Transient receptor potential cation channel subfamily M member 6

Overview
NameTransient receptor potential cation channel subfamily M member 6
Smed IDSMED30002539
Length (bp)4112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member 6 (SMED30002539) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 6 (SMED30002539) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member 6 (SMED30002539) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 6 (SMED30002539) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30002539SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002539SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002539SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002539SMESG000064631.1 SMESG000064622.1 dd_Smed_v4_10029_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 296.975 bits (759), Expect = 2.275e-81
Identity = 323/1193 (27.07%), Postives = 533/1193 (44.68%), Query Frame = 1
Query:  265 MQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH-------------KENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS--------GDISLSNDE----------------------------------------------WAAFLKDSIITG----KVKFIELFLENVSNIQDFLTANILKELYET--CPKST-------------------------------------------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPCSE----------------NDSIKHPFQELF----LWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTS--ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG-VLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            M  +++I   F   EC +   + K+    +++C CG+    H             +ENK      E WS     +  PT S+G +EF G   +N  +  ++RVSY  K D ++ L+   W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A          HK     G+  + ES +    V  +K    + ++ HQ+      I + +K + L+TVF + S   +D++ AIL +L+K  ++           QLSL L WNRVDI + +IF         G ++   D                                               W   L+ +++      +V F++L +EN  N+Q FLT   L+ELY T   P +T                                           NFR  +  L G    K L        K++G    E P                   +D     FQ  F    +WAVLM++QK A F W + +ES+  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +   +++  D         NE   + S  I +K+  FY AP  KF  ++ +++ +++ F+YV+L  M     ++ E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G V      +Y    N      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P 
Sbjct:    1 MGQKSWIEKTFCKRECIFVIPSTKD----SNRCCCGQFTNQHIPPLPSATPSKNEEENKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFA----------HKYCEEGGI--INESLREQLLVTIQKTFNYNKAQSHQL---FAIIMECMKKKELVTVFRMGSEGQQDIEMAILTALLKGTNV-------SAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPPMATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKAL--------KLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISTFMIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1133          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 295.434 bits (755), Expect = 7.655e-81
Identity = 322/1193 (26.99%), Postives = 534/1193 (44.76%), Query Frame = 1
Query:  265 MQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH-------------KENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS--------GDISLSNDE----------------------------------------------WAAFLKDSIITG----KVKFIELFLENVSNIQDFLTANILKELYET--CPKST-------------------------------------------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPCSE----------------NDSIKHPFQELF----LWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTS--ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG-VLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            M  +++I   F   EC +   ++K+    +++C CG+    H             +E+K      E WS     +  PT S+G +EF G   +N  +  ++RVSY  K D ++ L+   W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A          HK     G+  + ES +    V  +K    + ++ HQ+      I + +K + L+TVF + S   +D++ AIL +L+K  ++           QLSL L WNRVDI + +IF         G ++   D                                               W   L+ +++      +V F++L +EN  N+Q FLT   L+ELY T   P +T                                           NFR  +  L G    K L        K++G    E P                   +D     FQ  F    +WAVLM++QK A F W + +ES+  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +   +++  D         NE   + S  I +K+  FY AP  KF  ++ +++ +++ F+YV+L  M     ++ E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G V      +Y    N      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P 
Sbjct:    1 MGQKSWIEKTFCKRECIFVIPSMKD----SNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFA----------HKYCEEGGI--INESLREQLLVTIQKTFNYNKAQSHQL---FAIIMECMKKKELVTVFRMGSEGQQDIEMAILTALLKGTNV-------SAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPPMATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKAL--------KLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISTFMIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1133          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 293.123 bits (749), Expect = 4.696e-80
Identity = 317/1162 (27.28%), Postives = 519/1162 (44.66%), Query Frame = 1
Query:  358 KCSCGEIKKSH-------------KENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS--------GDISLSNDE----------------------------------------------WAAFLKDSIITG----KVKFIELFLENVSNIQDFLTANILKELYET--CPKST-------------------------------------------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPCSE----------------NDSIKHPFQELF----LWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTS--ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG-VLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            +C CG+    H             +ENK      E WS     +  PT S+G +EF G   +N  +  ++RVSY  K D ++ L+   W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A          HK     G+  + ES +    V  +K    + ++ HQ+      I + +K + L+TVF + S   +D++ AIL +L+K  ++           QLSL L WNRVDI + +IF         G ++   D                                               W   L+ +++      +V F++L +EN  N+Q FLT   L+ELY T   P +T                                           NFR  +  L G    K L        K++G    E P                   +D     FQ  F    +WAVLM++QK A F W + +ES+  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +   +++  D         NE   + S  I +K+  FY AP  KF  ++ +++ +++ F+YV+L  M     ++ E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G V      +Y    N      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P 
Sbjct:    6 RCCCGQFTNQHIPPLPSATPSKNEEENKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFA----------HKYCEEGGI--INESLREQLLVTIQKTFNYNKAQSHQL---FAIIMECMKKKELVTVFRMGSEGQQDIEMAILTALLKGTNV-------SAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPPMATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKAL--------KLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISTFMIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1111          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:HGNC Symbol;Acc:HGNC:7146])

HSP 1 Score: 291.967 bits (746), Expect = 5.465e-80
Identity = 316/1164 (27.15%), Postives = 521/1164 (44.76%), Query Frame = 1
Query:  352 NSKCSCGEIKKSH-------------KENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS--------GDISLSNDE----------------------------------------------WAAFLKDSIITG----KVKFIELFLENVSNIQDFLTANILKELYET--CPKST-------------------------------------------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPCSE----------------NDSIKHPFQELF----LWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI---------------SKRTEFTKDFKTCQSESFPDF--------NEDNCRTS--ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG-VLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            +++C CG+    H             +E+K      E WS     +  PT S+G +EF G   +N  +  ++RVSY  K D ++ L+   W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+ S +GDA++   S      K    +  +GIAPWG V+N+  L       V+  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+P+V L+VEGG ++       ++E+  + +V+C+G+G+ASDI+  A          HK     G+  + ES +    V  +K    + ++ HQ+      I + +K + L+TVF + S   +D++ AIL +L+K  ++           QLSL L WNRVDI + +IF         G ++   D                                               W   L+ +++      +V F++L +EN  N+Q FLT   L+ELY T   P +T                                           NFR  +  L G    K L        K++G    E P                   +D     FQ  F    +WAVLM++QK A F W + +ES+  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+ P  I               SK  E  K+ +   +++  D         NE   + S  I +K+  FY AP  KF  ++ +++ +++ F+YV+L  M     ++ E + + Y+V + L+K  EI  S   ++  +IK W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P+   SW    NI   PY+ ++G V      +Y    N      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P 
Sbjct:    4 SNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAM--YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSS------KSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLS--VLNNSHTHFILADNG-----TLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFA----------HKYCEEGGI--INESLREQLLVTIQKTFNYNKAQSHQL---FAIIMECMKKKELVTVFRMGSEGQQDIEMAILTALLKGTNV-------SAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPPMATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKAL--------KLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWP-SLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQ-EYWNITDLVAISTFMIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPM 1111          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 271.937 bits (694), Expect = 2.296e-73
Identity = 336/1261 (26.65%), Postives = 555/1261 (44.01%), Query Frame = 1
Query:  523 FVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QK-----------------------QGDRVGI----PVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAA-----FLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN---------------------------------------------FRKTFLRLIGR-----PFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI--------------------------------------SKRTEFTKDFKTCQSESFPDFNEDNCRT-----SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW-SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQVLAFCYQKG------RCYNLSNSKKFEITKHNSKLH------IDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKI----QIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEV 3792
            +VRVS+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L    GR V   +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK                       Q D VGI    PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF     +   +W        + D+++  +V F++L +EN  ++  FLT + L+ELY T    +N                                             FR  +  L G      P  +G    K+   ++    + P  E +    PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                                       +  E T        ES    +E+  ++      +  K+  FY AP  KF  ++  +I +++ F+Y+VL  M+R   T  E + + Y+  + ++K  EI  S   ++  ++K W    +WN  D+I I+   V M+LR Q        D+   FR   + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +       + E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS    I+Q L   ++K       R Y L   K F       K+H      I++    K D      N  +D  +    +  EN S +    N   E++ S+K+ +  ++IR   +   +  + T L ++    + ++ K     S   T+  Y  I +Q          S   N   LQ+ ++  G+E 
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDL---IGRDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDP--EINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILRLQ--------DQP--FRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYG------EVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDERDYGL---KLFITDDELKKVHDFEEQCIEEYFREKDDRF----NSSNDERIRVTSERVENMSMRLEEVN---EREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAY--IVRQSS------FNSQEGNTFKLQESIDPAGEET 1184          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 207.608 bits (527), Expect = 7.458e-54
Identity = 201/801 (25.09%), Postives = 359/801 (44.82%), Query Frame = 1
Query:  280 YINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGP---------RESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQGDRVGIPVVLLIVEGG-------HDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDG--VAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELL-ITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-----ETCPKSTNFRKTF------------------LRLIGRPFS--------KGLNDVKELLSKMIGFYE---------YPCSENDSIKHPFQELFLWA----------VLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENL------AVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTW------RAGFNINFFSCILC---IIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTK 2421
            +I   F+  EC  F+   K+ +    +C CG    +H      +           +++W+  +  +   T +FG I F G    ++    +VR+SY  +  D++ L+   W + A  L I+V GG  +F++  +   +F +G++KAA TT A IIT GL+ G+   +  A+   ++ +  +M+    I  +GIAPWG +K +  L   +   V+Y+V +         LN  H++++  D+G     T  + G   + RQ LEN I+    +   +PVV  ++EGG       HD        +K  +  +VC+G+G+A+DII  A R           I SDG   A + E  +N++K    E D  E+ +     K  E +I+++LL I  +  +  ED+DF IL +++++ +L  D        QL+L L+WNRVD+ K  +FS     S+D     + D++   +V F+E  LEN  ++++FL+ N L+ LY      +     N+ + F                   +L+G  F         KG  D  + +++   F+          +    +D I    +E F +A          VL  +   A+  W   ++++   L+A R+YK   + +    D    +E  K  F+N       A++L+++C+  D +    L+  +  +WG  +CL LA  +    F+++  CQ  +   W      R+G N+   + ++C   I+F     K ++  +       E  P   E    TS +S   R+   P+ +
Sbjct:   88 WIENTFEKRECIRFAALPKDPE----RCGCGRPLSAHTPASTFFSTLPVHLLEKEQQTWTIANNTQTSTTDAFGTIVFQGG--AHAHKAQYVRLSYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALD--EAGISARMRSQ--IVTIGIAPWGVIKRKERL-IRQNEHVYYDVHSLSVNANVGILNDRHSYFLLADNG-----TVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVT-----MKPDIPAIVCDGSGRAADIISFAAR----------YINSDGTFAAEVGEKLRNLIKMVFPETDQEEMFR-----KITECVIRDDLLRIFRYGQEEEEDVDFVILSTVLQKQNLPPD-------EQLALTLSWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRYKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLAIRLYKATAKIA---EDEYLDVEEAKRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAILFMAYKPKHSKTARLLSEETPEQLPYPRES--ITSTTSNRYRYSKGPEEQ 840          

