U-actitoxin-Avd3j

Overview
NameU-actitoxin-Avd3j
Smed IDSMED30002548
Length (bp)180
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002548

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30002548 Contig32141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002548 Contig32141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002548 Contig55339uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002548 Contig55339newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30002548 Contig32141newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30002548 Contig32141uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Match: WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30916])

HSP 1 Score: 60.077 bits (144), Expect = 4.069e-12
Identity = 23/41 (56.10%), Postives = 33/41 (80.49%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+A  PR+ YNS+TG+C+ F+YGGC GN NNF+S + CE++
Sbjct:  302 CKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEES 342          
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Match: WFIKKN2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30916])

HSP 1 Score: 59.3066 bits (142), Expect = 8.757e-12
Identity = 23/41 (56.10%), Postives = 33/41 (80.49%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+A  PR+ YNS+TG+C+ F+YGGC GN NNF+S + CE++
Sbjct:  395 CKAYAPRWAYNSQTGQCQSFVYGGCEGNGNNFESREACEES 435          
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Match: APLP2 (amyloid beta precursor like protein 2 [Source:HGNC Symbol;Acc:HGNC:598])

HSP 1 Score: 58.5362 bits (140), Expect = 1.435e-11
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y++   GKC +FIYGGC GN+NNF+S   C
Sbjct:  319 CRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYC 356          
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Match: APLP2 (amyloid beta precursor like protein 2 [Source:HGNC Symbol;Acc:HGNC:598])

HSP 1 Score: 58.5362 bits (140), Expect = 1.435e-11
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y++   GKC +FIYGGC GN+NNF+S   C
Sbjct:  319 CRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYC 356          
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Match: APLP2 (amyloid beta precursor like protein 2 [Source:HGNC Symbol;Acc:HGNC:598])

HSP 1 Score: 58.5362 bits (140), Expect = 1.449e-11
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y++   GKC +FIYGGC GN+NNF+S   C
Sbjct:  319 CRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYC 356          
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 53.5286 bits (127), Expect = 3.243e-10
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             +C    PR+++NS+TG+CE+F YG C GN+NNF     CE+
Sbjct: 2175 GVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCER 2216          

HSP 2 Score: 49.6766 bits (117), Expect = 8.221e-9
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C     RY+YN  + KCE+F Y GC GN NN++S + CE
Sbjct:  432 CHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACE 470          

HSP 3 Score: 49.2914 bits (116), Expect = 1.010e-8
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            R  C     R+Y+N+   +C+ F +GGC GNQNNF+  +DCE
Sbjct:  545 RGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCE 586          

HSP 4 Score: 46.595 bits (109), Expect = 8.738e-8
Identity = 23/43 (53.49%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            CQ    RYYY+  T  C  F Y GC GN NNF S +DC Q LC
Sbjct: 2742 CQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDC-QRLC 2783          

HSP 5 Score: 46.595 bits (109), Expect = 9.545e-8
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+    R+Y+N   G C  F YGGC GN+N+F + K+CE
Sbjct: 1083 CKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECE 1121          

HSP 6 Score: 41.9726 bits (97), Expect = 4.486e-6
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLCN 176
            C  +  R+ ++     C  F YGGC GN NNF + ++C     N
Sbjct:  866 CAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCVN 909          
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 53.5286 bits (127), Expect = 3.243e-10
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             +C    PR+++NS+TG+CE+F YG C GN+NNF     CE+
Sbjct: 2184 GVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCER 2225          

HSP 2 Score: 49.6766 bits (117), Expect = 8.221e-9
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C     RY+YN  + KCE+F Y GC GN NN++S + CE
Sbjct:  432 CHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACE 470          

HSP 3 Score: 49.2914 bits (116), Expect = 1.030e-8
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            R  C     R+Y+N+   +C+ F +GGC GNQNNF+  +DCE
Sbjct:  545 RGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCE 586          

HSP 4 Score: 46.595 bits (109), Expect = 8.824e-8
Identity = 23/43 (53.49%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            CQ    RYYY+  T  C  F Y GC GN NNF S +DC Q LC
Sbjct: 2751 CQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDC-QRLC 2792          

HSP 5 Score: 46.595 bits (109), Expect = 9.639e-8
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+    R+Y+N   G C  F YGGC GN+N+F + K+CE
Sbjct: 1092 CKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECE 1130          

HSP 6 Score: 41.9726 bits (97), Expect = 4.486e-6
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLCN 176
            C  +  R+ ++     C  F YGGC GN NNF + ++C     N
Sbjct:  875 CAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCVN 918          
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 53.5286 bits (127), Expect = 3.646e-10
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             +C    PR+++NS+TG+CE+F YG C GN+NNF     CE+
Sbjct: 2055 GVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCER 2096          

HSP 2 Score: 49.2914 bits (116), Expect = 9.246e-9
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C     RY+YN  + KCE+F Y GC GN NN++S + CE
Sbjct:  303 CHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACE 341          

