Syntaxin

Overview
NameSyntaxin
Smed IDSMED30002549
Length (bp)1248
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Syntaxin (SMED30002549) t-SNE clustered cells

Violin plots show distribution of expression levels for Syntaxin (SMED30002549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Syntaxin (SMED30002549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Syntaxin (SMED30002549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002549h1SMcG0020349 SmedASXL_067273SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30002549h1SMcG0020349 SmedASXL_010530SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30002549h1SMcG0020349 Contig53860newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002549h1SMcG0020349 Contig53860uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30002549h1SMcG0020349 dd_Smed_v4_8453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002549h1SMcG0020349 dd_Smed_v4_8453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002549h1SMcG0020349 dd_Smed_v4_8453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002549h1SMcG0020349 dd_Smed_v4_8453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002549h1SMcG0020349 dd_Smed_v4_8453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30002549h1SMcG0020349 dd_Smed_v6_8453_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Syntaxin vs. Ensembl Human
Match: STX1B (syntaxin 1B [Source:HGNC Symbol;Acc:HGNC:18539])

HSP 1 Score: 332.798 bits (852), Expect = 1.714e-112
Identity = 163/272 (59.93%), Postives = 209/272 (76.84%), Query Frame = 1
Query:  115 INVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+G++      G  G
Sbjct:   21 VHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGVVLASSIGGTLG 287          
BLAST of Syntaxin vs. Ensembl Human
Match: STX1A (syntaxin 1A [Source:HGNC Symbol;Acc:HGNC:11433])

HSP 1 Score: 328.561 bits (841), Expect = 8.166e-111
Identity = 165/263 (62.74%), Postives = 212/263 (80.61%), Query Frame = 1
Query:  133 QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKG 921
            ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK+IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF   I+ D++ +KQ+L++IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K I+I +C     C+++GI+      G
Sbjct:   28 RFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVILGIVIASTVGG 285          
BLAST of Syntaxin vs. Ensembl Human
Match: STX1B (syntaxin 1B [Source:HGNC Symbol;Acc:HGNC:18539])

HSP 1 Score: 315.079 bits (806), Expect = 1.174e-105
Identity = 154/242 (63.64%), Postives = 194/242 (80.17%), Query Frame = 1
Query:  115 INVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARK 840
            ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+
Sbjct:   21 VHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARR 262          
BLAST of Syntaxin vs. Ensembl Human
Match: STX2 (syntaxin 2 [Source:HGNC Symbol;Acc:HGNC:3403])

HSP 1 Score: 307.375 bits (786), Expect = 1.568e-102
Identity = 150/284 (52.82%), Postives = 216/284 (76.06%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGII 900
            +D L  L A +  D+    DT + V+   +M++FF+QVE+IR  ID+I  +V++VK  HS ILS+P+ + K K +LE+   EIKK ANK+R KLK IEQS +QDE+ +++S DLRI++TQ+S +SR F+E MA+YN+AQ  +R+  K RI+RQ+EI  R  +++ELE+MLESG P+IFT +I++D+   +Q+L +IE+RH+DIMKLE SI+ELH+MF+DMAM VE+QGEMI+ IE NV  A DY+E AK +TKKA+KYQS AR+K++ I +CV VL+ +++GII
Sbjct:    2 RDRLPDLTACRKNDD---GDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLL-VILGII 281          
BLAST of Syntaxin vs. Ensembl Human
Match: STX2 (syntaxin 2 [Source:HGNC Symbol;Acc:HGNC:3403])

HSP 1 Score: 302.753 bits (774), Expect = 9.433e-101
Identity = 152/289 (52.60%), Postives = 215/289 (74.39%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAA-RKKMIIIGVCVAV--LICIVIGIIAG 906
            +D L  L A +  D+    DT + V+   +M++FF+QVE+IR  ID+I  +V++VK  HS ILS+P+ + K K +LE+   EIKK ANK+R KLK IEQS +QDE+ +++S DLRI++TQ+S +SR F+E MA+YN+AQ  +R+  K RI+RQ+EI  R  +++ELE+MLESG P+IFT +I++D+   +Q+L +IE+RH+DIMKLE SI+ELH+MF+DMAM VE+QGEMI+ IE NV  A DY+E AK +TKKA+KYQS A RKK III V V +  +I ++IG+  G
Sbjct:    2 RDRLPDLTACRKNDD---GDTVVVVEKDHFMDDFFHQVEEIRNSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGLSVG 287          
BLAST of Syntaxin vs. Ensembl Celegans
Match: unc-64 (Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;Acc:O16000])

HSP 1 Score: 350.132 bits (897), Expect = 9.525e-120
Identity = 178/286 (62.24%), Postives = 223/286 (77.97%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGII 900
            MTKD L+ALKA Q EDE    D  ++  +AQYM EFF QVE+IR  +D I N V++VK KHS ILS+P  D+KTK +L+E MA IK+ ANKVR KLK IE +I+ DE Q   +ADLRI+KTQ+ST+SR F+EVM DYNK Q  YR+ CK RI+RQ++IA +++ +E+LE+M+ESGNP +FTQ I+TDT QAKQ+LADIEARH DIMKLE SI+ELHDMF+DMAMLVESQGEM+DRIEYNVE A ++++ A ADTKKAV+YQS AR+K I I V   +LI  +I  I
Sbjct:    1 MTKDRLSALKAAQSEDEQD-DDMHMDTGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKHSAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIDHDE-QGAGNADLRIRKTQHSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQGIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEHAKEFVDRAVADTKKAVQYQSKARRKKICILVTGVILITGLIIFI 284          
BLAST of Syntaxin vs. Ensembl Celegans
Match: unc-64 (Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;Acc:O16000])

HSP 1 Score: 342.043 bits (876), Expect = 1.828e-116
Identity = 171/267 (64.04%), Postives = 214/267 (80.15%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            MTKD L+ALKA Q EDE    D  ++  +AQYM EFF QVE+IR  +D I N V++VK KHS ILS+P  D+KTK +L+E MA IK+ ANKVR KLK IE +I+ DE Q   +ADLRI+KTQ+ST+SR F+EVM DYNK Q  YR+ CK RI+RQ++IA +++ +E+LE+M+ESGNP +FTQ I+TDT QAKQ+LADIEARH DIMKLE SI+ELHDMF+DMAMLVESQGEM+DRIEYNVE A ++++ A ADTKKAV+YQS AR+K
Sbjct:    1 MTKDRLSALKAAQSEDEQD-DDMHMDTGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKHSAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIDHDE-QGAGNADLRIRKTQHSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQGIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEHAKEFVDRAVADTKKAVQYQSKARRK 265          
BLAST of Syntaxin vs. Ensembl Celegans
Match: unc-64 (Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;Acc:O16000])

HSP 1 Score: 342.043 bits (876), Expect = 1.828e-116
Identity = 171/267 (64.04%), Postives = 214/267 (80.15%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            MTKD L+ALKA Q EDE    D  ++  +AQYM EFF QVE+IR  +D I N V++VK KHS ILS+P  D+KTK +L+E MA IK+ ANKVR KLK IE +I+ DE Q   +ADLRI+KTQ+ST+SR F+EVM DYNK Q  YR+ CK RI+RQ++IA +++ +E+LE+M+ESGNP +FTQ I+TDT QAKQ+LADIEARH DIMKLE SI+ELHDMF+DMAMLVESQGEM+DRIEYNVE A ++++ A ADTKKAV+YQS AR+K
Sbjct:    1 MTKDRLSALKAAQSEDEQD-DDMHMDTGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKHSAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIDHDE-QGAGNADLRIRKTQHSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQGIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEHAKEFVDRAVADTKKAVQYQSKARRK 265          
BLAST of Syntaxin vs. Ensembl Celegans
Match: syx-3 (Putative syntaxin-3 [Source:UniProtKB/Swiss-Prot;Acc:Q20024])

HSP 1 Score: 114.775 bits (286), Expect = 1.003e-28
Identity = 79/281 (28.11%), Postives = 143/281 (50.89%), Query Frame = 1
Query:  103 PDTSINVDSAQYMNE------FFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK--MIIIGVCVAVLICIVI--GIIAGFVP 915
            P    +V+S   +N+      F  +  +IR  +  ++   D V   H  +LS+P  D +   +L+         A +++  LK + +  E       +   +R K  Q  +I + F  +M ++N+ Q  Y++  K +I   ++I   ++S+EE+E+ + SGN +  T+ +M   N+ K    ++++R  ++  LE+ + EL  MF D+ ++V SQGEM+D I  +VE A +Y + A+ + ++A   Q  ARK    IIIG  +AVLI I+     +  F P
Sbjct:   26 PARKYDVESQPLINQDADFEMFLERCSNIRGGLKSLEEDYDAVVQLHGALLSTPGADSENSNKLKSHNQMFFSKAEQIKNSLKILSE--ETSRIPTTACGIMRAKSDQVKSIYKTFENIMLNFNREQDEYKEKAKRKIVDYLKIRNMQLSDEEIENAVSSGNLSEVTKGVMLALNEKKALYDEVKSRADELKNLERQMGELAQMFHDLHIMVVSQGEMVDSIVNSVENATEYAKQARGNVEEARNLQKRARKMKVCIIIGSIIAVLILILFIQSAVCHFTP 304          
BLAST of Syntaxin vs. Ensembl Celegans
Match: syx-2 (Putative syntaxin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20574])