HSP 2 Score: 85.5001 bits (210), Expect = 2.734e-16
Identity = 93/361 (25.76%), Postives = 169/361 (46.81%), Query Frame = 1
Query: 2386 KLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWT--FNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQ-RDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHI-----DKPMAFKHDTLNIFSNIK 3444
            + R FY +P TKF      F+ F+   + ++L     ++ + +E +  IY V + ++   ++  S   RI  ++K ++   +N W                L + L   G     +    W + + S     FY+KI   L+ H  LGP I M +K++  +     ++L+ L+++GV  QA   P  +D+ W+ + NI   PY+ ++G +  G           T  +    C    F+ P+L   ++++ NILLLN+LIA  + I  D    S  IW +  Y  ++EY+D P LP PFS F ++Y  + + Y   R     ++K+F  ++H+ KL +      +   F+ D ++  + I+
Sbjct:  888 RFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETS-LKPSKYEWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAA------------LLFFLVGYGFRLVPMYRHSWGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWSMCYICVLLLVPLMAFGVNRQALTEPNVKDWHWLLVRNIFYKPYFMLYGEVYAGEI--------DTCGDEGIRCFPGYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSPFLPPPFSIFAHVYHFIDYLYNLRR----PDTKRFR-SEHSIKLSVTEDEMKRIQDFEEDCIDTLTRIR 1222          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 178.718 bits (452), Expect = 7.860e-45
Identity = 166/605 (27.44%), Postives = 270/605 (44.63%), Query Frame = 1
Query:  169 NEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIP-------------------------------------YGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQ-VDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1833
            NED + T   A+  +      + + F E++  +   N++   F   EC  F  + +++     KC CG  + +H+   IP                                      G  E WS       L T +FG++EF G    +     +VRV++  +   I+ L  + W+I+   L I+V GGT +F +  K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +    +L         +  H+ + E   C +   KN L I     +   D+D AIL +L+K  +          + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  147 NEDVSATANSAQLVLPTPLF-NQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDL----HKCGCGRTRDAHR--NIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQH--KNLLTIFRLGEQGEHDVDHAILTALLKGQN-------LSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 708          

HSP 2 Score: 77.411 bits (189), Expect = 6.975e-14
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1849 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2289
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  849 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1001          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 178.718 bits (452), Expect = 8.248e-45
Identity = 166/605 (27.44%), Postives = 270/605 (44.63%), Query Frame = 1
Query:  169 NEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIP-------------------------------------YGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQ-VDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1833
            NED + T   A+  +      + + F E++  +   N++   F   EC  F  + +++     KC CG  + +H+   IP                                      G  E WS       L T +FG++EF G    +     +VRV++  +   I+ L  + W+I+   L I+V GGT +F +  K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +    +L         +  H+ + E   C +   KN L I     +   D+D AIL +L+K  +          + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  187 NEDVSATANSAQLVLPTPLF-NQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDL----HKCGCGRTRDAHR--NIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQH--KNLLTIFRLGEQGEHDVDHAILTALLKGQN-------LSAADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 748          

HSP 2 Score: 77.411 bits (189), Expect = 7.305e-14
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1849 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2289
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  889 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1041          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 178.333 bits (451), Expect = 1.124e-44
Identity = 167/605 (27.60%), Postives = 271/605 (44.79%), Query Frame = 1
Query:  169 NEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIP-------------------------------------YGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQ---GDRVGIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKN---VLKRKLIEQDISELHQ-VDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIGFYEYPCS 1833
            NED + T   A+  +      + + F E++  +   N++   F   EC  F  + +++     KC CG  + +H+   IP                                      G  E WS       L T +FG++EF G    +     +VRV++  +   I+ L  + W+I+   L I+V GGT +F +  K   +F +GL+KAA TT A IIT G + G+   +  A++ +QS         N I C+GIAPWG +K R      + +TV Y  S+   K +   LN  H++++  D+G   +   + +   R+ LE  ISQKQ   G    +PVV +++EGG          V    +V +VVC+G+G+A+D++  A          H+ +  DG  +LP+  +    +L         +  H+ + E   C +   KN L I     +   D+D AIL +L+K  +L         + QL+L L WNRVDI +  +F+             + +++I  +V F+ L LE   N+Q FLT + L ELY T     N     +R + R   +G    L D+  ++ K++G   Y CS
Sbjct:  248 NEDVSATANSAQLVLPTPLF-NQMRFTESNMSLNRHNWVRETFTRRECSRFIASSRDL----HKCGCGRTRDAHR--NIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQS------AQRNKIVCIGIAPWGLLKKREDF-IGQDKTVPYYPSS--SKGRFTGLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFA----------HQNVTEDG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQH--KNLLTIFRLGEQGEHDVDHAILTALLKGQNLS-------AADQLALALAWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELYNTDKGPPNTLFYIVRDVVR-VRQGYRFKLPDIGLVIEKLMG-NSYQCS 809          

HSP 2 Score: 77.411 bits (189), Expect = 7.105e-14
Identity = 45/153 (29.41%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1849 KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFEN---LAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFS---CILCIIFPFLI 2289
            ++P+ EL +WAVL ++Q  A   W   +E++  ALVA R+YK     +  D    E  E  K Y E    L+++L++ C+ +D      L+  +  NW   +CL LA    +  F+++  CQ  +   W  G  +   S    +L +I P  I
Sbjct:  950 RYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1102          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 173.326 bits (438), Expect = 3.263e-43
Identity = 153/568 (26.94%), Postives = 257/568 (45.25%), Query Frame = 1
Query:  265 MQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKE---------------------------------NKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHN--NFISCLGIAPWGYVKNRNILEFAKGRTVHY--NVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQGDRVGIPVVLLIVEGG-------HDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVL---KRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDI--KSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIG 1812
            ++ +N+I  + K  +C YF  + +     + +C CG+ +  H E                                 N++   P   WS     E++PT ++G I F G     +    + R+S+     DIV L+   WK+    L I++ GG   F +  K    F +G++K A +T+A IIT GL++G+       +++  S L+D   H   N +  +GIA WG +K R+     K  TV Y  NV N     +   LN NH++++F D+G     T  + G     R+ LE  ++Q    R  IP+V +++EGG       HD      R     + ++VC+G+G+A+DI+  A          H+ +  +G   L ++ +N L    R++   D     ++   IK I +   N+ L+T+F +   S EDLD  I+  L+K  +L           QL L L WNR DI + +IF+     +  +    + +++   ++ F+ L LEN  ++Q FLT   L+ LY T     N  +T L L+       L +V  L+  ++G
Sbjct:  100 LKGKNWIECRLKMRQCSYFVPSQR----FSERCGCGKERSKHTEEVLERSQNKNHPLNHLTLPGIHEVDTTDADADDNEVNLTPGR-WSIQSHTEIVPTDAYGNIVFEG----TAHHAQYARISFDSDPRDIVHLMMKVWKLKPPKLIITINGGLTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGV-------VKHLDSALHDHGNHTSKNHVVAIGIASWGMLKQRSRF-VGKDSTVTYATNVFNNTRLKE---LNDNHSYFLFSDNG-----TVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPR-----IPVIVCDGSGRAADILAFA----------HQAVSQNG--FLSDNIRNQLVNIVRRIFGYDPKTAQKL---IKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKGQNL-------SPPEQLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTDKGPQNTLRTNL-LVDSKHHIKLVEVGRLVENLMG 614          

HSP 2 Score: 84.3445 bits (207), Expect = 6.141e-16
Identity = 46/163 (28.22%), Postives = 83/163 (50.92%), Query Frame = 1
Query: 1843 SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDR---SETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF------NINFFSCILCIIFPFLISKRTE 2304
            + ++P+ +L +WAVL ++QK AK  W   +E +  ALVA+R+Y    +T+   T     S+    + + F  LAV+++E C    ++    L+  +  NWG  +CL LA+ +   KF+++  CQ  +   W+ G       N    +C+      FL+  +T+
Sbjct:  712 TFRYPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGLLMKNNQNSKVLTCLAAPPLIFLLGFKTK 874          