HSP 3 Score: 49.2914 bits (116), Expect = 1.136e-8
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            R  C     R+Y+N+   +C+ F +GGC GNQNNF+  +DCE
Sbjct:  416 RGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCE 457          

HSP 4 Score: 46.595 bits (109), Expect = 9.828e-8
Identity = 23/43 (53.49%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            CQ    RYYY+  T  C  F Y GC GN NNF S +DC Q LC
Sbjct: 2622 CQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDC-QRLC 2663          

HSP 5 Score: 46.2098 bits (108), Expect = 1.063e-7
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+    R+Y+N   G C  F YGGC GN+N+F + K+CE
Sbjct:  963 CKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECE 1001          

HSP 6 Score: 41.5874 bits (96), Expect = 4.900e-6
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLCN 176
            C  +  R+ ++     C  F YGGC GN NNF + ++C     N
Sbjct:  746 CAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCVN 789          
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.7582 bits (125), Expect = 6.368e-10
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             +C    PR+++NS+TG+CE+F YG C GN+NNF     CE+
Sbjct: 1658 GVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCER 1699          

HSP 2 Score: 48.9062 bits (115), Expect = 1.509e-8
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C     RY+YN  + KCE+F Y GC GN NN++S + CE
Sbjct:  432 CHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACE 470          

HSP 3 Score: 48.521 bits (114), Expect = 1.835e-8
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            R  C     R+Y+N+   +C+ F +GGC GNQNNF+  +DCE
Sbjct:  545 RGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCE 586          

HSP 4 Score: 45.8246 bits (107), Expect = 1.685e-7
Identity = 23/43 (53.49%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            CQ    RYYY+  T  C  F Y GC GN NNF S +DC Q LC
Sbjct: 2225 CQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDC-QRLC 2266          

HSP 5 Score: 45.8246 bits (107), Expect = 1.735e-7
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+    R+Y+N   G C  F YGGC GN+N+F + K+CE
Sbjct: 1092 CKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECE 1130          

HSP 6 Score: 41.2022 bits (95), Expect = 7.473e-6
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLCN 176
            C  +  R+ ++     C  F YGGC GN NNF + ++C     N
Sbjct:  875 CAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCVN 918          
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 52.373 bits (124), Expect = 7.667e-10
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             +C    PR+++NS+TG+CE+F YG C GN+NNF     CE+
Sbjct: 1437 GVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCER 1478          

HSP 2 Score: 48.521 bits (114), Expect = 1.799e-8
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C     RY+YN  + KCE+F Y GC GN NN++S + CE
Sbjct:  211 CHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACE 249          

HSP 3 Score: 48.1358 bits (113), Expect = 2.210e-8
Identity = 19/42 (45.24%), Postives = 27/42 (64.29%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            R  C     R+Y+N+   +C+ F +GGC GNQNNF+  +DCE
Sbjct:  324 RGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCE 365          

HSP 4 Score: 45.4394 bits (106), Expect = 1.971e-7
Identity = 23/43 (53.49%), Postives = 25/43 (58.14%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            CQ    RYYY+  T  C  F Y GC GN NNF S +DC Q LC
Sbjct: 2004 CQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDC-QRLC 2045          

HSP 5 Score: 45.4394 bits (106), Expect = 2.010e-7
Identity = 18/39 (46.15%), Postives = 25/39 (64.10%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+    R+Y+N   G C  F YGGC GN+N+F + K+CE
Sbjct:  871 CKNFADRWYFNVDDGTCHPFKYGGCAGNRNHFFTQKECE 909          

HSP 6 Score: 41.2022 bits (95), Expect = 8.242e-6
Identity = 15/44 (34.09%), Postives = 22/44 (50.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLCN 176
            C  +  R+ ++     C  F YGGC GN NNF + ++C     N
Sbjct:  654 CAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKCVN 697          
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Match: CG13748 (gene:FBgn0033355 transcript:FBtr0088656)

HSP 1 Score: 54.6842 bits (130), Expect = 1.971e-11
Identity = 22/48 (45.83%), Postives = 36/48 (75.00%), Query Frame = 3
Query:   15 MLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            ++P++  + +C+A+IPR+ Y+ +  KC +F +GGC GN+NNF S KDC
Sbjct:   61 LMPAR--KGVCRALIPRWRYDPEQKKCVEFKFGGCDGNENNFASYKDC 106          
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0077545)

HSP 1 Score: 53.5286 bits (127), Expect = 6.835e-11
Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C A+  RY YN  T  CE+F+YGGC GN+NNF+S + CEQ
Sbjct:   64 CFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103          
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0346581)

HSP 1 Score: 53.5286 bits (127), Expect = 6.835e-11
Identity = 23/40 (57.50%), Postives = 29/40 (72.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C A+  RY YN  T  CE+F+YGGC GN+NNF+S + CEQ
Sbjct:   64 CFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103          
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0077546)