HSP 1 Score: 92.8189 bits (229), Expect = 5.580e-21
Identity = 58/244 (23.77%), Postives = 131/244 (53.69%), Query Frame = 1
Query:  127 SAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLE-SGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIII 855
            +A+Y++  F   E++R  I  ++  ++ ++     +L+    D + K  LE  +  I++    +R  ++  E    +   Q +S  + R+++ Q   +  N  +++  +N+    Y+     R++RQ++   + +++E++  ++E SG+  +F +E+   +   + +  D++ RH +I  LE +I  L ++FLD+  L E+Q EM+  I+ NVE  ++ ++   A+ K AV+Y+ +A +K I +
Sbjct:   29 AAEYVDRRF---EEVRNAIASVRGEIEKLRRDQQHVLALTIADPRDKNILENQIGTIRRRTGDLRKLVRQAEDDFLEFTKQVQSVTEKRMRQNQLELLKDNLNKLINLFNETHQDYKSRVSVRVRRQLQTVGQDLTDEDINRIMENSGSEQLFFREVNPLSVSGQAAYEDVKKRHGEIKDLENNIAMLEEIFLDLQHLTEAQDEMVTNIDNNVENGLEQVKQGSANVKTAVEYKKSAMRKKICV 269          
BLAST of Syntaxin vs. Ensembl Fly
Match: Syx1A (gene:FBgn0013343 transcript:FBtr0084588)

HSP 1 Score: 352.829 bits (904), Expect = 1.076e-120
Identity = 182/290 (62.76%), Postives = 234/290 (80.69%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSA-QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGF 909
            MTKD LAAL A Q +DE+   + ++NVD    YM++FF QVE+IR MID++Q+ V++VK KHS ILS+P  DEKTK +LE+ MA+IKKNAN+VR KLK IEQ+IEQ+E Q+KSSADLRI+KTQ+ST+SR F+EVM +YN+ Q  YR+ CK RI+RQ+EI  R  +++ELE MLE GN ++FTQ I+ +T QAKQ+LADIEARHQDIMKLE SIKELHDMF+DMAMLVESQGEMIDRIEY+VE A+DY++TA  DTKKA+KYQS AR+K I+I +C+ VL  +    ++ +
Sbjct:    1 MTKDRLAALHAAQSDDEEE-TEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSY 289          
BLAST of Syntaxin vs. Ensembl Fly
Match: Syx1A (gene:FBgn0013343 transcript:FBtr0392904)

HSP 1 Score: 352.829 bits (904), Expect = 1.076e-120
Identity = 182/290 (62.76%), Postives = 234/290 (80.69%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSA-QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGF 909
            MTKD LAAL A Q +DE+   + ++NVD    YM++FF QVE+IR MID++Q+ V++VK KHS ILS+P  DEKTK +LE+ MA+IKKNAN+VR KLK IEQ+IEQ+E Q+KSSADLRI+KTQ+ST+SR F+EVM +YN+ Q  YR+ CK RI+RQ+EI  R  +++ELE MLE GN ++FTQ I+ +T QAKQ+LADIEARHQDIMKLE SIKELHDMF+DMAMLVESQGEMIDRIEY+VE A+DY++TA  DTKKA+KYQS AR+K I+I +C+ VL  +    ++ +
Sbjct:    1 MTKDRLAALHAAQSDDEEE-TEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSY 289          
BLAST of Syntaxin vs. Ensembl Fly
Match: Syx1A (gene:FBgn0013343 transcript:FBtr0303161)

HSP 1 Score: 353.214 bits (905), Expect = 1.159e-120
Identity = 182/290 (62.76%), Postives = 234/290 (80.69%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSA-QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGF 909
            MTKD LAAL A Q +DE+   + ++NVD    YM++FF QVE+IR MID++Q+ V++VK KHS ILS+P  DEKTK +LE+ MA+IKKNAN+VR KLK IEQ+IEQ+E Q+KSSADLRI+KTQ+ST+SR F+EVM +YN+ Q  YR+ CK RI+RQ+EI  R  +++ELE MLE GN ++FTQ I+ +T QAKQ+LADIEARHQDIMKLE SIKELHDMF+DMAMLVESQGEMIDRIEY+VE A+DY++TA  DTKKA+KYQS AR+K I+I +C+ VL  +    ++ +
Sbjct:    1 MTKDRLAALHAAQSDDEEE-TEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSY 289          
BLAST of Syntaxin vs. Ensembl Fly
Match: Syx4 (gene:FBgn0024980 transcript:FBtr0332496)

HSP 1 Score: 76.2554 bits (186), Expect = 2.005e-15
Identity = 43/163 (26.38%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  364 AQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMII 852
            A++  S + R+K+T +  + + FI +          Y    K  ++   +I   + S +E+E ++E+    +F    + +T + +Q+L ++  R  ++ +LEKSI+E+H +F+ +  LV  Q E+I R+E++ +QA  +++    +  +A ++Q  ARKK I+
Sbjct:   76 AENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIM 238          
BLAST of Syntaxin vs. Ensembl Fly
Match: Syx4 (gene:FBgn0024980 transcript:FBtr0070494)

HSP 1 Score: 76.2554 bits (186), Expect = 5.185e-15
Identity = 43/163 (26.38%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  364 AQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMII 852
            A++  S + R+K+T +  + + FI +          Y    K  ++   +I   + S +E+E ++E+    +F    + +T + +Q+L ++  R  ++ +LEKSI+E+H +F+ +  LV  Q E+I R+E++ +QA  +++    +  +A ++Q  ARKK I+
Sbjct:  152 AENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIM 314          
BLAST of Syntaxin vs. Ensembl Zebrafish
Match: stx1b (syntaxin 1B [Source:ZFIN;Acc:ZDB-GENE-000330-4])

HSP 1 Score: 334.339 bits (856), Expect = 2.678e-113
Identity = 168/294 (57.14%), Postives = 219/294 (74.49%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            KD    L++ +  D+D   +  ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS ARKK I+I +C     C+++G++      G  G
Sbjct:    2 KDRTQELRSAKDSDDD---EEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNTTQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHTEIIKLENSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSQARKKKIMIIIC-----CVILGVVLASSIGGTLG 287          
BLAST of Syntaxin vs. Ensembl Zebrafish
Match: stx1b (syntaxin 1B [Source:ZFIN;Acc:ZDB-GENE-000330-4])

HSP 1 Score: 331.643 bits (849), Expect = 2.096e-112
Identity = 163/272 (59.93%), Postives = 209/272 (76.84%), Query Frame = 1
Query:  115 INVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS ARKK I+I +C     C+++G++      G  G
Sbjct:   14 VHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNTTQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHTEIIKLENSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSQARKKKIMIIIC-----CVILGVVLASSIGGTLG 280          
BLAST of Syntaxin vs. Ensembl Zebrafish
Match: stx1a (syntaxin 1A (brain) [Source:ZFIN;Acc:ZDB-GENE-100802-1])

HSP 1 Score: 284.263 bits (726), Expect = 1.203e-93
Identity = 139/256 (54.30%), Postives = 192/256 (75.00%), Query Frame = 1
Query:  136 YMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIA 903
            +M+EFF QVE+IR  ID +   V +VK  HS  L+SP+ DEKTKT+ EE M +IK  ANKVR +L++I+QSIE +EA +  SAD+RI+KTQ+ST+SR F+EVM++YN AQ  YR+ CK RI+RQ+EI  RK + EELE +LES NP+IFT  +  D +  KQ++ +IE RH +I++LE  I+EL DMF+D+A+LVE+QGE+I+ IE NV  A +Y+E AK +TK A+K Q  +R K+I+IG CV+V  C++I IIA
Sbjct:   32 FMDEFFEQVEEIREFIDSLAEKVGEVKRNHSATLASPNPDEKTKTEFEELMNDIKTLANKVRSRLQHIQQSIEHEEAFNGQSADVRIRKTQHSTLSRKFVEVMSEYNAAQSEYRERCKGRIQRQLEITGRKTTKEELETILESDNPSIFTTGVFMDCSITKQAMNEIETRHNEIIQLESCIRELQDMFVDLAVLVENQGELINNIETNVSSAQEYVEKAKEETKAAIKIQKTSRTKLILIGGCVSV--CVLILIIA 285          
BLAST of Syntaxin vs. Ensembl Zebrafish
Match: stx2b (syntaxin 2b [Source:ZFIN;Acc:ZDB-GENE-091204-424])

HSP 1 Score: 280.796 bits (717), Expect = 3.665e-92
Identity = 132/244 (54.10%), Postives = 194/244 (79.51%), Query Frame = 1
Query:  112 SINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            +++++   +M +FF +VE++R +I++I + VD+VK K+S ILS+P+ DEKTK +LE+   EIKK+AN V+  LK++ QS+  DE  +++S D RI+KTQY+ +S  F+EVM  YN+AQV++R+  K+RI+RQ+EI  +  +NEELE+MLE+GNP+IFT +I++D+   +Q+L +IE+RHQDI++LE SIKELHDMF+DMAMLVE+QGEMID IE NV  AV+Y+  AK +TKKAV+YQ+ AR+K
Sbjct:   12 AVSMERNDFMQDFFQKVEEVRRVIEKISSLVDEVKKKYSVILSAPNPDEKTKEELEQLTVEIKKHANYVQKSLKSMHQSLPSDEQVNQASVDARIQKTQYTNLSHKFVEVMTQYNEAQVSFREKSKSRIQRQLEITGKITTNEELEEMLETGNPSIFTSDIISDSQITRQALNEIESRHQDILRLESSIKELHDMFVDMAMLVETQGEMIDNIEKNVHNAVEYVGQAKVETKKAVRYQTRARRK 255          
BLAST of Syntaxin vs. Ensembl Zebrafish
Match: stx2b (syntaxin 2b [Source:ZFIN;Acc:ZDB-GENE-091204-424])