HSP 3 Score: 56.9954 bits (136), Expect = 1.124e-7
Identity = 45/198 (22.73%), Postives = 98/198 (49.49%), Query Frame = 1
Query: 2782 LKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG------VLNLGNTVYFTWCNASTNYEVSN----ECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSN 3345
            LK++  L+  + LGP I +++++I  ++    ++ I L ++G+  Q+  YP  D+ WI + NI   PY+ ++G      +   G+ ++ T  + +    + N     C    ++ P+    +++  N+LL+N+++A  +YI +    ++  I+ +  Y  ++EY   P LP PF+   ++  +        R +   N
Sbjct: 1193 LKLVDYLSVQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKN 1390          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 291.967 bits (746), Expect = 6.569e-80
Identity = 329/1257 (26.17%), Postives = 547/1257 (43.52%), Query Frame = 1
Query:  268 QYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPY----GPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIG-------------------------------FYEYP-----------------CSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY---FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDNCRTSISS-------------------------------------KLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQTK-LNKIQIKNVKKVQEGS 3660
            Q R++I   F+  EC  F    K+    ++KC CG+ + +H+   IP      P + W         PT ++G IEF G    +     +VR+S+  + + +V L   +W +    L I+V GG  +F +  K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++  AF         HK         + ES ++ L   + +     L Q ++  + +    +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                                Y+Y                   SE    + PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +  D   +E  E  ++Y   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN  +  S                                      K   FY AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+       +     + S   C   +++ PI  + Y++I NILL+N+LIA  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct:   11 QPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQ--TIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD------IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1182          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 281.952 bits (720), Expect = 7.674e-78
Identity = 304/1168 (26.03%), Postives = 505/1168 (43.24%), Query Frame = 1
Query:  238 VHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPY----GPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIG-------------------------------FYEYP-----------------CSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY---FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN--------------------------------CRTSISSKLRRF------------------------YVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGR 3327
            ++F  N    Q R++I   F+  EC  F    K+    ++KC CG+ + +H+   IP      P + W         PT ++G IEF G    +     +VR+S+  + + +V L   +W +    L I+V GG  +F +  K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++  AF         HK         + ES ++ L   + +     L Q ++  + +    +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                                Y+Y                   SE    + PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +  D   +E  E  ++Y   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN                                   S +++ R F                        Y AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+       +     + S   C   +++ PI  + Y++I NILL+N+LIA  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K +
Sbjct:    1 MYFETNWVFHQPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQ--TIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD------IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRKAK 1110          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 284.263 bits (726), Expect = 1.710e-77
Identity = 332/1278 (25.98%), Postives = 552/1278 (43.19%), Query Frame = 1
Query:  262 KMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPY----GPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVH-YNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIG-------------------------------FYEYP-----------------CSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY---FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN--------------------------------CRTSISSKLRRF------------------------YVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQTK-LNKIQIKNVKKVQEGS 3660
            K Q R++I   F+  EC  F    K+    ++KC CG+ + +H+   IP      P + W         PT ++G IEF G    +     +VR+S+  + + +V L   +W +    L I+V GG  +F +  K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V+ RN       R V  +++S+   K     LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++  AF         HK         + ES ++ L   + +     L Q ++  + +    +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                                Y+Y                   SE    + PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +  D   +E  E  ++Y   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN                                   S +++ R F                        Y AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+       +     + S   C   +++ PI  + Y++I NILL+N+LIA  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct:   27 KHQPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQ--TIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVE-RNHELLGHNREVPCHSISSPRSKL--AVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD------IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1219          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 283.878 bits (725), Expect = 2.756e-77
Identity = 329/1276 (25.78%), Postives = 549/1276 (43.03%), Query Frame = 1
Query:  268 QYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPY----GPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIG-------------------------------FYEYP-----------------CSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY---FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN--------------------------------CRTSISSKLRRF------------------------YVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQTK-LNKIQIKNVKKVQEGS 3660
            Q R++I   F+  EC  F    K+    ++KC CG+ + +H+   IP      P + W         PT ++G IEF G    +     +VR+S+  + + +V L   +W +    L I+V GG  +F +  K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V +N  +L   +    H   S    + +   LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++  AF         HK         + ES ++ L   + +     L Q ++  + +    +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                                Y+Y                   SE    + PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +  D   +E  E  ++Y   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN                                   S +++ R F                        Y AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+       +     + S   C   +++ PI  + Y++I NILL+N+LIA  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct:   11 QPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQ--TIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCH---SISSPRSKLAVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD------IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1201          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 282.722 bits (722), Expect = 5.731e-77
Identity = 331/1276 (25.94%), Postives = 551/1276 (43.18%), Query Frame = 1
Query:  268 QYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPY----GPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVH-YNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-----EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG----LNDVKELLSKMIG-------------------------------FYEYP-----------------CSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY---FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF----NINFFSCILCIIFPFLIS----KRTEFTKDFKTCQSESFPDFNEDN--------------------------------CRTSISSKLRRF------------------------YVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNS-KLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKS---IKSGISRMEIRSKSI--FKELENIQTK-LNKIQIKNVKKVQEGS 3660
            Q R++I   F+  EC  F    K+    ++KC CG+ + +H+   IP      P + W         PT ++G IEF G    +     +VR+S+  + + +V L   +W +    L I+V GG  +F +  K K    +GL+KAA TT A I T G N G+T  +GDA+      L +  +    +  +GIAPWG V+ RN       R V  +++S+   K     LN  H +++  D+G     T+ K G     R+ LE  IS            PVV L++EGG +        V +   V +VVC+G+G+A+D++  AF         HK         + ES ++ L   + +     L Q ++  + +    +N+ LITVF I+       ++LD  IL +L K   L           QLSL LTWNRVDI + +IF       N      +  ++   ++ F++L LEN  +++ FLT   L+ELY T     N     LR +     KG    L+D+  +++K++G                                Y+Y                   SE    + PF EL +WAVL ++Q+ A   W   +E+L  +LV+ ++YK     +  D   +E  E  ++Y   FE+   KL++  +  D E A  L+  +  +W   SCL LA  +     +++   Q  +   W  G     N N F  IL +  PF I     K  E  +     + E   + N DN                                   S +++ R F                        Y AP TKF   S  ++ F+I FS+ VL  M++M     E   + Y+  +  +K  EI  S    I  +    W +N WN  D   I+  ++ +  R++     +           + IY +    +YL+IL +L  +K LGP + MM K++K ++ F  ++ + L+S+GV+ QA  YP +  +W  +  +   PY+ ++G +  G+       +     + S   C   +++ PI  + Y++I NILL+N+LIA  + I  +++  S  +W +  +++++EY  KP+LP PF    + Y +L +C +K        +K  E+ + N  KL ++K                   DL +L  + E   + F  +   I  Q +   +K+   R+E  S+ I    + ENIQT  +  I+ + ++K++E S
Sbjct:   18 QPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQ--TIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVE-RNHELLGHNREVPCHSISSPRSKL--AVLNNRHAYFLLVDNG-----TQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELLQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHL-------SPPEQLSLALTWNRVDIARSEIFVYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRFRENTMDI----------GRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGD------IDPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHFYSLLKYCVRK--------AKGLEVQRDNGLKLFLEK------------------DDLERLYDFEEECVEGFFHEQEIILNQSTDERVKNTTERVETMSQKIEDINQKENIQTATVQNIEFR-LRKMEESS 1208          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 281.952 bits (720), Expect = 6.542e-77
Identity = 286/1101 (25.98%), Postives = 509/1101 (46.23%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPR----ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ-KQGDR---VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQD---ISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLT-ANILKELYETCPKSTNFRKTFLRLIGRPFSKG-----------LNDVKELLSKMIGFY---------------------------EYPCS----ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIY-KYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFL------------ISKRTEFTKDFKTCQSESFPDFNEDNCRTSI--------------SSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFG--VLNLGNTVY-FTWCNASTNYEVSNECP----ENNFLIP-----ILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            ++I    K  EC ++       D +   C CG  K  H +  I   P     E W +   +   PT +FG I F G      K   +VRVS     +++  L+  +WK+ +  L ISV GG  +F +    K+ F +GLIK A TT A I+T G + G+   +G A+   + Y          I  +G+APWG + NR+ L   +GR   Y   +E  + +   L+ NHTH++  DDG     T+   G     R  LE  IS+   G+R   V IPVV ++++GG          +      VV EG+G+ +D+I                + S  V+ +  +  N L ++   Q+    +EL Q+ E  K I+DI++   L+TVF I   +  D+D AIL +L+K       + ++    QL L + WNRVDI + +IF+ +   ++ +    +  +++  K +F+ L LEN   +++FL     L ELY   P     RK   R+ G    +G           L+ V E +  ++G +                           + PCS      D++  P ++LFLWAV+   ++ A+  W +C + +  AL A++I  K  Q +   D++ +  +    N++E  A+ +  ECH  D + A  L+ + + +WG  +CL LA ++ D  F+++   Q  +   W    +++   +  +LC+I FP +            I ++ E T+  K      F   ++   +  +              SS+L  F  +PQ KF  +  ++  F+  F+ V++   +    +  E++  ++L  ++ ++  +++       + R    +  + WN +D++ IV  I  ++ R Q +    Y  KV++          I+  F L+++ + +  + LGPKI ++ +++ +L  F  ++ I++++YGV  Q       +  +WI    + + PY T+FG    N+ NT++  + C+ + +  +  +CP    +N  + P     ++   Y++  NILLLN+LIA  +Y  Q++  N+  IWK+  Y LI EY+ +P LP PF
Sbjct:   38 SWIKENIKKKECCFYVE-----DGREGICKCGYPKVQHCDEAI--KPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAV---RDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDG-----TQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAH--------------VASVPVSKVTMALINRLLKRFFMQEYKNFTEL-QIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVIL------CIDFII--FCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYE-PYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPF 1095          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 244.973 bits (624), Expect = 1.328e-65
Identity = 263/1042 (25.24%), Postives = 472/1042 (45.30%), Query Frame = 1
Query:  469 FGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQG----DRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKST-NFRKTFL--------------RLIGRP--------FSKGLNDVKELLSKMI-----GFYEYPCSENDSI------------KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY-FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIF---PFLISKRTEFTKDFKTCQSESFPDFNEDNCRTS-------------------------------ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLG--NTVYFTWCNASTNYE-----VSNECPE--NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
             G I+FTG   T  K   FVRV+      +I  ++  +W +    L ++++GG    ++    ++   +GL+KAA +T A I+T GL  GIT  +G A++ +S +    K++    +  +GIAPW  ++NR++L  AK        + ++      SL+ NH+H+I  D+  +        G  R  +   IS Q+ G      + IPV+ L+V G   I  +  + ++  +  ++  G+G  +DI+      M R C    +++   +   P+   +               ++    K I+ I+ +  L+TV D +   +LD  IL +L+K     C S          +L L + WNRVDI K +IFSGD+  S  +    + ++++  K  F+ LF++N  NI+ FLT   L+ELY  C  S  N   T L              R+ G P        F    ++V ++L   +     GFY+   + + ++            +HP+++LFLWA+L  +Q+ A +FW    E++  ALV  +I K     +      +E+  + KN  +E  A+ L  EC+   ++ A  L+ +K   W   + L +A+ +    F ++   Q  +   W      +     L + F   P + +   +F  + +  + E  P    D+  T                                +  +  RF+ AP T F  +   + +F+I FSYV+L   +       +  EI+   ++  ++L++  + F +  D    +    +  ++WNK DM+ I   +V +  R  ++           +   +T+ +L    F L+++ + A HK+LGPKI ++ ++IK++  F   + ++L++YGVT+QA  +P      W+     L  PY  +FG + L   +       N +T+ +         CP    N+L+ +L   Y+++ N+LLLN+LIA  SY  Q +  N+ + WK+  Y+LI+EY+ +P L  PF    +I Q L
Sbjct:   17 LGDIDFTGVSRTRGK---FVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVR----VVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPK---RPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADIL---VTLMDRGCWDADIVQELLINTFPDGLHST--------------EITSWTKLIQRILDHGHLLTVHDPEQDSELDTVILKALVKA----CKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMST----------YEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWV-FRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1010          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 243.817 bits (621), Expect = 3.081e-65
Identity = 264/1047 (25.21%), Postives = 471/1047 (44.99%), Query Frame = 1
Query:  469 FGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQG----DRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKST-NFRKTFL--------------RLIGRP--------FSKGLNDVKELLSKMI-----GFYEYPCSE-----------------NDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY-FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIF---PFLISKRTEFTKDFKTCQSESFPDFNEDNCRTS-------------------------------ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLG--NTVYFTWCNASTNYE-----VSNECPE--NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
             G I+FTG   T  K   FVRV+      +I  ++  +W +    L ++++GG    ++    ++   +GL+KAA +T A I+T GL  GIT  +G A++ +S +    K++    +  +GIAPW  ++NR++L  AK        + ++      SL+ NH+H+I  D+  +        G  R  +   IS Q+ G      + IPV+ L+V G   I  +  + ++  +  ++  G+G  +DI+      M R C    +++   +   P+   +               ++    K I+ I+ +  L+TV D +   +LD  IL +L+K     C S          +L L + WNRVDI K +IFSGD+  S  +    + ++++  K  F+ LF++N  NI+ FLT   L+ELY  C  S  N   T L              R+ G P        F    ++V ++L   +     GFY+   +E                 +   +HP+++LFLWA+L  +Q+ A +FW    E++  ALV  +I K     +      +E+  + KN  +E  A+ L  EC+   ++ A  L+ +K   W   + L +A+ +    F ++   Q  +   W      +     L + F   P + +   +F  + +  + E  P    D+  T                                +  +  RF+ AP T F  +   + +F+I FSYV+L   +       +  EI+   ++  ++L++  + F +  D    +    +  ++WNK DM+ I   +V +  R  ++           +   +T+ +L    F L+++ + A HK+LGPKI ++ ++IK++  F   + ++L++YGVT+QA  +P      W+     L  PY  +FG + L   +       N +T+ +         CP    N+L+ +L   Y+++ N+LLLN+LIA  SY  Q +  N+ + WK+  Y+LI+EY+ +P L  PF    +I Q L
Sbjct:   17 LGDIDFTGVSRTRGK---FVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVR----VVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPK---RPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADIL---VTLMDRGCWDADIVQELLINTFPDGLHST--------------EITSWTKLIQRILDHGHLLTVHDPEQDSELDTVILKALVKA----CKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMST----------YEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWV-FRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1015          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 243.817 bits (621), Expect = 3.442e-65
Identity = 264/1047 (25.21%), Postives = 471/1047 (44.99%), Query Frame = 1
Query:  469 FGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQG----DRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKST-NFRKTFL--------------RLIGRP--------FSKGLNDVKELLSKMI-----GFYEYPCSE-----------------NDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNY-FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIF---PFLISKRTEFTKDFKTCQSESFPDFNEDNCRTS-------------------------------ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLG--NTVYFTWCNASTNYE-----VSNECPE--NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
             G I+FTG   T  K   FVRV+      +I  ++  +W +    L ++++GG    ++    ++   +GL+KAA +T A I+T GL  GIT  +G A++ +S +    K++    +  +GIAPW  ++NR++L  AK        + ++      SL+ NH+H+I  D+  +        G  R  +   IS Q+ G      + IPV+ L+V G   I  +  + ++  +  ++  G+G  +DI+      M R C    +++   +   P+   +               ++    K I+ I+ +  L+TV D +   +LD  IL +L+K     C S          +L L + WNRVDI K +IFSGD+  S  +    + ++++  K  F+ LF++N  NI+ FLT   L+ELY  C  S  N   T L              R+ G P        F    ++V ++L   +     GFY+   +E                 +   +HP+++LFLWA+L  +Q+ A +FW    E++  ALV  +I K     +      +E+  + KN  +E  A+ L  EC+   ++ A  L+ +K   W   + L +A+ +    F ++   Q  +   W      +     L + F   P + +   +F  + +  + E  P    D+  T                                +  +  RF+ AP T F  +   + +F+I FSYV+L   +       +  EI+   ++  ++L++  + F +  D    +    +  ++WNK DM+ I   +V +  R  ++           +   +T+ +L    F L+++ + A HK+LGPKI ++ ++IK++  F   + ++L++YGVT+QA  +P      W+     L  PY  +FG + L   +       N +T+ +         CP    N+L+ +L   Y+++ N+LLLN+LIA  SY  Q +  N+ + WK+  Y+LI+EY+ +P L  PF    +I Q L
Sbjct:   66 LGDIDFTGVSRTRGK---FVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVR----VVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPK---RPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADIL---VTLMDRGCWDADIVQELLINTFPDGLHST--------------EITSWTKLIQRILDHGHLLTVHDPEQDSELDTVILKALVKA----CKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAERMGKGRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAMST----------YEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWV-FRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQAL 1064          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 242.662 bits (618), Expect = 9.338e-65
Identity = 277/1121 (24.71%), Postives = 504/1121 (44.96%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKE----NKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGR-TVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG--YFRQALENKIS-QKQGD-RVGIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIG--------RPFSKGLNDVKELLSKMIGFYEYP----------------------------CSENDSI-KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF--NINFFSCILCIIFP------FLISKRTEFTKDFKTCQS-----------ESFPDFNE------------DNCRTS---------------ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWS----KTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYY-----PQRDFSWIALSNILDYPYYTMFGVLNLG--NTVYFTWCNASTNYEVSNECPE------NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYI 3291
            ++I   FK   C  F   +++      +C CG ++  H+     +         W         PT ++G +EF G      + + F+R+S       + DL+   WK+    L +SV+GG     +    +++  QGL+KAA +T A IIT GL +GI+  +G+A++ + + +   +  N  +  +GIAPWG V+NR  L   +G     Y V N        SL+ NH  ++  DDG     + +K G   FR  LE+ IS Q+ G+  + IPV+ +++ G   +  F+E S  +K     +V  G+G  ++++ +    +Q           D   ++    +  L  K+ +   +E +  D+ +  +  I +N+ +I++++ K    ED +  +L  L++        N N  + +L L +TWNRVDI K ++F+G+I    +E    + D++   K +F+ L +++  NI  +LT   L++LY +   +   +   L  +         + +S  L +V +LL+ ++G   +P                            C   D + KHP+  LF+WAVL  + + A F W  CDES+  AL   ++     +  + +T+   +++     FE +A  +   C+      +  L+ +K++ WG  +CLE+A  +    F S+   Q  +   W          +  +L II P      F+  ++T+  +  K+  +           E+   FN+            +N R +               + S+ ++F+ AP T F  +   +  F+  ++YV+L   K        + E +   ++  ++  +  E F +  ++ + +  + +  + WNK             VL   L I G+      MF WS    + I  +    F L+++ + A HK+LGPKI ++ K+IK    F   +L++L++YGV +QA  Y     P R F       +L  PY  +FG + +   +T      + + N  + NE  E      +N+L+ IL   ++++ NILL+N+LIAT SY    +  +S   WK+  Y+LI+EY+ +P L  PF  F +I
Sbjct:   21 SWIPKFFKKRLCTTF---VEDSFSYGGRCQCGAMRDDHRSMALGDNFSTAVVSQWLSSQHTSEQPTDAYGDLEFDG---IGRRHSYFLRLSSTTDPARVFDLMKEHWKLQQPNLVVSVVGGEGRSVVKSWVRDVLRQGLVKAAQSTGAWIITGGLRQGISRCVGEAVKDNAAAV-SSITLNKVLP-IGIAPWGLVENRQQLVNLEGSFPARYMVRNI--SPDSCSLDNNHKAFLLVDDG----TSGRKGGELAFRACLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMS--LKNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEEEDASPIM--ELREQLAAKVKKYFPAE-NDTDKLVDKVLSIYQNKDIISIYNAKQEGAEDFEIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGNIDWKYEELVDSMTDALENNKPQFVRLLIDSGLNILSYLTYGRLEKLYNSISDTCLAKTLLLHHLDERMHESNVQIYSISLYEVSQLLTDLLGEVCHPFYWTELKLEASSTRRKSMKKACRILMGSCKYRDEMCKHPWFCLFIWAVLQNRSEMAIFCWEMCDESVLTALAGCKLLLELSKQEI-ETEAKLSMKELALKFERMAHDVFGTCYLSKASHSYKLLIRKSKLWGDATCLEMAIAADAQIFFSHDGVQSLLSQIWWGDIERGTPLWRILLVIICPPVCYSNFIEYRKTDQAEKEKSVMAPPCSEIDRQYEETVFSFNDNKHQNEAEHKDSENIRRTAKGAPAFIKPKKSSFVVSRWKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDGPAVSEYVLYFWVFTLVCQEIQEAFIA-GNKKFPQTLFLYAQDVWNK-----------FDVLAISLFITGLCCR---MFSWSFNMGRGILCVDYMVFTLRLIYIFAIHKELGPKIIILGKMIKHAFFFLFFLLVWLIAYGVANQALLYQYDPSPARVF-----RRVLYRPYLHIFGDIPVEEIDTGKHWERDCTDNLTLINEGIEPCRDTSHNWLVVILLVIFLLVTNILLINLLIATFSYTFTKVQEHSDKYWKFQRYNLIVEYHSRPTLAPPFIIFSHI 1101          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 328.946 bits (842), Expect = 7.633e-92
Identity = 305/1060 (28.77%), Postives = 513/1060 (48.40%), Query Frame = 1
Query:  421 ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYN-VSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYET--CPKST------NFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPC--------------------------------------------SENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFP---FLISKRTEFTKDFKT---------------CQSESFPDFNEDNC-----RTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
            E WS     ++ PT +FG +EF G   +N  +  ++RVSY  K D ++ L+  +W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    I  +GIAPWG V+N+  L   K  T  Y  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R +  V +VVC+G+G+ASDI+  A          HK     G+  + ES ++ L   + +      +Q  + +  + + +K + LITVF + S   +D++ AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN  ++Q FLT   L+ELY T   P +T      + +K     +   +   L D+  +L  ++G   Y C                                             E    K+PF EL +WAVL+++QK A F W + +E++  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+FP     +  R++    F T                ++ +    +E+N         I +K+  FY AP  KF  ++ +++++++ F+YV+L  M+R   ++ E + + Y+V + L+K  EI  S   ++  ++K W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P   F ++Y +L
Sbjct:   18 EKWSISKHTQLSPTDAFGILEFQGGGHSNKAM--YIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGRICAIGIAPWGIVENKEDL-IGKDVTKPYQTMSNPLSKLS--VLNSSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFA----------HKYSEEGGI--ISESLRDQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTN-------ASAPDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIVRDVKKVGFGNLPPDYHVSLIDIGLVLEYLMGG-AYRCHYTRKTFRTLYNNLFGPKRDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESSESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEEGKEKEDENMVRNTTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYG------EVFADQIDPPCGENLYDEDGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIIFSHLYIIL 1024          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: TRPM6 (transient receptor potential cation channel, subfamily M, member 6 [Source:NCBI gene;Acc:100487366])