HSP 1 Score: 51.6026 bits (122), Expect = 1.347e-10
Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C A IP + Y+ +T  CEKFIYGGC GN+N F + + CEQ
Sbjct:   39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQ 78          
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0345610)

HSP 1 Score: 51.6026 bits (122), Expect = 1.347e-10
Identity = 22/40 (55.00%), Postives = 28/40 (70.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C A IP + Y+ +T  CEKFIYGGC GN+N F + + CEQ
Sbjct:   39 CAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQ 78          
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Match: tfpia (tissue factor pathway inhibitor a [Source:ZFIN;Acc:ZDB-GENE-030711-1])

HSP 1 Score: 53.5286 bits (127), Expect = 4.375e-10
Identity = 21/40 (52.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A+  R+Y++  TG+CE F YGGC+GN NNF++ +DCE+
Sbjct:   51 CKAMKDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEE 90          

HSP 2 Score: 51.9878 bits (123), Expect = 1.734e-9
Identity = 19/40 (47.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+ ++PRY+++ K+ +C++F YGGC GN NNF++ K C+Q
Sbjct:  110 CRGLVPRYFFDQKSQECKQFFYGGCFGNANNFKTIKACQQ 149          
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Match: tfpia (tissue factor pathway inhibitor a [Source:ZFIN;Acc:ZDB-GENE-030711-1])

HSP 1 Score: 53.5286 bits (127), Expect = 4.631e-10
Identity = 21/40 (52.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A+  R+Y++  TG+CE F YGGC+GN NNF++ +DCE+
Sbjct:   50 CKAMKDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEE 89          

HSP 2 Score: 51.9878 bits (123), Expect = 1.747e-9
Identity = 19/40 (47.50%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+ ++PRY+++ K+ +C++F YGGC GN NNF++ K C+Q
Sbjct:  109 CRGLVPRYFFDQKSQECKQFFYGGCFGNANNFKTIKACQQ 148          
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 53.1434 bits (126), Expect = 7.167e-10
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C A +PR+Y+ ++ G+C  F +GGC GN+NNF+S + C
Sbjct:  315 CHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYC 352          
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Match: aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:ZFIN;Acc:ZDB-GENE-061009-28])

HSP 1 Score: 53.1434 bits (126), Expect = 7.171e-10
Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A +PR++++ +  KC +FIYGGC GN+NNF S + C
Sbjct:  324 CRASMPRWHFDMQQRKCVRFIYGGCAGNRNNFDSEEYC 361          
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Match: appb (amyloid beta (A4) precursor protein b [Source:ZFIN;Acc:ZDB-GENE-020220-1])

HSP 1 Score: 53.1434 bits (126), Expect = 7.825e-10
Identity = 18/38 (47.37%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C A +PR+Y+ ++ G+C  F +GGC GN+NNF+S + C
Sbjct:  304 CHAKLPRWYFVAEKGRCASFTFGGCGGNRNNFESEEYC 341          
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 56.9954 bits (136), Expect = 4.638e-11
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A+IPR+YY+    KC +FIYGGC GN+NNF S   C
Sbjct:  310 CRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYC 347          
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 56.9954 bits (136), Expect = 5.164e-11
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A+IPR+YY+    KC +FIYGGC GN+NNF S   C
Sbjct:  298 CRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYC 335          
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 56.6102 bits (135), Expect = 5.637e-11
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A+IPR+YY+    KC +FIYGGC GN+NNF S   C
Sbjct:  288 CRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYC 325          
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 56.6102 bits (135), Expect = 6.040e-11
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A+IPR+YY+    KC +FIYGGC GN+NNF S   C
Sbjct:  298 CRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYC 335          
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Match: gtf2e2 (general transcription factor IIE subunit 2 [Source:Xenbase;Acc:XB-GENE-962385])

HSP 1 Score: 56.6102 bits (135), Expect = 6.095e-11
Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A+IPR+YY+    KC +FIYGGC GN+NNF S   C
Sbjct:  264 CRAMIPRWYYDVTERKCAQFIYGGCGGNRNNFDSEDYC 301          
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Match: Spint3 (serine peptidase inhibitor, Kunitz type, 3 [Source:MGI Symbol;Acc:MGI:3651470])

HSP 1 Score: 58.151 bits (139), Expect = 6.321e-13
Identity = 25/39 (64.10%), Postives = 31/39 (79.49%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+A+  R+YYNSKTGKCE F YGGC+GN+NNF S   C+
Sbjct:   44 CRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQ 82          
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Match: Wfikkn2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:MGI Symbol;Acc:MGI:2669209])

HSP 1 Score: 59.3066 bits (142), Expect = 5.724e-12
Identity = 23/41 (56.10%), Postives = 33/41 (80.49%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+A +PR+ YNS+TG C+ F+YGGC GN NNF+S + CE++
Sbjct:  390 CKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFESREACEES 430          
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Match: Aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:MGI Symbol;Acc:MGI:88047])