HSP 1 Score: 275.404 bits (703), Expect = 2.645e-90
Identity = 132/237 (55.70%), Postives = 189/237 (79.75%), Query Frame = 1
Query:  136 YMNEFFNQV-EDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            +M +FF +V E++R +I++I + VD+VK K+S ILS+P+ DEKTK +LE+   EIKK+AN V+  LK++ QS+  DE  +++S D RI+KTQY+ +S  F+EVM  YN+AQV++R+  K+RI+RQ+EI  +  +NEELE+MLE+GNP+IFT +I++D+   +Q+L +IE+RHQDI++LE SIKELHDMF+DMAMLVE+QGEMID IE NV  AV+Y+  AK +TKKAV+YQ+ AR+K
Sbjct:    6 FMQDFFQKVVEEVRRVIEKISSLVDEVKKKYSVILSAPNPDEKTKEELEQLTVEIKKHANYVQKSLKSMHQSLPSDEQVNQASVDARIQKTQYTNLSHKFVEVMTQYNEAQVSFREKSKSRIQRQLEITGKITTNEELEEMLETGNPSIFTSDIISDSQITRQALNEIESRHQDILRLESSIKELHDMFVDMAMLVETQGEMIDNIEKNVHNAVEYVGQAKVETKKAVRYQTRARRK 242          
BLAST of Syntaxin vs. Ensembl Xenopus
Match: slc7a6os (solute carrier family 7 member 6 opposite strand [Source:Xenbase;Acc:XB-GENE-5805704])

HSP 1 Score: 355.525 bits (911), Expect = 2.031e-121
Identity = 176/294 (59.86%), Postives = 227/294 (77.21%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            KD    L+A +  DED   + ++++D  ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK IEQSIEQ+EA ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF+  I+ D+N  KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G  G
Sbjct:    2 KDRTRELRAAKDSDEDD--EVTVSLDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKAELEELMSDIKKTANKVRSKLKGIEQSIEQEEAMNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFSSGIIMDSNITKQALNEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTFGGIFG 288          
BLAST of Syntaxin vs. Ensembl Xenopus
Match: slc7a6os (solute carrier family 7 member 6 opposite strand [Source:Xenbase;Acc:XB-GENE-5805704])

HSP 1 Score: 352.443 bits (903), Expect = 4.846e-120
Identity = 173/287 (60.28%), Postives = 223/287 (77.70%), Query Frame = 1
Query:   70 KATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            K T  +D D   + ++++D  ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK IEQSIEQ+EA ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF+  I+ D+N  KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G  G
Sbjct:   20 KRTYAKDSDEDDEVTVSLDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKAELEELMSDIKKTANKVRSKLKGIEQSIEQEEAMNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFSSGIIMDSNITKQALNEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTFGGIFG 301          
BLAST of Syntaxin vs. Ensembl Xenopus
Match: slc7a6os (solute carrier family 7 member 6 opposite strand [Source:Xenbase;Acc:XB-GENE-5805704])

HSP 1 Score: 349.362 bits (895), Expect = 3.634e-119
Identity = 172/281 (61.21%), Postives = 221/281 (78.65%), Query Frame = 1
Query:   88 DEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            DED   + ++++D  ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK IEQSIEQ+EA ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF+  I+ D+N  KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G  G
Sbjct:    9 DEDD--EVTVSLDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKAELEELMSDIKKTANKVRSKLKGIEQSIEQEEAMNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFSSGIIMDSNITKQALNEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTFGGIFG 282          
BLAST of Syntaxin vs. Ensembl Xenopus
Match: slc7a6os (solute carrier family 7 member 6 opposite strand [Source:Xenbase;Acc:XB-GENE-5805704])

HSP 1 Score: 349.362 bits (895), Expect = 4.790e-119
Identity = 172/281 (61.21%), Postives = 221/281 (78.65%), Query Frame = 1
Query:   88 DEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            DED   + ++++D  ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK IEQSIEQ+EA ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF+  I+ D+N  KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G  G
Sbjct:   11 DEDD--EVTVSLDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKAELEELMSDIKKTANKVRSKLKGIEQSIEQEEAMNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFSSGIIMDSNITKQALNEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTFGGIFG 284          
BLAST of Syntaxin vs. Ensembl Xenopus
Match: slc7a6os (solute carrier family 7 member 6 opposite strand [Source:Xenbase;Acc:XB-GENE-5805704])

HSP 1 Score: 348.977 bits (894), Expect = 5.489e-119
Identity = 172/281 (61.21%), Postives = 221/281 (78.65%), Query Frame = 1
Query:   88 DEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            DED   + ++++D  ++M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK IEQSIEQ+EA ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF+  I+ D+N  KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G  G
Sbjct:    8 DEDD--EVTVSLDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKAELEELMSDIKKTANKVRSKLKGIEQSIEQEEAMNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFSSGIIMDSNITKQALNEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTFGGIFG 281          
BLAST of Syntaxin vs. Ensembl Mouse
Match: Stx1b (syntaxin 1B [Source:MGI Symbol;Acc:MGI:1930705])

HSP 1 Score: 332.798 bits (852), Expect = 1.177e-112
Identity = 163/272 (59.93%), Postives = 209/272 (76.84%), Query Frame = 1
Query:  115 INVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+G++      G  G
Sbjct:   21 VHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGVVLASSIGGTLG 287          
BLAST of Syntaxin vs. Ensembl Mouse
Match: Stx1a (syntaxin 1A (brain) [Source:MGI Symbol;Acc:MGI:109355])

HSP 1 Score: 328.561 bits (841), Expect = 4.920e-111
Identity = 167/265 (63.02%), Postives = 212/265 (80.00%), Query Frame = 1
Query:  136 YMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            +M+EFF QVE+IR  ID+I   V++VK KHS IL+SP+ DEKTK +LEE M++IKK ANKVR KLK+IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  ++EELEDMLESGNPAIF   I+ D++ +KQ+L++IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K I+I +C     C+++GII      G  G
Sbjct:   29 FMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVILGIIIASTIGGIFG 288          
BLAST of Syntaxin vs. Ensembl Mouse
Match: Stx2 (syntaxin 2 [Source:MGI Symbol;Acc:MGI:108059])

HSP 1 Score: 294.664 bits (753), Expect = 8.958e-98
Identity = 144/285 (50.53%), Postives = 215/285 (75.44%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSIN-VDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGII 900
            +D L  L A +  D+    DT++  V+   +M+ FF+QVE+IR+ I +I   V+DVK  HS ILS+P+ + K K +LE+   EIKK AN++R KLK+IEQS +QDE  +++S DLRI++TQ+S +SR F++VM +YN+AQ+ +R+  K RI+RQ+EI  R  +++ELE+MLESG P+IF  +I++D+   +Q+L +IE+RH+DIMKLE SI+ELH+MF+DMAM VE+QGEM++ IE NV  +VDY+E AK +TKKA+KYQS AR+K++ + +CV  L+ +++GII
Sbjct:    2 RDRLPDLTACRTNDD---GDTAVVIVEKDHFMDGFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKSIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKVMFVLICVVTLL-VILGII 282          
BLAST of Syntaxin vs. Ensembl Mouse
Match: Stx3 (syntaxin 3 [Source:MGI Symbol;Acc:MGI:103077])

HSP 1 Score: 283.493 bits (724), Expect = 2.230e-93
Identity = 146/264 (55.30%), Postives = 200/264 (75.76%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARK 840
            KD L  LKA Q   +D   +  I +D+  +M+EFF+++E+ R  ID+I   V++ K  +S ILS+P  + KTK  LE+   EIKK AN VR KLK++E+ IE+DE   +SSADLRI+K+Q+S +SR F+EVM  YN+AQV +R+  K RI+RQ+EI  +K ++EELE+MLESGNPAIFT  I+ D+  +KQ+L++IE RH+DI++LE SIKELHDMF+D+AMLVE+QG MIDRIE N++Q+V ++E A ADTKKAVKYQS AR+
Sbjct:    2 KDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEV--RSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGII-DSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARR 262          
BLAST of Syntaxin vs. Ensembl Mouse
Match: Stx2 (syntaxin 2 [Source:MGI Symbol;Acc:MGI:108059])