HSP 1 Score: 316.235 bits (809), Expect = 1.337e-87
Identity = 302/1107 (27.28%), Postives = 503/1107 (45.44%), Query Frame = 1
Query:  358 KCSCGEIKKSHK--ENKIPYGPR------ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVK--EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNF------------------------------------------RKTFLRLIGRPF-----SKGLNDVKELLSKMIGFYEYPC-------SENDSIK--HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-------PDFNEDNCR--------TSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMF--------RW--------SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL-AFCYQKGR 3327
            KC CG +   H   +   P  P       E WS  +  +  PT +FG I F   D T      ++R+SY   L+ ++ L+  +W++    L ISV GG  +FK+  K K +F +GL+KAA TT A I+T G+N G +  +GDA++   S      +H   I  +GI PWG ++N+  L       ++  + N + K    SLN  H+H+I  DDG     T  K G     R+ LE+ IS QK   R+  G+PVV L++EGG ++ +     V+    V +VVCEGTG+A+DI+  AF   +        ++ + + M+ ++F N+  R           Q +  +  + + ++    IT+FD +S E  D+D AIL +L+K  ++           QLSL LTWNRVDI K  I               ++D+++  +V F++L +E   N+  FLT   L+ELY T    TN                                           RK+F  L    F     S  L   +  L         PC        +N+ +   +P+ +L +WAVLM++QK A FFW   +E++  A++A ++Y+     + + T   D SE L+ +   F  LA+ ++E    +++++A  L+  + +NW   +CL+LA  ST   F+S+   Q  +   W     +   ++   IL I+ P  +       + E +   ++ +   F       P   ED  +          I+ K+  FY AP  KF  H+  +++F++ F+Y VL  M   Q ++ E   +IY+    ++K  E+F S   +   ++K W    +WN                          TD + +F        RW         + IY L +  +Y+++L   A +++ GP I M+ K+   +     I+ I LL++GV+ +A   P    SW    +I+  PY+ MFG       VY    +A    E   +CP  +F+ P L A Y+ +  I+++N+LI+  + + + ++  S  +WKY+ Y  I+ Y +KP LP P     +IY ++   C+ +  
Sbjct:   35 KCCCGRLIGDHPGLDYGWPINPSPQEREDEEWSILNHTKPSPTDAFGTINFQDGDHTYH--AKYIRISYDTTLELLMHLMIKEWQMELPKLVISVHGGIQNFKLPSKIKQVFGKGLVKAAETTGAWILTEGINTGASKHVGDALKAHAS------QHLRKICAVGIPPWGAIENQQDLIGKDVVCLYQTLINPMSKL--TSLNSMHSHFIMVDDG-----TVGKYGNEMKLRRNLEDFISLQKIHTRMGQGVPVVGLVIEGGPNVILMVWEYVRSTPPVPVVVCEGTGRAADIL--AFTH-KHTTDTDPQLKEEILEMIQKTF-NLGHR-----------QSNHVLYILMECMERRASITIFDAESEEQQDIDLAILTALLKGTNM-------SAQDQLSLALTWNRVDIAKKHILIYGQHWKVGSLEQAMQDALVMDRVDFVKLLIEYGVNMHRFLTIGHLEELYNTKQGPTNLLLHHLVRDVKQSNPSPDYRISLIDVGLVIEYLIGGAYRSSYTRKSFRVLYNSLFRKHKMSSKLESPESTLHSQFFRTAQPCRHEVTCTEDNEPVGFIYPYNDLLVWAVLMKRQKMAMFFWQHGEEAMVKAVIACKLYRAMAHEAKQSTMVDDTSEELKKYSKEFGQLALDILENAFKMNEQMAMKLLTYQLKNWSNSTCLKLAVSSTLRPFVSHTCTQMLLTDMWMGRLKMRKHSWLKVILGILLPPFVLMLEFKTKAEMSHVPQSLEFHQFSRLYVDPPSLREDQNQKISNGLGILPITRKICEFYSAPIVKFWFHTMVYLAFLMLFTYTVLVKMDP-QPSVQEWCVIIYIFTTAVEKVREVFVSEPGKFSQKVKVWIN-EYWN-------------------------LTDSIAIFLFFIGFGLRWPDPPFQTAGRIIYCLDIIFWYVRLLDFFAVNQQAGPYITMLGKMTSNMFGIVIIMAIVLLAFGVSRKAILSPDHPPSWTLARDIVFQPYWMMFG------EVYAGEIDAC---EEDPDCPPGSFITPFLQAVYLFVQYIIMVNLLISLFNNVYRVLNSVSHKLWKYNRYRYIMTYYEKPWLPPPLIFLSHIYILINRLCHHRSH 1068          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 306.605 bits (784), Expect = 1.034e-84
Identity = 292/992 (29.44%), Postives = 483/992 (48.69%), Query Frame = 1
Query:  571 IFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYN-VSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNF------------------------RKTFLRLIGRPFSKGLNDVKELLSKMIGFY--EYPC-------------------SENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDT---DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFP---FLISKRTEFTKDFKTCQ-----SESFPDFNEDNCR----TSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE-------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
            +  +W++    L ISV GG  +F+M  K K +F +GLIKAA+TT A I T G++ G+   +GDA++   S      K    I  +GIAPWG V+N+  L   K  T  Y  +SN + K     LN +HTH+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R +  V +VVC+G+G+ASDI+  A          HK     G+  + ES ++ L   + +      +Q  + +  + + +K + LITVF + S   +D++ AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN  ++Q FLT   L+ELY T     ++                        RKTF  L    F  G    K L  K++G    E P                     E    K+PF EL +WAVL+++QK A F W + +E++  ALVA ++YK     S       D S+ L+     F  LA++L+++ +  D++VA  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +        I+ I+FP     +  R++    F T +     + S     E+  R      I +K+  FY AP  KF  ++ +++++++ F+YV+L  M+R   ++ E + + Y+V + L+K  EI  S   ++  ++K W    +WN  D++ I   ++  +LR Q   N  Y        + + IY + +  +Y+++L +   +K LGP + M+ K++ ++L F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +      + +E       C    +L P L A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++D+P+LP P   F ++Y +L
Sbjct:    1 MVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSS------KSRGRICAIGIAPWGIVENKEDL-IGKDVTKPYQTMSNPLSKLS--VLNSSHTHFILADNG-----TLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFA----------HKYSEEGGI--ISESLRDQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTN-------ASAPDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLF--GPKRPKAL--KLLGMEDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESSESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEEDTTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRLQ---NQPY------MGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYG------EVFADQIDPPCGENLYDEDGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIIFSHLYIIL 938          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: ENSXETT00000055613.1 (transient receptor potential cation channel subfamily M member 7-like [Source:NCBI gene;Acc:100497855])