HSP 1 Score: 58.5362 bits (140), Expect = 9.379e-12
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y++   GKC +FIYGGC GN+NNF+S   C
Sbjct:  319 CRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYC 356          
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Match: Aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:MGI Symbol;Acc:MGI:88047])

HSP 1 Score: 57.3806 bits (137), Expect = 2.210e-11
Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y++   GKC +FIYGGC GN+NNF+S   C
Sbjct:  319 CRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYC 356          
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Match: Spint2 (serine protease inhibitor, Kunitz type 2 [Source:MGI Symbol;Acc:MGI:1338031])

HSP 1 Score: 54.299 bits (129), Expect = 2.149e-10
Identity = 21/38 (55.26%), Postives = 29/38 (76.32%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A IPR++YN   G C+ F+YGGC GN NN+QS ++C
Sbjct:   47 CRASIPRWWYNITDGSCQPFVYGGCEGNGNNYQSKEEC 84          

HSP 2 Score: 50.447 bits (119), Expect = 5.765e-9
Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+A  PR+YY+++   C  FIYGGCRGN+N++ S + C Q+
Sbjct:  142 CRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQH 182          
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Match: sp|Q8WPI3|BOOG2_RHIMP (Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN=G2 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.002e-13
Identity = 26/49 (53.06%), Postives = 40/49 (81.63%), Query Frame = 3
Query:   18 LPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            LP+ E   +C+A+IPR+Y+N++TGKC  F YGGC GN+NNF++ +DC++
Sbjct:   23 LPADE--GICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEDCQK 69          

HSP 2 Score: 51.9878 bits (123), Expect = 3.518e-9
Identity = 19/39 (48.72%), Postives = 30/39 (76.92%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C   + R++YN ++G+CE F+YGGC GN NN++S ++CE
Sbjct:   98 CAGQLERWFYNVRSGECETFVYGGCGGNDNNYESEEECE 136          
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Match: sp|P0DN09|VKT5_ANEVI (U-actitoxin-Avd3h OS=Anemonia viridis OX=51769 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.221e-13
Identity = 26/40 (65.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A  PRYYYNS + +CEKFIYGGCRGN NNF + ++CE+
Sbjct:   30 CRARFPRYYYNSSSKRCEKFIYGGCRGNANNFHTLEECEK 69          
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Match: sp|P0DN12|VKT8_ANEVI (U-actitoxin-Avd3k OS=Anemonia viridis OX=51769 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.407e-13
Identity = 30/50 (60.00%), Postives = 37/50 (74.00%), Query Frame = 3
Query:   15 MLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            +LP    R  C+A  PRYYYNS + +CEKFIYGGCRGN NNF + K+CE+
Sbjct:   22 LLPMDVGR--CRARHPRYYYNSSSKRCEKFIYGGCRGNANNFITKKECEK 69          
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Match: sp|Q9TWG0|VKT1_ANESU (KappaPI-actitoxin-Avd3b OS=Anemonia sulcata OX=6108 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.510e-13
Identity = 29/50 (58.00%), Postives = 37/50 (74.00%), Query Frame = 3
Query:   15 MLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            +LP    R  C+A  PRYYYNS + +CEKFIYGGCRGN NNF + ++CE+
Sbjct:    6 LLPMDVGR--CRASHPRYYYNSSSKRCEKFIYGGCRGNANNFHTLEECEK 53          
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Match: sp|Q9TWF9|VKT2_ANESU (KappaPI-actitoxin-Avd3c OS=Anemonia sulcata OX=6108 PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.578e-13
Identity = 30/50 (60.00%), Postives = 37/50 (74.00%), Query Frame = 3
Query:   15 MLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            +LP    R  C+A  PRYYYNS + +CEKFIYGGCRGN NNF + K+CE+
Sbjct:    6 LLPMDVGR--CRARHPRYYYNSSSRRCEKFIYGGCRGNANNFITKKECEK 53          
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Match: I1ZII0 (Serine protease inhibitor-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.292e-18
Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+A  PRYYYNSKTGKCEKFIYGGC+GNQNNFQSSKDCEQN
Sbjct:   32 CKAYFPRYYYNSKTGKCEKFIYGGCKGNQNNFQSSKDCEQN 72          
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Match: A0A2P6KJJ0 (BPTI/Kunitz domain-containing protein OS=Nephila clavipes OX=2585209 GN=NCL1_38046 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.950e-12
Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+A IPRYYYN KT KCEKFIYGGC GN NNF++ +DCE
Sbjct:   62 CKAAIPRYYYNKKTKKCEKFIYGGCNGNSNNFRTLEDCE 100          
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Match: H9GB43 (Uncharacterized protein OS=Anolis carolinensis OX=28377 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 6.148e-12
Identity = 27/50 (54.00%), Postives = 39/50 (78.00%), Query Frame = 3
Query:   12 YMLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            ++LP+      C+A++PRY+YN K+ +CEKFIYGGC GN+NNF++ KDC 
Sbjct:   31 HLLPNP---GPCRAVVPRYFYNPKSNRCEKFIYGGCHGNKNNFETLKDCH 77          
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Match: A0A2P6JVV9 (U-actitoxin-Avd3j OS=Nephila clavipes OX=2585209 GN=NCL1_61548 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.774e-11
Identity = 26/39 (66.67%), Postives = 33/39 (84.62%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C+A +PR+YYN  T KCE+FIYGGC+GN NNFQ+ +DCE
Sbjct:   43 CKAAMPRFYYNKNTKKCERFIYGGCKGNNNNFQTLEDCE 81          
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Match: H9GVY4 (Uncharacterized protein OS=Anolis carolinensis OX=28377 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.029e-11
Identity = 27/50 (54.00%), Postives = 39/50 (78.00%), Query Frame = 3
Query:   12 YMLPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            ++LP+      C+A++PRY+YN K+ +CEKFIYGGC GN+NNF++ KDC 
Sbjct:  139 HLLPNP---GPCRAVVPRYFYNPKSNRCEKFIYGGCHGNKNNFETLKDCH 185          
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Match: lrp11 (LDL receptor related protein 11 [Source:NCBI gene;Acc:103032685])