HSP 1 Score: 279.641 bits (714), Expect = 9.298e-92
Identity = 138/266 (51.88%), Postives = 201/266 (75.56%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSIN-VDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            +D L  L A +  D+    DT++  V+   +M+ FF+QVE+IR+ I +I   V+DVK  HS ILS+P+ + K K +LE+   EIKK AN++R KLK+IEQS +QDE  +++S DLRI++TQ+S +SR F++VM +YN+AQ+ +R+  K RI+RQ+EI  R  +++ELE+MLESG P+IF  +I++D+   +Q+L +IE+RH+DIMKLE SI+ELH+MF+DMAM VE+QGEM++ IE NV  +VDY+E AK +TKKA+KYQS AR+K
Sbjct:    2 RDRLPDLTACRTNDD---GDTAVVIVEKDHFMDGFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKSIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRK 264          
BLAST of Syntaxin vs. UniProt/SwissProt
Match: sp|Q16932|STX_APLCA (Syntaxin OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.862e-124
Identity = 187/276 (67.75%), Postives = 224/276 (81.16%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVA 870
            MTKD LAALKA Q +D+D+         S  +M EFF QV++IR MID+I + VD+VK KHS ILS+P  D+K K +LEE M+EIKKNANKVR KLK IEQ+IEQ+E  +KSSADLRI+KTQ++T+SR F+EVM DYN  Q+ YR+ CK RIKRQ+ I  +  +NEELEDM+ESGNPAIFTQ I+ +T QA ++LADIEARH DIMKLE SI++LHDMF+DMAMLVESQGEMIDRIEYNVEQAVDYIETAK DTKKAVKYQS AR+K I+I VC+A
Sbjct:    1 MTKDRLAALKAAQSDDDDNDDVAVTVDSSG-FMEEFFEQVDEIREMIDKIASNVDEVKKKHSAILSAPQTDDKMKEELEELMSEIKKNANKVRAKLKVIEQNIEQEEHTNKSSADLRIRKTQHATLSRKFVEVMNDYNACQIDYRERCKGRIKRQLAITGKTTTNEELEDMIESGNPAIFTQGIIMETQQANETLADIEARHNDIMKLETSIRDLHDMFMDMAMLVESQGEMIDRIEYNVEQAVDYIETAKMDTKKAVKYQSKARRKKIMILVCLA 275          
BLAST of Syntaxin vs. UniProt/SwissProt
Match: sp|Q24547|STX1A_DROME (Syntaxin-1A OS=Drosophila melanogaster OX=7227 GN=Syx1A PE=1 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.079e-119
Identity = 182/290 (62.76%), Postives = 234/290 (80.69%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSA-QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGF 909
            MTKD LAAL A Q +DE+   + ++NVD    YM++FF QVE+IR MID++Q+ V++VK KHS ILS+P  DEKTK +LE+ MA+IKKNAN+VR KLK IEQ+IEQ+E Q+KSSADLRI+KTQ+ST+SR F+EVM +YN+ Q  YR+ CK RI+RQ+EI  R  +++ELE MLE GN ++FTQ I+ +T QAKQ+LADIEARHQDIMKLE SIKELHDMF+DMAMLVESQGEMIDRIEY+VE A+DY++TA  DTKKA+KYQS AR+K I+I +C+ VL  +    ++ +
Sbjct:    1 MTKDRLAALHAAQSDDEEE-TEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSY 289          
BLAST of Syntaxin vs. UniProt/SwissProt
Match: sp|O16000|STX1A_CAEEL (Syntaxin-1A homolog OS=Caenorhabditis elegans OX=6239 GN=unc-64 PE=1 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.212e-118
Identity = 178/286 (62.24%), Postives = 223/286 (77.97%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGII 900
            MTKD L+ALKA Q EDE    D  ++  +AQYM EFF QVE+IR  +D I N V++VK KHS ILS+P  D+KTK +L+E MA IK+ ANKVR KLK IE +I+ DE Q   +ADLRI+KTQ+ST+SR F+EVM DYNK Q  YR+ CK RI+RQ++IA +++ +E+LE+M+ESGNP +FTQ I+TDT QAKQ+LADIEARH DIMKLE SI+ELHDMF+DMAMLVESQGEM+DRIEYNVE A ++++ A ADTKKAV+YQS AR+K I I V   +LI  +I  I
Sbjct:    1 MTKDRLSALKAAQSEDEQD-DDMHMDTGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKHSAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIDHDE-QGAGNADLRIRKTQHSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQGIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEHAKEFVDRAVADTKKAVQYQSKARRKKICILVTGVILITGLIIFI 284          
BLAST of Syntaxin vs. UniProt/SwissProt
Match: sp|A8WVD0|STX1A_CAEBR (Syntaxin-1A OS=Caenorhabditis briggsae OX=6238 GN=unc-64 PE=3 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.289e-116
Identity = 173/268 (64.55%), Postives = 213/268 (79.48%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDE-AQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            MTKD LAALKA Q EDE    D  +   +AQYM EFF QVE+IR  +D I N V++VK KHS ILS+P  D+KTK +L+E MA IK+ ANKVR KLK IE +IE DE  Q   +ADLRI+KTQ+ST+SR F+EVM DYNK Q  YR+ CK RI+RQ++IA +++ +E+LE+M+ESGNP +FTQ I+TDT QAKQ+LADIEARH DIMKLE SI+ELHDMF+DMAMLVESQGEM+DRIEYNVE A ++++ A ADTKKAV+YQS AR+K
Sbjct:    1 MTKDRLAALKAAQSEDEQD-DDMHMETGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKHSAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIEHDENQQGAGNADLRIRKTQHSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQGIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEHAKEFVDRAVADTKKAVQYQSKARRK 267          
BLAST of Syntaxin vs. UniProt/SwissProt
Match: sp|P61265|STX1B_RAT (Syntaxin-1B OS=Rattus norvegicus OX=10116 GN=Stx1b PE=1 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 8.232e-112
Identity = 163/272 (59.93%), Postives = 209/272 (76.84%), Query Frame = 1
Query:  115 INVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+G++      G  G
Sbjct:   21 VHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGVVLASSIGGTLG 287          
BLAST of Syntaxin vs. TrEMBL
Match: A0A3Q0KD32 (Putative syntaxin OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 495.738 bits (1275), Expect = 1.938e-173
Identity = 236/291 (81.10%), Postives = 268/291 (92.10%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVP 915
            MTKDL++AL+A QPED   LPDTS+ +D +QYMN+FF+QVE+IR +I+++Q+ VD+VKNKHSDILSSP+QDE TK QLE+AMAEIK  A++VR KLK +E +IE DE  D++SADLRI+KTQYSTISRNFIEVM DYNKAQVA+RDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDT QAKQSLADIEARHQDIMKLEKSIKELHDMF+DMAMLVESQGEMIDRIEYNVEQAVDYIE+AKADTKKAVKYQS+ARKKMIIIG+CVA+LICI++G I G VP
Sbjct:    1 MTKDLISALRAAQPEDASDLPDTSLPLDGSQYMNDFFSQVEEIRNLIERVQSLVDNVKNKHSDILSSPNQDEATKAQLEDAMAEIKTIAHRVRAKLKQMEMNIEYDENSDRTSADLRIRKTQYSTISRNFIEVMTDYNKAQVAFRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTQQAKQSLADIEARHQDIMKLEKSIKELHDMFMDMAMLVESQGEMIDRIEYNVEQAVDYIESAKADTKKAVKYQSSARKKMIIIGICVAILICIIVGTIVGMVP 291          
BLAST of Syntaxin vs. TrEMBL
Match: A0A4S2LDG1 (t-SNARE coiled-coil homology domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008035 PE=3 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 3.905e-173
Identity = 237/291 (81.44%), Postives = 264/291 (90.72%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVP 915
            MTKDL+ AL+A QPED   LPD S+++D  QYMN+FF QVE+IR +I+++Q  V+DVKNKHSDILSSP+QDE TK QLEEAMAEIK  A+KVR KLK +E +IE DE  DKSSADLRI+KTQYSTISRNFIEVM DYNKAQVA+RDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDT QAKQSLADIEARHQDIMKLEKSIKELHDMF+DMAMLVESQGEMIDRIEYNVEQAVDYIE+AKADTKKAVKYQS+ARKKMIIIG+CVA+L+CI++G I G +P
Sbjct:    1 MTKDLIGALRAAQPEDAGDLPDASLSIDGPQYMNDFFAQVEEIRNLIERVQALVEDVKNKHSDILSSPNQDETTKAQLEEAMAEIKMIAHKVRAKLKQMEMNIEYDENSDKSSADLRIRKTQYSTISRNFIEVMTDYNKAQVAFRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTQQAKQSLADIEARHQDIMKLEKSIKELHDMFMDMAMLVESQGEMIDRIEYNVEQAVDYIESAKADTKKAVKYQSSARKKMIIIGICVAILVCIIVGTIVGMLP 291          
BLAST of Syntaxin vs. TrEMBL
Match: A0A0X3NR09 (Syntaxin OS=Schistocephalus solidus OX=70667 GN=STX PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 2.313e-163
Identity = 240/292 (82.19%), Postives = 265/292 (90.75%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPK 918
            MTKDLL ALKA +PEDE ++P+  + +D  QYMNEFF QVE+IR  I++IQ  V+DVKNKH DILSSP+QDEKTK QLEEAMAEIK  A+KVR KLK +E +IE DE  DKSSADLRI+KTQYSTISRNFIEVM DYNKAQVA+RDACKNRIKRQMEIAERKI+NEELEDMLESGNPAIFTQEIMTDT QAKQSLADIEARH+DI+KLEKSIKELHDMF+DMAMLVESQGEMIDRIE+NV+QAVDYIETAKADTKKAVKYQSAARKKMIII +CVA+LICI+IGII GFVPK
Sbjct:    1 MTKDLLGALKAARPEDEGAMPEAPVPLDGPQYMNEFFAQVEEIRKFIERIQALVEDVKNKHGDILSSPNQDEKTKAQLEEAMAEIKMLAHKVRAKLKQMEMNIEYDENADKSSADLRIRKTQYSTISRNFIEVMTDYNKAQVAFRDACKNRIKRQMEIAERKITNEELEDMLESGNPAIFTQEIMTDTQQAKQSLADIEARHEDIIKLEKSIKELHDMFMDMAMLVESQGEMIDRIEFNVDQAVDYIETAKADTKKAVKYQSAARKKMIIIAICVAILICILIGIIVGFVPK 292          
BLAST of Syntaxin vs. TrEMBL
Match: A0A5K4EAN1 (Putative syntaxin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 7.391e-158
Identity = 224/300 (74.67%), Postives = 259/300 (86.33%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGV----------CVAVLICIVIGIIAGFV 912
            MTKDL++AL+A QPED   LPDTS+ +D +QYMN+FF+QVE+IR +I+++Q+ VD+VKNKHSDILSSP+QDE TK QLE+AMAEIK  A++VR KLK +E +IE DE  D++SADLRI+KTQYSTISRNFIEVM DYNKAQVA+RDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDT QAKQSLADIEARHQDIMKLEKSIKELHDMF+DMAMLVESQGEMIDRIEYNVEQAVDYIE+AKADTKKAVKYQS+ARK   IIG           C ++ +  ++G +  F+
Sbjct:    1 MTKDLISALRAAQPEDASDLPDTSLPLDGSQYMNDFFSQVEEIRNLIERVQSLVDNVKNKHSDILSSPNQDEATKAQLEDAMAEIKTIAHRVRAKLKQMEMNIEYDENSDRTSADLRIRKTQYSTISRNFIEVMTDYNKAQVAFRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTQQAKQSLADIEARHQDIMKLEKSIKELHDMFMDMAMLVESQGEMIDRIEYNVEQAVDYIESAKADTKKAVKYQSSARKVGTIIGCKLCPFQVFLRCQSIRVVSLLGCVVIFL 300          
BLAST of Syntaxin vs. TrEMBL
Match: C1LHB0 (Syntaxin 1A OS=Schistosoma japonicum OX=6182 GN=Syx1A PE=2 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 2.178e-157
Identity = 223/281 (79.36%), Postives = 251/281 (89.32%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICI 885
            MTKDL+ AL+A QPED + LPDTS+ +D +QYMN+FF+QVE+IR +I+++Q+ VDDVKNKHSDILSSP+QDE TK QLE+AMAEIK  A+KVR KLK +E +IE DE  D++SADLRI+KTQYSTISRNFIEVM DYNKAQVA+RDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDT QAKQSLADIEARHQDIMKLEKSIKELHDMF+DMAMLVESQGEMIDRIEYNVEQAVDYIE+AKADTKKAVKYQS+ARK    +G  +    CI
Sbjct:    1 MTKDLIGALRAAQPEDANDLPDTSLPLDGSQYMNDFFSQVEEIRNLIERVQSLVDDVKNKHSDILSSPNQDEATKAQLEDAMAEIKTIAHKVRAKLKQMEMNIEYDENSDRTSADLRIRKTQYSTISRNFIEVMTDYNKAQVAFRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTQQAKQSLADIEARHQDIMKLEKSIKELHDMFMDMAMLVESQGEMIDRIEYNVEQAVDYIESAKADTKKAVKYQSSARK----VGTVIQCEYCI 277          
BLAST of Syntaxin vs. Ensembl Cavefish
Match: stx1b (syntaxin-1B [Source:NCBI gene;Acc:103042529])