HSP 1 Score: 305.064 bits (780), Expect = 5.133e-84
Identity = 293/1131 (25.91%), Postives = 525/1131 (46.42%), Query Frame = 1
Query:  358 KCSCGEIKKSHKENKIPYGPR--------ESWSEGDCMEMLPTYSFGKIEFT-GEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQ-GDRVG--IPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFK----NVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI--------------------------------GRPFSKGLNDVKELLSKMIGFY--EYPCSENDSIK----------HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK-YHQRTSLRDT--DRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN---FFSCILCIIFPFLI-----------SKRTEFTKDFK---------TCQSESFPDFNEDN--CRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNK 3465
            +C CG + K H       GP         E W+         T +FG I+F  G     +K   F+R+S   K++DI+ L+  +W +    L ISV GG   F++H + K  F +G +KAA++T A I T G N G+ + IGDAI+   +    ++ HN  IS +G+APWG ++ R  L        +  + + + K     LN  H+H++  DDG     T  + G     R+ LENK S +Q   + G  +P++ LI+EGG    +     +++   V +VVCEGTG+A+D++             HK   S G  +LP+  +    +++K+         LH     + C++     + LITV  I    H+++D  +L +L+K  ++           +L L L W+RVDI K+ IF              + D++I  +V+F++L +EN  ++Q FLT   L ELY     +++   T L+LI                                 R   K    + + LS+  G +      S ND+++          +PF +L +WAVL ++QK A FFW   +ES+  ALVAT++Y+  +Q     D   D SE L+ +   F  LAV+L+++    +  +A  L+  + +NW   +CL+LA  S    F+S+   Q  +   W    N+    ++  I  I FP +I           S   +   D+K         TC  E     + +    R  I+ +   FY AP  KF + +  +++F++ +++VVL  M+ +  ++ E + ++ ++   ++K  EIF S + ++  +++ W++ ++ N  D I I+  +V   LR+         D ++       IY L    +++++L +L+ +++ GP + M+ K++  +     I++I L++YG+  +A  YP  D SW    ++L +PY+ ++     G    +       +  V + C    ++ P L A Y+++  ++++N++IA  +++       S +IWK   Y  I+ ++ KP+LP P     Y+  + +  + + +       K +   +   KLH      F+   + I+   K D + NK
Sbjct:   38 RCCCGRLIKQHAYYASGAGPSGAAHVQESEHWTVDRHTVKSSTDAFGTIDFQCGSHGYKAK---FIRLSDDSKVEDILQLMIKEWHMKRPNLVISVHGGMQKFELHPRFKEAFGKGFVKAAVSTGAWIFTGGTNNGVAAHIGDAIKEYAT----RLTHN--ISIIGVAPWGIIEGRQDLIGNNVMAPYQTLLSPLSKLH--VLNNLHSHFLLVDDG-----TAGRTGGEINLRRELENKTSLQQFNAKTGRHVPMMALILEGGPKTILTVLEYLQQSPPVPVVVCEGTGRAADLLAYV----------HKHTESSG--LLPDGMESNVISIIKKTFTLNKNEALHLFQTLMCCMQ----MKELITVLHIGPDIHQEIDVDLLKALLKGNNI-------SPIDRLHLALAWDRVDIAKNHIFVRGQQWLVKPLEQVMMDALIMDRVEFVKLLIENGVSMQKFLTIPRLDELYNVVDTNSD---TLLQLILEIKKGNVPGKYKITMMDVGLVIEYLMGGVFRSRYTKKNFKAMYKALSQTSGTHGDSQKSSRNDALEADNQITRPFPYPFNDLLVWAVLTKRQKMALFFWQHGEESMAKALVATKLYRGMYQEAQQSDIIDDSSEKLKKYSKEFGELAVELLDQSFKQNDLMAMKLLTYELKNWSKSTCLKLAVSSRLRTFVSHTCTQMLLNDMWMGRLNMRKNAWYKVISGIFFPPIIPLFDYKTMAQMSHIPQSQDDYKMNLDDKEEITCSVEGIALVSNEGKPKRVPIARRFYAFYHAPIVKFWLSTLVYMAFLMLYAFVVLVKMESLP-SVQEWIVILSILTTGVEKIREIFMSEAGKLTQKLRVWFS-SYLNINDAIAIITFLVGFGLRFG------GRDFIL-------IYCLNTIFWFIRLLDILSVNQEAGPYVLMVGKMVMSMFYVVVIMVIVLITYGIPRKAILYPHEDPSWTLAKDVLFHPYFMIY-----GEVFAYEIDVCGNDSAVPHLCGTGTWITPFLEATYLLVNYVIMVNLIIAVFNHVYLQYKSMSNIIWKCQRYKFIMAFHSKPVLPPPLIILSYVTSLFSCVFLRKQKNKTHGPKLYLTEEEQKKLH-----EFEEHCVGIYLIYKEDKNKNK 1101          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 299.671 bits (766), Expect = 3.890e-82
Identity = 311/1131 (27.50%), Postives = 517/1131 (45.71%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHK---------ENKIPYG------PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANI-----------------LKELYETCPKSTNFRKTFLRLIG--RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKH---PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI---------------------SKRTEFTKDFKTCQSESFPDF---------NEDNCRT------------SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQVLAFCYQK 3321
            +++I   F   EC +   + K+      +C CG +   H          +N+   G        E WS G   ++ PT +FG IEF G   +N  +  +VR+S+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GD+++   S      K    I  +GIAPWG V+N+  L        +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN  ++      N+                 +   Y        FR  +  L G  RP +  L  +++ +    G       E +         I H   PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                      +  E  +  KT + +   D          N D+ R              I  K+  FY AP  KF   +  ++ +++ F+Y+VL  M R   ++ E + + Y+  + ++K  EI  S   ++  + K W    +WN  D++ I+   + MVLR Q      Y          + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +    Y V+ E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS F  I + L   ++K
Sbjct:   62 KSWIERAFHKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLKDHAS------KSRGKICTIGIAPWGIVENQEDLVGKDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHPTSPLNVKYNLISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGILLPPSILSLEFKNKDEMPYMSQANEMDLQEKEVEEPDKTVKEKEEDDMELTAMLARGNGDSSRKKDEDEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP-SMQEWIVISYIFTLGIEKMREILMSEPGKLLQKFKVWLQ-EYWNLADLVSILLFSIGMVLRLQEQPFSSY---------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYG------EVFADQIDPPCGYNVTGEDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHFTMICKHLCCRWRK 1137          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 301.597 bits (771), Expect = 7.731e-83
Identity = 318/1154 (27.56%), Postives = 525/1154 (45.49%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH--------------KENKIPYG--PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAA-----FLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN---------------------------------------------FRKTFLRLIGR-----PFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI--------------------------------------SKRTEFTKDFKTCQSESFPDFNEDNCRT-----SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW-SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQ 3297
            +++I   F   EC +   + K+      +C CG +   H               E+++       E WS     ++ PT +FG IEF G   +N  +  +VRVS+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L    GR V   +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF     +   +W        + D+++  +V F++L +EN  ++  FLT + L+ELY T    +N                                             FR  +  L G      P  +G    K+   ++    + P  E +    PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                                       +  E T        ES    +E+  ++      +  K+  FY AP  KF  ++  +I +++ F+Y+VL  M+R   T  E + + Y+  + ++K  EI  S   ++  ++K W    +WN  D+I I+   V M+LR Q        D+   FR   + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +       + E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS    I+Q
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDL---IGRDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDP--EINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILRLQ--------DQP--FRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYG------EVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQ 1149          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 300.442 bits (768), Expect = 1.416e-82
Identity = 318/1154 (27.56%), Postives = 525/1154 (45.49%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH--------------KENKIPYG--PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAA-----FLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN---------------------------------------------FRKTFLRLIGR-----PFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI--------------------------------------SKRTEFTKDFKTCQSESFPDFNEDNCRT-----SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW-SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQ 3297
            +++I   F   EC +   + K+      +C CG +   H               E+++       E WS     ++ PT +FG IEF G   +N  +  +VRVS+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L    GR V   +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF     +   +W        + D+++  +V F++L +EN  ++  FLT + L+ELY T    +N                                             FR  +  L G      P  +G    K+   ++    + P  E +    PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                                       +  E T        ES    +E+  ++      +  K+  FY AP  KF  ++  +I +++ F+Y+VL  M+R   T  E + + Y+  + ++K  EI  S   ++  ++K W    +WN  D+I I+   V M+LR Q        D+   FR   + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +       + E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS    I+Q
Sbjct:   64 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDL---IGRDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDP--EINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILRLQ--------DQP--FRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYG------EVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQ 1151          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 290.426 bits (742), Expect = 2.769e-79
Identity = 314/1146 (27.40%), Postives = 524/1146 (45.72%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH--------------KENKIPYG--PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAA-----FLKDSIITGKVKFIELFLENVSN---------IQDFLTAN--------------ILKELYETCPKSTNFRKTF---------------LRLIGR----PFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI--------------------------------------SKRTEFTKDFKTCQSESFPDFNEDNCRT-----SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW-SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQ 3297
            +++I   F   EC +   + K+      +C CG +   H               E+++       E WS     ++ PT +FG IEF G   +N  +  +VRVS+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L    GR V   +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF     +   +W        + D+++  +V F++L +EN  +         ++D    N              +++ L     +    RK F               L+L+G     P  +G    K+   ++    + P  E +    PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                                       +  E T        ES    +E+  ++      +  K+  FY AP  KF  ++  +I +++ F+Y+VL  M+R   T  E + + Y+  + ++K  EI  S   ++  ++K W    +WN  D+I I+   V M+LR Q        D+   FR   + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +       + E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS    I+Q
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDL---IGRDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDP--EINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILRLQ--------DQP--FRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYG------EVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQ 1141          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 288.886 bits (738), Expect = 7.378e-79
Identity = 350/1324 (26.44%), Postives = 583/1324 (44.03%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH--------------KENKIPYG--PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV---HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLEN----VSNIQDFLTANILKELYE---------TCPKS--------------------------TNFRKTFLRLIGR-----PFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI--------------------------------------SKRTEFTKDFKTCQSESFPDFNEDNCRT-----SISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRW-SKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNE---------CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMP---FSTFVYIYQVLAFCYQKG------RCYNLSNSKKFEITKHNSKLH------IDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKI----QIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEV 3792
            +++I   F   EC +   + K+      +C CG +   H               E+++       E WS     ++ PT +FG IEF G   +N  +  +VRVS+  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L    GR V   +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G  ++ ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF              + D+++  +V F++L +EN     SN    L  ++ K  Y            P                              FR  +  L G      P  +G    K+   ++    + P  E +    PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W     +   +    IL I+ P  I                                       +  E T        ES    +E+  ++      +  K+  FY AP  KF  ++  +I +++ F+Y+VL  M+R   T  E + + Y+  + ++K  EI  S   ++  ++K W    +WN  D+I I+   V M+LR Q        D+   FR   + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA  +P  + SW    NI   PY+ ++G       V+    +       + E         C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   FS    I+Q +   ++K       R Y L   K F       K+H      I++    K D      N  +D  +    +  EN S +    N   E++ S+K+ +  ++IR   +   +  + T L ++    + ++ K     S   T+  Y  I +Q          S   N   LQ+ ++  G+E 
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDL---IGRDVVRPYQTMSNPMSKL--TVLNSMHSHFILADNG-----TTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGG--LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDP--EINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILRLQ--------DQP--FRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYG------EVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHVCCRWRKHESDQDERDYGL---KLFITDDELKKVHDFEEQCIEEYFREKDDRF----NSSNDERIRVTSERVENMSMRLEEVN---EREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAY--IVRQSS------FNSQEGNTFKLQESIDPAGEET 1306          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:MGI Symbol;Acc:MGI:1351901])