HSP 1 Score: 56.9954 bits (136), Expect = 2.489e-11
Identity = 19/38 (50.00%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+   PR+YY++  G+C+ F+YGGC+GN+NNF    DC
Sbjct:  426 CRGTFPRWYYDAAAGECKHFLYGGCKGNRNNFLQQTDC 463          
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Match: ENSAMXT00000053501.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:31379453:31384888:1 gene:ENSAMXG00000037311.1 transcript:ENSAMXT00000053501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.860e-11
Identity = 20/38 (52.63%), Postives = 30/38 (78.95%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR+Y+  + G+C  FIYGGC GN+NNF+S + C
Sbjct:   15 CRAMLPRWYFVKEEGRCAPFIYGGCGGNRNNFESEEYC 52          
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Match: lrp11 (LDL receptor related protein 11 [Source:NCBI gene;Acc:103032685])

HSP 1 Score: 55.4546 bits (132), Expect = 8.445e-11
Identity = 19/38 (50.00%), Postives = 28/38 (73.68%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+   PR+YY++  G+C+ F+YGGC+GN+NNF    DC
Sbjct:  426 CRGTFPRWYYDAAAGECKHFLYGGCKGNRNNFLQQTDC 463          
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 53.9138 bits (128), Expect = 3.760e-10
Identity = 19/41 (46.34%), Postives = 30/41 (73.17%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            R  C+A + R+Y+ ++TG+C  F +GGC GN+NNF+S + C
Sbjct:  317 RGPCRATLSRWYFVAETGRCAPFSFGGCGGNRNNFESEEYC 357          
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Match: appb (amyloid beta A4 protein-like [Source:NCBI gene;Acc:103046668])

HSP 1 Score: 53.5286 bits (127), Expect = 4.105e-10
Identity = 19/41 (46.34%), Postives = 30/41 (73.17%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            R  C+A + R+Y+ ++TG+C  F +GGC GN+NNF+S + C
Sbjct:  317 RGPCRATLSRWYFVAETGRCAPFSFGGCGGNRNNFESEEYC 357          
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 9.250e-12
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C A+IPR++YN KT  CE F YGGC GN NNF S + C
Sbjct:  175 CTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSC 212          

HSP 2 Score: 50.8322 bits (120), Expect = 6.128e-10
Identity = 20/43 (46.51%), Postives = 32/43 (74.42%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
             +C+A++ RY++N  +G CE+F YGGC+GN NNF+ +  C Q+
Sbjct:   81 GVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQH 123          

HSP 3 Score: 48.1358 bits (113), Expect = 5.739e-9
Identity = 21/38 (55.26%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A +PR +YN  T +CE F YGGC GN NNF+S  +C
Sbjct:   12 CRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAEC 49          
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 9.925e-12
Identity = 23/38 (60.53%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C A+IPR++YN KT  CE F YGGC GN NNF S + C
Sbjct:  176 CTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSC 213          

HSP 2 Score: 50.8322 bits (120), Expect = 6.294e-10
Identity = 20/43 (46.51%), Postives = 32/43 (74.42%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
             +C+A++ RY++N  +G CE+F YGGC+GN NNF+ +  C Q+
Sbjct:   82 GVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQH 124          