HSP 1 Score: 336.65 bits (862), Expect = 2.357e-114
Identity = 168/294 (57.14%), Postives = 219/294 (74.49%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            KD    L++ +  D+D   +  ++VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  A+FT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS ARKK I+I +C     C+++G+I      G  G
Sbjct:    2 KDRTQELRSAKDSDDD---EEVVHVDRGNFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRLKLKAIEQSIEQEEVMNRSSADLRIRKTQHSTLSRKFVEVMTEYNTTQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAVFTDDIKMDSQMTKQALNEIETRHTEIIKLENSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSQARKKKIMIIIC-----CVILGVILASTIGGTLG 287          
BLAST of Syntaxin vs. Ensembl Cavefish
Match: stx1a (syntaxin 1A [Source:NCBI gene;Acc:103022407])

HSP 1 Score: 336.65 bits (862), Expect = 2.458e-114
Identity = 161/262 (61.45%), Postives = 208/262 (79.39%), Query Frame = 1
Query:  136 YMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKG 921
            +M+EFF QVE+IR  ID +   V++VK KHS IL++P+ DEKTK +LE+ M +IKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q +YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D+N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G
Sbjct:   28 FMDEFFEQVEEIRGFIDSLSEKVEEVKRKHSAILAAPNPDEKTKAELEDLMTDIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSSYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMDSNITQQAMNEIETRHTEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTVGG 284          
BLAST of Syntaxin vs. Ensembl Cavefish
Match: stx1a (syntaxin 1A [Source:NCBI gene;Acc:103022407])

HSP 1 Score: 323.168 bits (827), Expect = 3.695e-109
Identity = 156/254 (61.42%), Postives = 201/254 (79.13%), Query Frame = 1
Query:  160 VEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKG 921
            VE+IR  ID +   V++VK KHS IL++P+ DEKTK +LE+ M +IKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q +YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D+N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G
Sbjct:   30 VEEIRGFIDSLSEKVEEVKRKHSAILAAPNPDEKTKAELEDLMTDIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSSYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMDSNITQQAMNEIETRHTEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTVGG 278          
BLAST of Syntaxin vs. Ensembl Cavefish
Match: stx1a (syntaxin 1A [Source:NCBI gene;Acc:103022407])

HSP 1 Score: 322.398 bits (825), Expect = 3.474e-108
Identity = 162/296 (54.73%), Postives = 209/296 (70.61%), Query Frame = 1
Query:  136 YMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQ-------------------------------------GEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAV-LICIVIGIIAGF 909
            +M+EFF QVE+IR  ID +   V++VK KHS IL++P+ DEKTK +LE+ M +IKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q +YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D+N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQ                                     GEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K+I I VCV V L+ ++I +  G 
Sbjct:   28 FMDEFFEQVEEIRGFIDSLSEKVEEVKRKHSAILAAPNPDEKTKAELEDLMTDIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSSYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMDSNITQQAMNEIETRHTEIIKLENSIRELHDMFMDMAMLVESQGDLINNIESNVRNAQDYVEKAKEDTKAAIKVQKTSKVGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKLIAISVCVGVCLLILIISLAVGL 323          
BLAST of Syntaxin vs. Ensembl Cavefish
Match: stx1a (syntaxin 1A [Source:NCBI gene;Acc:103022407])

HSP 1 Score: 318.546 bits (815), Expect = 9.978e-107
Identity = 161/299 (53.85%), Postives = 208/299 (69.57%), Query Frame = 1
Query:  136 YMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQ-------------------------------------GEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKG 921
            +M+EFF QVE+IR  ID +   V++VK KHS IL++P+ DEKTK +LE+ M +IKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q +YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D+N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQ                                     GEMIDRIEYNVE AVDY+E A +DTKKAVKYQS AR+K I+I +C     C+V+GI+      G
Sbjct:   28 FMDEFFEQVEEIRGFIDSLSEKVEEVKRKHSAILAAPNPDEKTKAELEDLMTDIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSSYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMDSNITQQAMNEIETRHTEIIKLENSIRELHDMFMDMAMLVESQGDLINNIESNVRNAQDYVEKAKEDTKAAIKVQKTSKVGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIIC-----CVVLGIVIASTVGG 321          
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000623.1 (pep scaffold:Pmarinus_7.0:GL477174:3033:6181:-1 gene:ENSPMAG00000000558.1 transcript:ENSPMAT00000000623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 8.850e-49
Identity = 76/131 (58.02%), Postives = 101/131 (77.10%), Query Frame = 1
Query:  220 KHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQ 612
            +HS IL++P+ D+KTK +LE+ +A IK  ANKVR KLK IE SIEQ+E  ++SSAD+RI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  +  +NEELEDMLESGNP IF+  + T   Q
Sbjct:    2 RHSSILAAPNSDDKTKEELEKLLANIKVTANKVRSKLKAIETSIEQEELANRSSADMRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKQRIQRQLEITGKLTTNEELEDMLESGNPTIFSSGVRTQRGQ 132          
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Match: stx11b.2 (syntaxin 11b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050417-148])

HSP 1 Score: 145.976 bits (367), Expect = 4.579e-41
Identity = 97/273 (35.53%), Postives = 152/273 (55.68%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKV---------RF--KLKNIEQSIEQDEA-QDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEI-AERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQS 828
            KD L  L     + ED        VDS Q  +  F     I ++ ++ +   D+++   SD+     Q+ +  T +   ++ IK++AN V         R   +L+ +  S EQ EA Q   SA  RI +   + +++ F +VM +YN A++A R+ CK RI RQ+EI   +  S+ ELE+ +E GN  +F   I+ +T  AK +L +IE RHQ+++KLE+ ++E+HD+FL MA+LVE QGEM++ IE  V    DYI  A    +KA+KYQ+
Sbjct:    2 KDRLQELITISHKTEDGKSVVDDEVDSRQE-SVIFEHESPIPSLHEETEAIQDEIERLQSDVRRMGKQNARFLTSMRR-LSSIKRDANAVARDVRLRAERLHKRLQLLTASCEQLEARQGAQSAAARIIRAHVNALTQRFHQVMLEYNAAEIAQRENCKRRIARQLEILGSQPASDAELEERIEQGNWEVFAMGILGETRSAKAALNEIEQRHQELLKLEQRLREVHDLFLQMALLVEEQGEMVNNIENTVTNTQDYIAQANETFQKAIKYQN 272          
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Match: stx12 (syntaxin 12 [Source:ZFIN;Acc:ZDB-GENE-040625-11])

HSP 1 Score: 64.3142 bits (155), Expect = 6.273e-12
Identity = 37/111 (33.33%), Postives = 63/111 (56.76%), Query Frame = 1
Query:  556 LESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIV 888
            L+S  PAI            ++ L DI+ R   I +LE  I +++ +F D+  ++  QG+M+D IE NVE A  +++ A+   ++A +YQ A+RKKM     C+ ++I +V
Sbjct:  168 LQSEEPAI-----------TEEDLEDIKERETAIRQLEADIMDVNQIFKDLGTMIHEQGDMVDSIEANVESAEVHVDHAEQQLRRAAQYQRASRKKM-----CILLVILVV 262          
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Match: si:ch211-208k15.1 (si:ch211-208k15.1 [Source:ZFIN;Acc:ZDB-GENE-100922-189])

HSP 1 Score: 56.9954 bits (136), Expect = 1.670e-9
Identity = 31/81 (38.27%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  625 LADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK--MIIIGV 861
            L DI+ RH+ I +LE  + +++ +F D+A +V  QG  +D I ++VE A   +E A  +   A K+Q+ +RKK   IIIG 
Sbjct:  164 LEDIQVRHEAIQQLESDLLDVNSIFKDLAAMVHEQGGTVDSIVHHVESASSNVEGANENLIAASKHQAKSRKKTCFIIIGA 244          
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Match: stx7l (syntaxin 7-like [Source:ZFIN;Acc:ZDB-GENE-041014-35])

HSP 1 Score: 56.9954 bits (136), Expect = 1.820e-9
Identity = 34/105 (32.38%), Postives = 59/105 (56.19%), Query Frame = 1
Query:  529 ISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            ++  E ++ +E+G      Q    D    ++ L +I+ R   I  LE  I +++ +F D+  ++  QG+MID IE NVE A  ++E A    ++A +YQ+A+RKK
Sbjct:  150 VNGSEEDESIETGFEDRTLQSQAQDEGITEEDLEEIKEREVAIQMLEADIMDINQIFKDLGTMIHEQGDMIDSIEANVETAEVHVEQANQQLRRAAQYQTASRKK 254          
BLAST of Syntaxin vs. Ensembl Yeast
Match: SSO2 (Plasma membrane t-SNARE; involved in fusion of secretory vesicles at the plasma membrane; syntaxin homolog that is functionally redundant with Sso1p; SSO2 has a paralog, SSO1, that arose from the whole genome duplication [Source:SGD;Acc:S000004795])

