubulin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010796B9 domainPFAMPF07162B9-C2coord: 4..165
e-value: 1.8E-55
score: 187.7
IPR010796B9 domainPANTHERPTHR12968ENDOTHELIAL PROTEIN B9-RELATEDcoord: 1..176
IPR010796B9 domainPROSITEPS51381B9coord: 2..118
score: 44.894
NoneNo IPR availablePANTHERPTHR12968:SF2B9 DOMAIN-CONTAINING PROTEIN 2coord: 1..176