HSP 3 Score: 48.1358 bits (113), Expect = 5.887e-9
Identity = 21/38 (55.26%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A +PR +YN  T +CE F YGGC GN NNF+S  +C
Sbjct:   12 CRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAEC 49          
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 54.299 bits (129), Expect = 3.730e-11
Identity = 23/48 (47.92%), Postives = 33/48 (68.75%), Query Frame = 3
Query:   18 LPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            LP+K     C+A  PRY++N  T +CE FIYGGC  N+NNF++ ++C 
Sbjct:   29 LPAKP--GDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECR 74          

HSP 2 Score: 45.4394 bits (106), Expect = 5.002e-8
Identity = 19/38 (50.00%), Postives = 24/38 (63.16%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A I RY+YN   G C  F+YGGC GN N F+  + C
Sbjct:   96 CRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESC 133          
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 48.521 bits (114), Expect = 6.165e-9
Identity = 21/41 (51.22%), Postives = 27/41 (65.85%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C+    R+ YN    +C+ FIYGGC GN+NNFQS + CE N
Sbjct:  383 CKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDN 423          
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 4.463e-8
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+    R+ Y++ T  C++F YGGCRGNQNNF    +C
Sbjct:   10 CRGSFTRWTYDAATSTCKEFTYGGCRGNQNNFLEEAEC 47          

HSP 2 Score: 41.2022 bits (95), Expect = 1.927e-6
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+    R+ Y++++G C++F YGGC GN NNF    +C
Sbjct:  175 CRGSFTRWTYDAESGHCKEFTYGGCGGNFNNFLEETEC 212          
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Match: EDO47795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL41])

HSP 1 Score: 59.3066 bits (142), Expect = 3.267e-14
Identity = 23/41 (56.10%), Postives = 33/41 (80.49%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQN 167
            C A +PR+YYN+K  +C+KF+YGGCRGN N F+S + CE++
Sbjct:   11 CSAYVPRWYYNAKHRRCQKFVYGGCRGNANRFKSHRSCERS 51          
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 57.7658 bits (138), Expect = 1.782e-13
Identity = 22/40 (55.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A +PR ++NS++GKCE FIYGGC GN NNF + ++C++
Sbjct:   23 CRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKK 62          
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Match: EDO38284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDB9])

HSP 1 Score: 52.7582 bits (125), Expect = 1.318e-11
Identity = 22/39 (56.41%), Postives = 29/39 (74.36%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCE 161
            C A I R+YYN+K GKC+ F++GGC  N NNF++ K CE
Sbjct:   22 CMASIERFYYNAKIGKCQSFVFGGCLPNGNNFKTRKACE 60          
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 50.8322 bits (120), Expect = 5.975e-11
Identity = 20/40 (50.00%), Postives = 31/40 (77.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A   R++YN  + KC++F+YGGC+GN NNF+S  +CE+
Sbjct:   11 CRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEK 50          
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Match: EDO26263 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 50.8322 bits (120), Expect = 5.975e-11
Identity = 20/40 (50.00%), Postives = 31/40 (77.50%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            C+A   R++YN  + KC++F+YGGC+GN NNF+S  +CE+
Sbjct:   11 CRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEK 50          
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 57.7658 bits (138), Expect = 1.424e-11
Identity = 19/38 (50.00%), Postives = 32/38 (84.21%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+A++PR++++ + G+C +FIYGGC GN+NNF+S + C
Sbjct:  339 CRALLPRWFFDREEGRCVQFIYGGCGGNRNNFESEEYC 376          
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Match: lrp11 (low-density lipoprotein receptor-related protein 11 [Source:NCBI gene;Acc:101175213])

HSP 1 Score: 56.225 bits (134), Expect = 4.851e-11
Identity = 20/38 (52.63%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+   PR+YY+  TG+C+ F+YGGC+GN NNF    DC
Sbjct:  403 CKGTFPRWYYDQNTGECKHFLYGGCQGNHNNFLQELDC 440          
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Match: ENSORLT00000012975.2 (pep primary_assembly:ASM223467v1:12:15740273:15760140:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000012975.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 9.996e-11
Identity = 24/42 (57.14%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             LC     RY+YN + G+CE FIYGGC GNQNNF + K+C Q
Sbjct:   80 GLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQ 121          

HSP 2 Score: 54.299 bits (129), Expect = 9.996e-11
Identity = 24/42 (57.14%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             LC     RY+YN + G+CE FIYGGC GNQNNF + K+C Q
Sbjct:  132 GLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQ 173          
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Match: ENSORLT00000042019.1 (pep primary_assembly:ASM223467v1:12:15740119:15780496:1 gene:ENSORLG00000010354.2 transcript:ENSORLT00000042019.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 3.778e-10
Identity = 24/42 (57.14%), Postives = 29/42 (69.05%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
             LC     RY+YN + G+CE FIYGGC GNQNNF + K+C Q
Sbjct:   88 GLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKECLQ 129          

HSP 2 Score: 52.373 bits (124), Expect = 8.948e-10
Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
             LC     RY+YN + G+CE FIYGGC GNQNNF + K+C
Sbjct:   32 GLCFGYFERYFYNFRKGRCEIFIYGGCLGNQNNFLTEKEC 71          