HSP 1 Score: 97.4413 bits (241), Expect = 2.171e-23
Identity = 74/254 (29.13%), Postives = 134/254 (52.76%), Query Frame = 1
Query:  148 FFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPA-IFTQEIMTDT--NQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGII 900
            F N++  I   + + +N ++ +  +H D+L+     E+ + +L  ++ +    A  ++++LK   +  ++D   D +      K+ Q     + F++++ DY      Y++  K + KRQ  I + + ++EE+E  +   N   IF+Q ++      +AK +LA+++ARHQ+++KLEK++ EL  +F DM  LV  Q E +D I+ NVE A   +E     T KAVK    ARK  I    C  ++IC +I  I
Sbjct:   40 FMNKINSINANLSRYENIINQIDAQHKDLLTQV--SEEQEMELRRSLDDYISQATDLQYQLKADIKDAQRDGLHDSN------KQAQAENCRQKFLKLIQDYRIIDSNYKEESKEQAKRQYTIIQPEATDEEVEAAINDVNGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGHTNKAVKSARKARKNKI---RC--LIICFIIFAI 280          
BLAST of Syntaxin vs. Ensembl Yeast
Match: SSO1 (Plasma membrane t-SNARE; involved in fusion of secretory vesicles at the plasma membrane and in vesicle fusion during sporulation; forms a complex with Sec9p that binds v-SNARE Snc2p; syntaxin homolog; functionally redundant with Sso2p; SSO1 has a paralog, SSO2, that arose from the whole genome duplication [Source:SGD;Acc:S000006153])

HSP 1 Score: 95.1301 bits (235), Expect = 1.248e-22
Identity = 73/237 (30.80%), Postives = 125/237 (52.74%), Query Frame = 1
Query:  148 FFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLES-GNPAIFTQEIMTDT--NQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMI 849
            F N++  I   +D+  + ++ V + H  +L+    +E+  + L  ++      A  ++FKLKN  +S ++D   D +      K+ Q     + F++++ DY      Y++  K + KRQ  I + + + +E+E  +   G   IF+Q ++      +AK +LA+++ARHQ+++KLEKS+ EL  +F DM  LV  Q E +D I+ NVE A   +E     T KAVK    ARK  I
Sbjct:   36 FMNKISQINRDLDKYDHTINQVDSLHKRLLTEV--NEEQASHLRHSLDNFVAQATDLQFKLKNEIKSAQRDGIHDTN------KQAQAENSRQRFLKLIQDYRIVDSNYKEENKEQAKRQYMIIQPEATEDEVEAAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKSMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQLDVEQGVGHTDKAVKSARKARKNKI 264          
BLAST of Syntaxin vs. Ensembl Yeast
Match: TLG2 (Syntaxin-like t-SNARE; forms a complex with Tlg1p and Vti1p and mediates fusion of endosome-derived vesicles with the late Golgi; required along with VPS45 for an early step of the constitutive CVT pathway; interactions with Vps45 prevents Tlg2p degradation, and facilitates t-SNARE complex formation; homologous to mammalian SNARE protein syntaxin 16 (Sx16) [Source:SGD;Acc:S000005378])

HSP 1 Score: 54.299 bits (129), Expect = 1.510e-8
Identity = 33/104 (31.73%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  604 TNQAKQSLADIEA------RHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAAR--KKMIIIGVCVAVLICIVI 891
            T Q +Q L D  A      R ++I +L + + E+  +F +M  LV  QG ++DRI+YN+E  V  +++A  +  KA  YQ   +  K ++++ +CV  L   V+
Sbjct:  231 TLQRQQQLHDTSAEAYLRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKATHYQKRTQKCKVILLLTLCVIALFFFVM 334          
BLAST of Syntaxin vs. Ensembl Nematostella
Match: EDO37354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG06])

HSP 1 Score: 275.404 bits (703), Expect = 1.438e-90
Identity = 146/272 (53.68%), Postives = 195/272 (71.69%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDT--SINVD-SAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKS----SADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            +D L  L+A     +D  P+   SI +    ++M++FF Q  +IR  ID+I   V+ VK  HS +LSS   D++ K  LE  M+ I+K AN VR ++K +EQ I++DE Q  S     A+ RIKK Q++T+SR FIEVM++YN  Q  YR+ CK RI RQ+EI  +  ++EE+EDMLESGNP+IFT +I+  T QAKQ+L DIEARH+DI+ LEK+I+ELH+MF DM MLVESQGEMIDRIE+NVEQAVDY+++AK DTKKA+ YQS AR+K
Sbjct:    2 RDRLDFLRAEDNTRDDGPPEYEDSIAIPMGGEFMDDFFQQTANIRENIDKIAQDVERVKKAHSAVLSSAVPDQEVKDNLEICMSRIQKTANTVRSRIKAMEQQIKEDEKQGGSLHNNYAEARIKKCQHATLSRKFIEVMSEYNTTQTEYRELCKARICRQLEITGKSKTSEEVEDMLESGNPSIFTSDIVIQTQQAKQALGDIEARHRDIITLEKNIQELHEMFQDMYMLVESQGEMIDRIEFNVEQAVDYVQSAKTDTKKALTYQSKARRK 273          
BLAST of Syntaxin vs. Ensembl Nematostella
Match: EDO41548 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U3])

HSP 1 Score: 71.633 bits (174), Expect = 5.656e-14
Identity = 69/278 (24.82%), Postives = 136/278 (48.92%), Query Frame = 1
Query:   52 DLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIK-KNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTD--------TNQAKQSLAD----IEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKM 846
            D +A ++   PE     P +S+         ++ + VE+I+  I +I+  + D+   H   L+ P  D+      EE   EI  K   ++  + +N  Q + + +++     + R+ K   S+++ +  E+  ++ K+Q  Y    KNR +R+ +           +  L S + A+  ++++ D        TN   + + D    +E R ++I  + +SI EL+++F D+A ++  QG ++DRI+YNVEQA   +E      KKA ++Q ++RK +
Sbjct:   33 DTVALVQRVDPELGTQAPISSLP-------PQWIDAVEEIQYEITRIKQRMKDLSTLHDRHLNRPTLDDSID---EEQTIEITTKEITQMFHQCQNAVQKMSR-QSRTAGKQEQRLLKNVISSLAVSLQELSTNFRKSQSTYLKRLKNREERERQF---------FDTGLPSTSSALMNEDVVEDDDLYDRGFTNDQMRLVEDNSAIVEQREKEIQSIVQSISELNEIFRDLATMIVEQGSILDRIDYNVEQASVKVEQGLEQLKKAEQHQKSSRKML 290          
BLAST of Syntaxin vs. Ensembl Nematostella
Match: EDO36133 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ7])

HSP 1 Score: 58.151 bits (139), Expect = 1.573e-9
Identity = 31/71 (43.66%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  634 IEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKM 846
            I  R + I ++E  I +++++F D+A +V  QGE ID IE N+EQA + + +A    +KA K Q AARKKM
Sbjct:  200 IYEREERIRQIEGDILDINEIFRDLATMVYEQGETIDSIEGNIEQAYNNVGSANIQLQKASKLQKAARKKM 270          
BLAST of Syntaxin vs. Ensembl Nematostella
Match: EDO44588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV68])

HSP 1 Score: 50.447 bits (119), Expect = 2.415e-8
Identity = 26/64 (40.62%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  634 IEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQ 825
            +E R + I +LE  I  ++++F D+  ++  QGE+ID IE NVE A  ++ETA     KA  YQ
Sbjct:    1 MEERERAIRQLEADIVGVNEIFRDLGNMIHEQGEVIDSIEANVETAAVHVETANVQLDKARGYQ 64          
BLAST of Syntaxin vs. Ensembl Medaka
Match: stx1a (syntaxin-1A [Source:NCBI gene;Acc:101175011])

HSP 1 Score: 334.339 bits (856), Expect = 2.132e-113
Identity = 166/286 (58.04%), Postives = 220/286 (76.92%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAG 906
            ++L    + T+ EDE      ++ +D   +M+EFF QVE+IR+ I+ +   V++VK KHS IL+SP+ DEKTK +LE+ MAEIKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS AR+K I+I +C  +L  ++  I+ G
Sbjct:    6 QELRHGKETTEEEDE-----VAVGMDKG-FMDEFFEQVEEIRSFIESLAEKVEEVKRKHSAILASPNPDEKTKVELEDLMAEIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNTTQSDYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMD-NITQQAMNEIETRHNEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASIVGG 284          
BLAST of Syntaxin vs. Ensembl Medaka
Match: stx1b (syntaxin-1B [Source:NCBI gene;Acc:101157106])

HSP 1 Score: 334.339 bits (856), Expect = 2.852e-113
Identity = 171/293 (58.36%), Postives = 215/293 (73.38%), Query Frame = 1
Query:   58 LAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG*Y 936
            L  L   Q +D D   +  + VD   +M+EFF QVE+IR  I+++   V+ VK +HS IL++P+ DEKTK +LE+  A+IKK ANKVR KLK IEQSIEQ+E  ++SSADLRI+KTQ+ST+SR F+EVM +YN  Q  YRD CK+RI+RQ+EI  R  +NEELEDMLESG  AIFT +I  D+   KQ+L +IE RH +I+KLE SI+ELHDMF+DMAMLVESQGEMIDRIEYNVE +VDY+E A +DTKKAVKYQS ARKK I+I +C     C+V+GII         G Y
Sbjct:   14 LLFLSCVQAKDSDD-DEEVVQVDRDHFMDEFFEQVEEIRGCIEKLSEDVEHVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNTTQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHTEIIKLENSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSQARKKKIMIIIC-----CVVLGIILASTIGSTLGLY 300          
BLAST of Syntaxin vs. Ensembl Medaka
Match: stx1a (syntaxin-1A [Source:NCBI gene;Acc:101175011])