HSP 1 Score: 248.825 bits (634), Expect = 2.090e-66
Identity = 276/1074 (25.70%), Postives = 489/1074 (45.53%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKI-PYGPR-ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISEL----------HQVDEAIKCIEDIIKNELLITVF--DIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGR----PFSKG-----LNDVKELLSKMIG-----FYEYPCSEND-----SIKH--------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVL--MILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGY-YPQRDFSWIALSNILDYPYYTMFGVLNL---GNTVYFTWCNASTNYEVSNECPENN----------FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDK 3252
            ++I    K  EC YF  + K  D     C+CG   + H E  I P+  + + W     ++ +PT +FG I FT  D++  K+  +VRVS       I  L+   W +    L ISV GG  +F M  + K+IF +GL+K A TT A IIT G + G+   +G+A++     L    K    I+ +G+A WG + NR  L    G      + +E  +     L+ NH+H+I  DDG   Q   +     R  LE  IS++  +R G    IP+V +++EGG          +      V+ EG+G+ +D+I +                   VA LP S   +    LI+Q +S            +Q+ E  K I+DI++   L+T+F       +D+D AIL +L+K               QL L + WNRVDI + +IF+ +      +    +  ++I+ K +F+ LFLEN   +++F+T + L  LYE    S  F     +++       ++       ++ V ++L +++G      Y  P   +      ++ H                          P ++L +WAV+   ++ A   W +  +    AL  ++I K   +         E L    + FE+ A+ +  EC+  D+E A  L+ + +E WG  +CL+LA ++ D+KF+S+   Q  +   W     ++   +  ILC++ FP L +    F +  K  Q+          CR    +++R F+ AP   F ++  ++ +F+  F+YV+   M   Q +     ++IYL L  ++ ++  ++F         ++   +  + WNK+D+  I+  IV +  R  L    +Y  ++++        SL    F L+++ +    K LGPKI ++ +++K++  F  ++ ++++S+GV  QA   + +    WI    ++ + Y T+FG +     G       C+ +       +CPE++          +L   L   Y++  NILLLN+LIA  +Y  Q++  ++  IWK+  + LI EY+ +
Sbjct:   60 SWIPENIKKKECVYFVESSKLSDAGKVVCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQEMPTDAFGDIVFT--DLSQ-KVGKYVRVSQDTPSSVIYQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVR--DFSLSSSCKEGEVIT-IGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP--LRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQ-------------------VATLPVSEITI---SLIQQKLSIFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSMTVPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLAL-ADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFISFRE--KRLQAL---------CR---PARVRAFFNAPVVIFHMNILSYFAFLCLFAYVL---MVDFQPSPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVGLTCR--LIPATLYPGRIIL--------SLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWI-FRGVVYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGR 1074          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 4.939e-76
Identity = 286/1101 (25.98%), Postives = 509/1101 (46.23%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPR----ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ-KQGDR---VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQD---ISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLT-ANILKELYETCPKSTNFRKTFLRLIGRPFSKG-----------LNDVKELLSKMIGFY---------------------------EYPCS----ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIY-KYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFL------------ISKRTEFTKDFKTCQSESFPDFNEDNCRTSI--------------SSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFG--VLNLGNTVY-FTWCNASTNYEVSNECP----ENNFLIP-----ILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            ++I    K  EC ++       D +   C CG  K  H +  I   P     E W +   +   PT +FG I F G      K   +VRVS     +++  L+  +WK+ +  L ISV GG  +F +    K+ F +GLIK A TT A I+T G + G+   +G A+   + Y          I  +G+APWG + NR+ L   +GR   Y   +E  + +   L+ NHTH++  DDG     T+   G     R  LE  IS+   G+R   V IPVV ++++GG          +      VV EG+G+ +D+I                + S  V+ +  +  N L ++   Q+    +EL Q+ E  K I+DI++   L+TVF I   +  D+D AIL +L+K       + ++    QL L + WNRVDI + +IF+ +   ++ +    +  +++  K +F+ L LEN   +++FL     L ELY   P     RK   R+ G    +G           L+ V E +  ++G +                           + PCS      D++  P ++LFLWAV+   ++ A+  W +C + +  AL A++I  K  Q +   D++ +  +    N++E  A+ +  ECH  D + A  L+ + + +WG  +CL LA ++ D  F+++   Q  +   W    +++   +  +LC+I FP +            I ++ E T+  K      F   ++   +  +              SS+L  F  +PQ KF  +  ++  F+  F+ V++   +    +  E++  ++L  ++ ++  +++       + R    +  + WN +D++ IV  I  ++ R Q +    Y  KV++          I+  F L+++ + +  + LGPKI ++ +++ +L  F  ++ I++++YGV  Q       +  +WI    + + PY T+FG    N+ NT++  + C+ + +  +  +CP    +N  + P     ++   Y++  NILLLN+LIA  +Y  Q++  N+  IWK+  Y LI EY+ +P LP PF
Sbjct:   38 SWIKENIKKKECCFYVE-----DGREGICKCGYPKVQHCDEAI--KPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAV---RDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDG-----TQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAH--------------VASVPVSKVTMALINRLLKRFFMQEYKNFTEL-QIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVIL------CIDFII--FCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYE-PYITIFGNFPTNIDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMMLCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPF 1095          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.154e-71
Identity = 196/754 (25.99%), Postives = 365/754 (48.41%), Query Frame = 1
Query:  232 SNVH---FAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGP-RESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKI------SQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRS-DG--VAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSK--GLNDVKELLSKMIG--FYEYPCSEN-------------------------------DSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRA--GFNINFFSCILCIIFPFLISKRTEFTKD 2316
            S+VH   F  N      +++I   F   EC  F     ++    S+C CG  ++ H +  +  G   E W+   C    PT ++G+I+F G      K   ++R+S+    + ++ L+  +W +    L ISV GG   F +  + + +F +GLIKAA TT A IIT G N G+   +G+A++  Q       +    ++ +GIA WG V K  +++    G+            HQ   L+ NH+H+   DDG     T+ K G     R  +E  I      S+ +   +G+PVVLL++EGG +        +K+KV  VV +G+G+A+ ++G A+         H + R+ DG  + ++   +++ ++ K++E  +      D+    I+D++++E +I+V+ +     +D+D AIL +L+K       +N++   +QL+L L WNR+D+ K  IF+ +   + +  +A +  +++  K +F ELFL+N  ++++FL+ +IL +LY   P +T  +    + +G+   K   ++ V E++ +++G  F  Y   +                                D +  P+ ++FLWAVL  +++ A+  W    E +  AL+A+R+ K     +  D   TD S  L      FE  AV +++EC + ++ ++  L+ ++ +++  ++ LELA  +    F+++  CQ  +   W      N  ++  ++C+  P LI     F  D
Sbjct:   16 SHVHLNKFGSNQLSQSKKSWIARNFSRRECIRFVPKSHDV----SRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEG--YGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQ----VNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDG-----TEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAY--------NHTIKRNVDGQTINVIDPQYEDEVRAKVVE--VFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLK-------ANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPD 737          