HSP 3 Score: 45.0542 bits (105), Expect = 4.292e-7
Identity = 20/38 (52.63%), Postives = 27/38 (71.05%), Query Frame = 3
Query:   45 CQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
            C+    RY+YN K  +CE FIYG C GNQNNF++ ++C
Sbjct:  142 CECYSERYFYNFKKRRCEIFIYGCCNGNQNNFETEQEC 179          
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Match: wfikkn2a (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:NCBI gene;Acc:101168544])

HSP 1 Score: 53.5286 bits (127), Expect = 4.611e-10
Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 3
Query:   18 LPSKE*RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQ 164
            LPS +    C+A  PR+ Y+S   KC+ F+YGGC GN+NNF+S + CEQ
Sbjct:  390 LPSLQ--GPCKAYEPRWAYSSTLKKCQSFVYGGCGGNENNFESKEACEQ 436          
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Match: SMESG000037997.1 (SMESG000037997.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.529e-14
Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            + LC+A  PRY+YN  + KCE+FIYGGC  N NNF++ KDC Q+LC
Sbjct:   33 KGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC-QDLC 77          
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Match: SMESG000038002.1 (SMESG000038002.1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.194e-14
Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            + LC+A  PRY+YN  + KCE+FIYGGC  N NNF++ KDC Q+LC
Sbjct:   33 KGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC-QDLC 77          
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Match: SMESG000037996.1 (SMESG000037996.1)

HSP 1 Score: 61.2326 bits (147), Expect = 7.548e-14
Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            + LC+A IPRY+YN  + KCE+FIYGGC  N NNF++ KDC Q+LC
Sbjct:   33 KGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDC-QDLC 77          