HSP 1 Score: 302.368 bits (773), Expect = 6.771e-101
Identity = 153/288 (53.12%), Postives = 215/288 (74.65%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAV-LICIVIGIIAGF 909
            ++L    + T+ EDE      ++ +D   +M+EFF QVE+IR+ I+ +   V++VK KHS IL+SP+ DEKTK +LE+ MAEIKK ANKVR KLK+I+Q+IEQ+E Q++SSADLRI+KTQ+ST+SR F+EVM++YN  Q  YR+ CK RI+RQ+EI  R  +NEELE MLES NPAIFT  I+ D N  +Q++ +IE RH +I+KLE SI+ELHDMF+DMAMLVESQG++++ IE  V +A+DY+E AK    +  K+Q  +++K+++IG CVAV LI ++I +  G 
Sbjct:    6 QELRHGKETTEEEDE-----VAVGMDKG-FMDEFFEQVEEIRSFIESLAEKVEEVKRKHSAILASPNPDEKTKVELEDLMAEIKKLANKVRSKLKSIQQTIEQEEGQNRSSADLRIRKTQHSTLSRKFVEVMSEYNTTQSDYRERCKGRIQRQLEITGRNTTNEELESMLESDNPAIFTSGIIMD-NITQQAMNEIETRHNEIIKLENSIRELHDMFMDMAMLVESQGDLVNCIERCVVEALDYVEEAKDRIPQCKKFQKTSKRKVLLIGGCVAVCLIILIISLAVGL 286          
BLAST of Syntaxin vs. Ensembl Medaka
Match: stx3a (syntaxin-3 [Source:NCBI gene;Acc:101164408])

HSP 1 Score: 285.034 bits (728), Expect = 4.070e-94
Identity = 148/274 (54.01%), Postives = 206/274 (75.18%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVA 870
            KD L  LKAT  +D++ +    I VD+A +M+EFF+Q+EDIR  ID+I   V +VK   S ILS+P  D+KT+  LE    +IKK AN  R KLK IE+++E ++ Q++ SAD+RI+K+Q++ +SR F+EVM  YN+AQV +R+  K RI+RQ+EI  +  ++EELE+MLESGN A+FT  I+ D+  +KQ+L++IE+RH+DI++LE SIKELHDMF+D+AMLVESQG++ID IE NV Q+VD+I  A+  TKKAV+YQ+ ARKKM IIG C A
Sbjct:    2 KDRLEQLKATCDQDDEEVE---IAVDNAAFMDEFFSQIEDIRGSIDKIDENVAEVKKLFSVILSAPTSDQKTQDDLEAITNDIKKMANNARNKLKTIERNLESEQQQERVSADMRIRKSQHAVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKATTDEELEEMLESGNAAVFTAGIV-DSGISKQALSEIESRHKDIVRLESSIKELHDMFVDIAMLVESQGDVIDNIEKNVSQSVDHIVEAREQTKKAVRYQTKARKKMYIIGACCA 271          
BLAST of Syntaxin vs. Ensembl Medaka
Match: stx2b (syntaxin 2 [Source:NCBI gene;Acc:101166559])

HSP 1 Score: 281.952 bits (720), Expect = 8.489e-93
Identity = 140/271 (51.66%), Postives = 199/271 (73.43%), Query Frame = 1
Query:   49 KDLLAALKATQPEDEDSLPDTSINVDSA-QYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIG 858
            +D LA L A    ++ ++P     VD    +M  FF +VE++R +ID+I + V++VK  HS ILS+P+ D +TK QL     +IK NAN VR KLK++EQS+ +D+  ++SS D RI+KTQ++ +SR F+EVM  YN+ QV++R+  K RI+RQ+EI  R  +NEELEDMLESGNP+IFT +I++D+   +Q+L +IE+RHQDI++LE SIKELH MF+DMAMLVE+QGEM++ IE NV  A +YI +AK +TKKAV+YQ  +R+K II+ 
Sbjct:    2 RDRLAELAANNAGEDAAVP-----VDPMDGFMESFFRRVEEVRGLIDKISHQVEEVKKTHSMILSAPNPDNRTKEQLTALTNDIKGNANVVRTKLKSMEQSMPKDDVTNRSSVDFRIQKTQHTVLSRKFVEVMTLYNETQVSFRERSKGRIQRQLEITGRVTTNEELEDMLESGNPSIFTSDIISDSQITRQALNEIESRHQDIIRLESSIKELHAMFMDMAMLVETQGEMVNSIENNVSNAAEYICSAKEETKKAVRYQKKSRRKYIILA 267          
BLAST of Syntaxin vs. Planmine SMEST
Match: SMESG000043410.1 (SMESG000043410.1)

HSP 1 Score: 334.724 bits (857), Expect = 1.301e-115
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 1
Query:  442 MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 930
            MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG
Sbjct:    1 MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG 163          
BLAST of Syntaxin vs. Planmine SMEST
Match: SMESG000043410.1 (SMESG000043410.1)

HSP 1 Score: 271.552 bits (693), Expect = 6.888e-91
Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
Query:  442 MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARK 840
            MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARK
Sbjct:    1 MADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARK 133          
BLAST of Syntaxin vs. Planmine SMEST
Match: SMESG000043412.1 (SMESG000043412.1)

HSP 1 Score: 247.669 bits (631), Expect = 7.738e-82
Identity = 122/126 (96.83%), Postives = 124/126 (98.41%), Query Frame = 1
Query:   43 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQYSTI 420
            MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQ  ++
Sbjct:    1 MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQIQNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIEQSIEQDEAQDKSSADLRIKKTQVRSL 126          
BLAST of Syntaxin vs. Planmine SMEST
Match: SMESG000043410.1 (SMESG000043410.1)

HSP 1 Score: 223.787 bits (569), Expect = 3.257e-72
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 1
Query:  406 QYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQ 729
            QYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQ
Sbjct:   34 QYSTISRNFIEVMADYNKAQVAYRDACKNRIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQ 141          
BLAST of Syntaxin vs. Planmine SMEST
Match: SMESG000037133.1 (SMESG000037133.1)