HSP 2 Score: 87.4261 bits (215), Expect = 7.269e-16
Identity = 112/516 (21.71%), Postives = 242/516 (46.90%), Query Frame = 1
Query: 2344 PDFNED--------NCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLT-----IH--EIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQ-----RDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKIQIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVNIVSTENSPVVIT 3831
            P+  ED        N +     ++  FY AP +KF  +   +++FI  ++YVVL+   R         IH  EI+   ++  +++++  ++       I  ++  +++ + WN VD+  +   I+A++LR+       +T+  + F  S+ I SL +  F ++ L++ + ++ LGPK+ M+ K++++L  F  I+ +F ++YG+   A  +P      R+ +W+ +++++ YPY+ M+G L      +          E     P+  +L P+L A Y++  NILLLN+LIA  +Y  + +  +S  +WK+  Y L+ EY+ +P+   P     +I   + + ++  RC +       +I    +++                             +  +N+  +F    + I +Q+   SG   +E R +++   ++ I ++LN++ + ++   +  + T+ NG       + +  +A +   L++N   LQ  +  + Q+  +      P+ +T
Sbjct:  807 PEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFS-DTWNFVDIFSLTVFIIAIILRF-------FTNSRI-FTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGEL------FLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMCRCGHPPRGSTMKIGLSPAEM-----------------------------EQMDNW--EFQAAEMYIHQQQQKNSGT--LEERVRALGDRVDCINSQLNRV-LDSMSGTRAHALTDGNGLEGGHDSEGR--LARMEVELSSNSESLQKILALLQQQPPVKGQAAVPIQLT 1271          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Match: sp|E9PTA2|TRPM2_RAT (Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3)