HSP 2 Score: 56.9954 bits (136), Expect = 3.230e-12
Identity = 26/46 (56.52%), Postives = 33/46 (71.74%), Query Frame = 3
Query:   36 RALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDCEQNLC 173
            +  C+A IPRY+YN  + KCE+FIYGGC  N NNF+  KDC Q+ C
Sbjct:   91 KGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKILKDC-QDFC 135          
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Match: SMESG000013910.1 (SMESG000013910.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.201e-13
Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
             LC+   PRY++N +TGKCEKFIYGGC+GN+NNF +  +C
Sbjct:   27 GLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIEC 66          
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Match: SMESG000013915.1 (SMESG000013915.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.036e-13
Identity = 24/40 (60.00%), Postives = 32/40 (80.00%), Query Frame = 3
Query:   39 ALCQAIIPRYYYNSKTGKCEKFIYGGCRGNQNNFQSSKDC 158
             LC+   PRY++N +TGKCEKFIYGGC+GN+NNF +  +C
Sbjct:   52 GLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIEC 91          
The following BLAST results are available for this feature:
BLAST of U-actitoxin-Avd3j vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WFIKKN24.069e-1256.10WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
WFIKKN28.757e-1256.10WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
APLP21.435e-1155.26amyloid beta precursor like protein 2 [Source:HGNC... [more]
APLP21.435e-1155.26amyloid beta precursor like protein 2 [Source:HGNC... [more]
APLP21.449e-1155.26amyloid beta precursor like protein 2 [Source:HGNC... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlt-113.243e-1047.62pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.243e-1047.62pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.646e-1047.62pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-116.368e-1047.62pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-117.667e-1047.62pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG137481.971e-1145.83gene:FBgn0033355 transcript:FBtr0088656[more]
CG36046.835e-1157.50gene:FBgn0031562 transcript:FBtr0077545[more]
CG36046.835e-1157.50gene:FBgn0031562 transcript:FBtr0346581[more]
IM331.347e-1055.00gene:FBgn0031561 transcript:FBtr0077546[more]
IM331.347e-1055.00gene:FBgn0031561 transcript:FBtr0345610[more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpia4.375e-1052.50tissue factor pathway inhibitor a [Source:ZFIN;Acc... [more]
tfpia4.631e-1052.50tissue factor pathway inhibitor a [Source:ZFIN;Acc... [more]
appb7.167e-1047.37amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
aplp27.171e-1050.00amyloid beta (A4) precursor-like protein 2 [Source... [more]
appb7.825e-1047.37amyloid beta (A4) precursor protein b [Source:ZFIN... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2e24.638e-1157.89general transcription factor IIE subunit 2 [Source... [more]
gtf2e25.164e-1157.89general transcription factor IIE subunit 2 [Source... [more]
gtf2e25.637e-1157.89general transcription factor IIE subunit 2 [Source... [more]
gtf2e26.040e-1157.89general transcription factor IIE subunit 2 [Source... [more]
gtf2e26.095e-1157.89general transcription factor IIE subunit 2 [Source... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spint36.321e-1364.10serine peptidase inhibitor, Kunitz type, 3 [Source... [more]
Wfikkn25.724e-1256.10WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
Aplp29.379e-1255.26amyloid beta (A4) precursor-like protein 2 [Source... [more]
Aplp22.210e-1155.26amyloid beta (A4) precursor-like protein 2 [Source... [more]
Spint22.149e-1055.26serine protease inhibitor, Kunitz type 2 [Source:M... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WPI3|BOOG2_RHIMP1.002e-1353.06Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN... [more]
sp|P0DN09|VKT5_ANEVI1.221e-1365.00U-actitoxin-Avd3h OS=Anemonia viridis OX=51769 PE=... [more]
sp|P0DN12|VKT8_ANEVI1.407e-1360.00U-actitoxin-Avd3k OS=Anemonia viridis OX=51769 PE=... [more]
sp|Q9TWG0|VKT1_ANESU1.510e-1358.00KappaPI-actitoxin-Avd3b OS=Anemonia sulcata OX=610... [more]
sp|Q9TWF9|VKT2_ANESU1.578e-1360.00KappaPI-actitoxin-Avd3c OS=Anemonia sulcata OX=610... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZII04.292e-1890.24Serine protease inhibitor-1 (Fragment) OS=Schmidte... [more]
A0A2P6KJJ02.950e-1274.36BPTI/Kunitz domain-containing protein OS=Nephila c... [more]
H9GB436.148e-1254.00Uncharacterized protein OS=Anolis carolinensis OX=... [more]
A0A2P6JVV91.774e-1166.67U-actitoxin-Avd3j OS=Nephila clavipes OX=2585209 G... [more]
H9GVY44.029e-1154.00Uncharacterized protein OS=Anolis carolinensis OX=... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp112.489e-1150.00LDL receptor related protein 11 [Source:NCBI gene;... [more]
ENSAMXT00000053501.15.860e-1152.63pep primary_assembly:Astyanax_mexicanus-2.0:12:313... [more]
lrp118.445e-1150.00LDL receptor related protein 11 [Source:NCBI gene;... [more]
appb3.760e-1046.34amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
appb4.105e-1046.34amyloid beta A4 protein-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005043.19.250e-1260.53pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005038.19.925e-1260.53pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
tfpi23.730e-1147.92tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
WFIKKN16.165e-951.22WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
ENSPMAT00000009465.14.463e-847.37pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477953.267e-1456.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298191.782e-1355.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382841.318e-1156.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416965.975e-1150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262635.975e-1150.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APP1.424e-1150.00amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
lrp114.851e-1152.63low-density lipoprotein receptor-related protein 1... [more]
ENSORLT00000012975.29.996e-1157.14pep primary_assembly:ASM223467v1:12:15740273:15760... [more]
ENSORLT00000042019.13.778e-1057.14pep primary_assembly:ASM223467v1:12:15740119:15780... [more]
wfikkn2a4.611e-1051.02WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of U-actitoxin-Avd3j vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037997.11.529e-1458.70SMESG000037997.1[more]
SMESG000038002.12.194e-1458.70SMESG000038002.1[more]
SMESG000037996.17.548e-1460.87SMESG000037996.1[more]
SMESG000013910.11.201e-1360.00SMESG000013910.1[more]
SMESG000013915.12.036e-1360.00SMESG000013915.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002548 ID=SMED30002548|Name=U-actitoxin-Avd3j|organism=Schmidtea mediterranea sexual|type=transcript|length=180bp
ATGACAGATAGTATATGCTCCCTTCCAAAGAATGAAGGGCCCTTTGCCAA
GCTATTATTCCAAGATATTATTATAATTCAAAGACTGGAAAATGCGAAAA
ATTCATTTATGGAGGCTGCAGAGGAAATCAAAATAATTTTCAAAGTAGCA
AGGATTGTGAACAAAATTTATGTAATATAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0042151nematocyst
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0006508proteolysis
GO:0010951negative regulation of endopeptidase activity
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
GO:0090729toxin activity
GO:0004867serine-type endopeptidase inhibitor activity
GO:0008233peptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR036880Kunitz_BPTI_sf
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002223Pancreatic trypsin inhibitor Kunitz domainPRINTSPR00759BASICPTASEcoord: 31..41
score: 63.89
coord: 3..17
score: 38.44
coord: 41..50
score: 31.65
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 4..50
e-value: 6.0E-17
score: 72.3
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 5..49
e-value: 5.0E-20
score: 71.5
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 6..50
score: 13.854
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 4..48
e-value: 2.54234E-20
score: 72.6678
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 2..50
e-value: 2.3E-23
score: 83.7
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 2..49
NoneNo IPR availablePANTHERPTHR10083KUNITZ-TYPE PROTEASE INHIBITOR-RELATEDcoord: 5..48
NoneNo IPR availablePANTHERPTHR10083:SF328TISSUE FACTOR PATHWAY INHIBITORcoord: 5..48