HSP 1 Score: 154.836 bits (390), Expect = 1.132e-45
Identity = 75/110 (68.18%), Postives = 94/110 (85.45%), Query Frame = 1
Query:  514 IAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEARHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETAKADTKKAVKYQSAARKK 843
            +A RKI +E+LE+MLE  + AIFT EI+T+T QAK+SL D+EARH DI+KLE+SIK+LH+MFLDMA+L+E QGEMIDRIEYNV +A DYIE A  DT+KAV+YQ +ARKK
Sbjct:    1 MANRKIDDEQLENMLEQESVAIFTHEIVTETEQAKKSLEDVEARHADIVKLERSIKDLHEMFLDMALLIEGQGEMIDRIEYNVAKASDYIERAVIDTQKAVQYQGSARKK 110          
The following BLAST results are available for this feature:
BLAST of Syntaxin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STX1B1.714e-11259.93syntaxin 1B [Source:HGNC Symbol;Acc:HGNC:18539][more]
STX1A8.166e-11162.74syntaxin 1A [Source:HGNC Symbol;Acc:HGNC:11433][more]
STX1B1.174e-10563.64syntaxin 1B [Source:HGNC Symbol;Acc:HGNC:18539][more]
STX21.568e-10252.82syntaxin 2 [Source:HGNC Symbol;Acc:HGNC:3403][more]
STX29.433e-10152.60syntaxin 2 [Source:HGNC Symbol;Acc:HGNC:3403][more]
back to top
BLAST of Syntaxin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-649.525e-12062.24Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;... [more]
unc-641.828e-11664.04Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;... [more]
unc-641.828e-11664.04Syntaxin-1A homolog [Source:UniProtKB/Swiss-Prot;... [more]
syx-31.003e-2828.11Putative syntaxin-3 [Source:UniProtKB/Swiss-Prot;... [more]
syx-25.580e-2123.77Putative syntaxin-2 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Syntaxin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syx1A1.076e-12062.76gene:FBgn0013343 transcript:FBtr0084588[more]
Syx1A1.076e-12062.76gene:FBgn0013343 transcript:FBtr0392904[more]
Syx1A1.159e-12062.76gene:FBgn0013343 transcript:FBtr0303161[more]
Syx42.005e-1526.38gene:FBgn0024980 transcript:FBtr0332496[more]
Syx45.185e-1526.38gene:FBgn0024980 transcript:FBtr0070494[more]
back to top
BLAST of Syntaxin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stx1b2.678e-11357.14syntaxin 1B [Source:ZFIN;Acc:ZDB-GENE-000330-4][more]
stx1b2.096e-11259.93syntaxin 1B [Source:ZFIN;Acc:ZDB-GENE-000330-4][more]
stx1a1.203e-9354.30syntaxin 1A (brain) [Source:ZFIN;Acc:ZDB-GENE-1008... [more]
stx2b3.665e-9254.10syntaxin 2b [Source:ZFIN;Acc:ZDB-GENE-091204-424][more]
stx2b2.645e-9055.70syntaxin 2b [Source:ZFIN;Acc:ZDB-GENE-091204-424][more]
back to top
BLAST of Syntaxin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a6os2.031e-12159.86solute carrier family 7 member 6 opposite strand [... [more]
slc7a6os4.846e-12060.28solute carrier family 7 member 6 opposite strand [... [more]
slc7a6os3.634e-11961.21solute carrier family 7 member 6 opposite strand [... [more]
slc7a6os4.790e-11961.21solute carrier family 7 member 6 opposite strand [... [more]
slc7a6os5.489e-11961.21solute carrier family 7 member 6 opposite strand [... [more]
back to top
BLAST of Syntaxin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stx1b1.177e-11259.93syntaxin 1B [Source:MGI Symbol;Acc:MGI:1930705][more]
Stx1a4.920e-11163.02syntaxin 1A (brain) [Source:MGI Symbol;Acc:MGI:109... [more]
Stx28.958e-9850.53syntaxin 2 [Source:MGI Symbol;Acc:MGI:108059][more]
Stx32.230e-9355.30syntaxin 3 [Source:MGI Symbol;Acc:MGI:103077][more]
Stx29.298e-9251.88syntaxin 2 [Source:MGI Symbol;Acc:MGI:108059][more]
back to top
BLAST of Syntaxin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16932|STX_APLCA1.862e-12467.75Syntaxin OS=Aplysia californica OX=6500 PE=2 SV=1[more]
sp|Q24547|STX1A_DROME1.079e-11962.76Syntaxin-1A OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|O16000|STX1A_CAEEL1.212e-11862.24Syntaxin-1A homolog OS=Caenorhabditis elegans OX=6... [more]
sp|A8WVD0|STX1A_CAEBR8.289e-11664.55Syntaxin-1A OS=Caenorhabditis briggsae OX=6238 GN=... [more]
sp|P61265|STX1B_RAT8.232e-11259.93Syntaxin-1B OS=Rattus norvegicus OX=10116 GN=Stx1b... [more]
back to top
BLAST of Syntaxin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KD321.938e-17381.10Putative syntaxin OS=Schistosoma mansoni OX=6183 P... [more]
A0A4S2LDG13.905e-17381.44t-SNARE coiled-coil homology domain-containing pro... [more]
A0A0X3NR092.313e-16382.19Syntaxin OS=Schistocephalus solidus OX=70667 GN=ST... [more]
A0A5K4EAN17.391e-15874.67Putative syntaxin OS=Schistosoma mansoni OX=6183 P... [more]
C1LHB02.178e-15779.36Syntaxin 1A OS=Schistosoma japonicum OX=6182 GN=Sy... [more]
back to top
BLAST of Syntaxin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stx1b2.357e-11457.14syntaxin-1B [Source:NCBI gene;Acc:103042529][more]
stx1a2.458e-11461.45syntaxin 1A [Source:NCBI gene;Acc:103022407][more]
stx1a3.695e-10961.42syntaxin 1A [Source:NCBI gene;Acc:103022407][more]
stx1a3.474e-10854.73syntaxin 1A [Source:NCBI gene;Acc:103022407][more]
stx1a9.978e-10753.85syntaxin 1A [Source:NCBI gene;Acc:103022407][more]
back to top
BLAST of Syntaxin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000623.18.850e-4958.02pep scaffold:Pmarinus_7.0:GL477174:3033:6181:-1 ge... [more]
stx11b.24.579e-4135.53syntaxin 11b, tandem duplicate 2 [Source:ZFIN;Acc:... [more]
stx126.273e-1233.33syntaxin 12 [Source:ZFIN;Acc:ZDB-GENE-040625-11][more]
si:ch211-208k15.11.670e-938.27si:ch211-208k15.1 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
stx7l1.820e-932.38syntaxin 7-like [Source:ZFIN;Acc:ZDB-GENE-041014-3... [more]
back to top
BLAST of Syntaxin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SSO22.171e-2329.13Plasma membrane t-SNARE; involved in fusion of sec... [more]
SSO11.248e-2230.80Plasma membrane t-SNARE; involved in fusion of sec... [more]
TLG21.510e-831.73Syntaxin-like t-SNARE; forms a complex with Tlg1p ... [more]
back to top
BLAST of Syntaxin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO373541.438e-9053.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415485.656e-1424.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361331.573e-943.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445882.415e-840.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Syntaxin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stx1a2.132e-11358.04syntaxin-1A [Source:NCBI gene;Acc:101175011][more]
stx1b2.852e-11358.36syntaxin-1B [Source:NCBI gene;Acc:101157106][more]
stx1a6.771e-10153.13syntaxin-1A [Source:NCBI gene;Acc:101175011][more]
stx3a4.070e-9454.01syntaxin-3 [Source:NCBI gene;Acc:101164408][more]
stx2b8.489e-9351.66syntaxin 2 [Source:NCBI gene;Acc:101166559][more]
back to top
BLAST of Syntaxin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043410.11.301e-115100.00SMESG000043410.1[more]
SMESG000043410.16.888e-91100.00SMESG000043410.1[more]
SMESG000043412.17.738e-8296.83SMESG000043412.1[more]
SMESG000043410.13.257e-72100.00SMESG000043410.1[more]
SMESG000037133.11.132e-4568.18SMESG000037133.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002549 ID=SMED30002549|Name=Syntaxin|organism=Schmidtea mediterranea sexual|type=transcript|length=1248bp
TTTTAATAAGTAAAGACTAGATTTTAATTATTATAGTGAAGAATGACGAA
GGATTTATTGGCAGCACTTAAAGCTACTCAACCGGAAGATGAAGACAGTC
TTCCGGATACATCAATTAATGTAGATAGTGCACAATACATGAATGAATTT
TTTAACCAGGTTGAAGATATTAGAACGATGATAGATCAAATTCAGAATTT
TGTAGACGATGTCAAAAATAAACATAGTGATATTCTTTCTTCACCACACC
AAGATGAGAAAACGAAAACACAACTGGAAGAAGCAATGGCTGAAATCAAG
AAAAATGCCAATAAAGTTCGGTTTAAGTTGAAAAACATTGAGCAAAGTAT
TGAACAAGACGAAGCGCAAGATAAATCATCTGCTGATTTACGAATTAAAA
AAACTCAGTATTCTACCATTTCTCGAAACTTCATTGAAGTAATGGCTGAC
TACAATAAGGCTCAGGTCGCTTACAGGGATGCCTGTAAAAACCGAATTAA
ACGACAAATGGAAATAGCTGAAAGAAAGATTTCCAACGAAGAACTTGAAG
ATATGCTTGAATCCGGCAATCCTGCAATATTTACTCAGGAAATTATGACC
GACACCAATCAAGCGAAGCAGTCTCTCGCTGACATTGAAGCACGTCATCA
GGACATAATGAAATTGGAGAAGAGTATTAAAGAGTTGCATGATATGTTTC
TAGATATGGCAATGCTGGTGGAAAGTCAAGGAGAAATGATTGATAGAATT
GAATATAATGTCGAACAAGCTGTAGACTACATCGAAACTGCAAAAGCCGA
TACTAAAAAAGCTGTCAAATATCAAAGTGCTGCTAGAAAGAAAATGATCA
TCATCGGAGTCTGTGTAGCAGTCCTCATTTGTATAGTCATCGGGATTATA
GCAGGTTTCGTTCCCAAAGGTAAATCAGGATGATATATGGTAGCACCCGA
TCTCTCTGTGTCTGCCTGTGTCAGTGCGTGTACGCATGTGTATATGCGTG
TTTCACCGCCAGCAATCACAGATCTGTTGTACATTTATTTCTAATCTCTC
CTCTCTTGATCAAACACAAATATATACAATATATATACAATATATATATT
GGAAATGGCTGTTACAGCACAATCGATGATCTAGCATTGTTATAGATTTT
TATTCTATTTTATTGTATAAATTATTACAAATGCTGATGAAAAATTTTCT
CATAAAAAATATGAAGAAATCAATCGATCAAAAAAGGTTTATTCAATT
back to top

protein sequence of SMED30002549-orf-1

>SMED30002549-orf-1 ID=SMED30002549-orf-1|Name=SMED30002549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=297bp
MTKDLLAALKATQPEDEDSLPDTSINVDSAQYMNEFFNQVEDIRTMIDQI
QNFVDDVKNKHSDILSSPHQDEKTKTQLEEAMAEIKKNANKVRFKLKNIE
QSIEQDEAQDKSSADLRIKKTQYSTISRNFIEVMADYNKAQVAYRDACKN
RIKRQMEIAERKISNEELEDMLESGNPAIFTQEIMTDTNQAKQSLADIEA
RHQDIMKLEKSIKELHDMFLDMAMLVESQGEMIDRIEYNVEQAVDYIETA
KADTKKAVKYQSAARKKMIIIGVCVAVLICIVIGIIAGFVPKGKSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR028669STX1
IPR000727T_SNARE_dom
IPR006011Syntaxin_N
IPR006012Syntaxin/epimorphin_CS
IPR010989SNARE
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005484SNAP receptor activity
GO:0000149SNARE binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
GO:0017157regulation of exocytosis
GO:0061025membrane fusion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 75..109
NoneNo IPR availableCOILSCoilCoilcoord: 149..169
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 183..290
e-value: 2.7E-41
score: 141.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.70coord: 32..156
e-value: 9.5E-48
score: 163.3
NoneNo IPR availablePANTHERPTHR19957SYNTAXINcoord: 15..285
NoneNo IPR availableCDDcd15880SNARE_syntaxin1coord: 194..262
e-value: 6.66002E-38
score: 126.857
NoneNo IPR availableTMHMMTMhelixcoord: 269..291
IPR006011Syntaxin, N-terminal domainSMARTSM00503SynN_4coord: 28..149
e-value: 4.3E-29
score: 112.7
IPR006011Syntaxin, N-terminal domainPFAMPF00804Syntaxincoord: 33..230
e-value: 4.4E-58
score: 196.3
IPR006011Syntaxin, N-terminal domainCDDcd00179SynNcoord: 33..184
e-value: 2.87444E-45
score: 148.586
IPR000727Target SNARE coiled-coil homology domainSMARTSM00397tSNARE_6coord: 190..257
e-value: 4.0E-23
score: 92.8
IPR000727Target SNARE coiled-coil homology domainPFAMPF05739SNAREcoord: 231..283
e-value: 1.5E-17
score: 63.3
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 195..257
score: 21.125
IPR028669Syntaxin 1PANTHERPTHR19957:SF84SYNTAXIN-1Acoord: 15..285
IPR006012Syntaxin/epimorphin, conserved sitePROSITEPS00914SYNTAXINcoord: 201..240
IPR010989SNARESUPERFAMILYSSF47661t-snare proteinscoord: 32..250