HSP 1 Score: 252.292 bits (643), Expect = 1.287e-66
Identity = 286/1127 (25.38%), Postives = 503/1127 (44.63%), Query Frame = 1
Query:  160 TSQNEDYTVTIRQA---------RCKINESCRESNVHFAENDEKMQ-YRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKI-PYG-PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQGDRVG----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISEL----------HQVDEAIKCIEDIIKNELLITVF--DIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSK----------GLNDVKELLSKMIG-----FYEYPCSEN-------------------------DSIKH------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVL--MILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGY-YPQRDFSWIALSNILDYPYYTMFGVLNL---GNTVYFTWCNASTNYEVSNECPENN----------FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDK 3252
            + Q E + V  R+A         R   +  C+   +  + + EK +   ++I    K  EC YF  + K  D     C CG   + H E  I P+    + W     +  +PT +FG I FTG    + K+  +VR+S       I  L+   W +   +L ISV GG  +F M  + K+IF +GL+K A TT A IIT G + G+   +G+A++     L    K  + I+ +GIA WG + NR  L    G      + +E  +     L+ NH+H+I  DDG     T  + G     R  LE  IS++  +R G    IP+V +++EGG          +      V+ EG+G+ +D+I +                   VA LP S   +    LI+Q +S            +Q+ E  K I+DI++   L+TVF       +D+D AIL +L+K               QL L + WNRVDI + +IF+ +      +    +  ++I+ K +F+ LFLEN   +++F+T + L  LYE    S  F     +++     +           ++ V ++L +++G      Y  P   +                          S  H      P ++L +WA++   ++ A   W +  +    AL  ++I K   +         E L    + FE+ A+ +  EC+  D+E A  L+ + +E WG  +CL+LA ++ D+KF+S+   Q  +   W     ++   +  ILC++ FP L +    F +  K  Q+          CR    +++R F+ AP   F ++  ++ +F+  F+YV+   M   Q +     ++IYL L  ++ ++  ++F         ++   +  + WNK+D+  I+  I  +  R  L    +Y  ++++        SL    F L+++ +    K LGPKI ++ +++K++  F  ++ ++++S+GV  QA   + +    WI    ++ + Y T+FG +     G       C+ +       +CPE++          +L   L   Y++  NILLLN+LIA  +Y  Q++  ++  IWK+  + LI EY+ +
Sbjct:   11 SDQEEGFGVQSRRATDLGMVPNLRRSNSSLCKSRRLLCSFSSEKQENLSSWIPENIKKKECVYFVESSKLSDAGKVVCECGYTHEQHIEVAIKPHTFQGKEWDPKKHVHEMPTDAFGDIVFTG---LSQKVGKYVRLSQDTSSIVIYQLMTQHWGLDVPSLLISVTGGAKNFNMKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVR--DFSLSSSCKEGDVIT-IGIATWGTIHNREALIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDG-----THGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAITNGTPCVIVEGSGRVADVIAQ-------------------VAALPVSEITI---SLIQQKLSVFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPSDLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEHERLAYASETPRLQMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSLPMPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLAL-ADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFISFRE--KRLQA---------LCRL---ARVRAFFNAPVVIFYLNILSYFAFLCLFAYVL---MVDFQPSPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAGLTCR--LIPATLYPGRIIL--------SLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWI-FRGVIYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGR 1075          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Match: sp|Q91YD4|TRPM2_MOUSE (Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 1.462e-65
Identity = 276/1074 (25.70%), Postives = 489/1074 (45.53%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKI-PYGPR-ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISEL----------HQVDEAIKCIEDIIKNELLITVF--DIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGR----PFSKG-----LNDVKELLSKMIG-----FYEYPCSEND-----SIKH--------------------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVL--MILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGY-YPQRDFSWIALSNILDYPYYTMFGVLNL---GNTVYFTWCNASTNYEVSNECPENN----------FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDK 3252
            ++I    K  EC YF  + K  D     C+CG   + H E  I P+  + + W     ++ +PT +FG I FT  D++  K+  +VRVS       I  L+   W +    L ISV GG  +F M  + K+IF +GL+K A TT A IIT G + G+   +G+A++     L    K    I+ +G+A WG + NR  L    G      + +E  +     L+ NH+H+I  DDG   Q   +     R  LE  IS++  +R G    IP+V +++EGG          +      V+ EG+G+ +D+I +                   VA LP S   +    LI+Q +S            +Q+ E  K I+DI++   L+T+F       +D+D AIL +L+K               QL L + WNRVDI + +IF+ +      +    +  ++I+ K +F+ LFLEN   +++F+T + L  LYE    S  F     +++       ++       ++ V ++L +++G      Y  P   +      ++ H                          P ++L +WAV+   ++ A   W +  +    AL  ++I K   +         E L    + FE+ A+ +  EC+  D+E A  L+ + +E WG  +CL+LA ++ D+KF+S+   Q  +   W     ++   +  ILC++ FP L +    F +  K  Q+          CR    +++R F+ AP   F ++  ++ +F+  F+YV+   M   Q +     ++IYL L  ++ ++  ++F         ++   +  + WNK+D+  I+  IV +  R  L    +Y  ++++        SL    F L+++ +    K LGPKI ++ +++K++  F  ++ ++++S+GV  QA   + +    WI    ++ + Y T+FG +     G       C+ +       +CPE++          +L   L   Y++  NILLLN+LIA  +Y  Q++  ++  IWK+  + LI EY+ +
Sbjct:   60 SWIPENIKKKECVYFVESSKLSDAGKVVCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQEMPTDAFGDIVFT--DLSQ-KVGKYVRVSQDTPSSVIYQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVR--DFSLSSSCKEGEVIT-IGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP--LRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQ-------------------VATLPVSEITI---SLIQQKLSIFFQEMFETFTENQIVEWTKKIQDIVRRRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSMTVPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLAL-ADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLFTGFISFRE--KRLQAL---------CR---PARVRAFFNAPVVIFHMNILSYFAFLCLFAYVL---MVDFQPSPSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVGLTCR--LIPATLYPGRIIL--------SLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNESRVDWI-FRGVVYHSYLTIFGQIPTYIDGVNFSMDQCSPNGTDPYKPKCPESDWTGQAPAFPEWLTVTLLCLYLLFANILLLNLLIAMFNYTFQEVQEHTDQIWKFQRHDLIEEYHGR 1074          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Match: sp|O94759|TRPM2_HUMAN (Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2)

HSP 1 Score: 242.276 bits (617), Expect = 1.805e-63
Identity = 203/756 (26.85%), Postives = 337/756 (44.58%), Query Frame = 1
Query:  244 FAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKI-PYGPRES-WSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQ----------VDEAIKCIEDIIKNELLITVF--DIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYE----TCPKSTNFRKTFLRLIGRPFSKG------LNDVKELLSKMIGFYEYPC----SENDSIK--------------------------------HPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCII-FPFLISKRTEF 2307
            F  ND++    ++I    K  EC YF  + K  D     C CG   + H E    P+  + + W     ++ +PT +FG I FTG    + K+  +VRVS       I  L+   W +    L ISV GG  +F M  + K+IF +GL+K A TT A IIT G + G+   +G+A++ +S S  Y   K    I+ +G+A WG V  R  L    G      + +E  +     L+ NH+H+I  DDG   Q   +     R  LE  IS++  +R G    IP+V +++EGG                 VV EG+G+ +D+I +                   VA LP S   +    LI+Q +S   Q          + E  K I+DI++   L+TVF       +D+D AIL +L+K               QL L + WNRVDI + +IF  +      +    +  ++I+ K +F++LFLEN   +++F+T + L  LYE    +C   +  +K  +    RP          ++ V ++L +++G +  P       ND ++                                 P ++L +WA++  +++ A   W +  + +  AL  ++I K   +         E L   + Y E+ A+ +  EC+  D+E A  L+ + +E WG  +CL+LA ++ D+KF+S+   Q  +   W    +++   +   LC++ FP L++    F
Sbjct:   50 FGNNDKQESLSSWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTG---LSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSY---KEGELIT-IGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP--LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQ-------------------VANLPVSDITI---SLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEEDTDSSEEMLALAEEY-EHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISF 773          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: A0A267FX17 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g3 PE=4 SV=1)

HSP 1 Score: 543.502 bits (1399), Expect = 1.332e-165
Identity = 364/1066 (34.15%), Postives = 594/1066 (55.72%), Query Frame = 1
Query:  256 DEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKIT---AGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNIL----EFAKGR---TVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELH--QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG--VLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAF------CYQKGR 3327
            +++   R +I A F+  EC  F            KC+CGE+++ H +  +P GP E W+E   M    T ++G+I    E   N     F RV   D +D +++L+   W++      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L    +   G     V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+  +  K +    +A L E   +     L +    +++  +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE+LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      ++ K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G   L +        C   +  + S + CP ++ L+ +L A Y++++N+LL+N+LIA  S I ++I  NS+ IWK++MY L+ EY+ +P+L +PF     +++ + F      C +KG+
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAK------DGKKCACGEVREKH-DGLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK--ADKKTLSESQLADLRERMISTFSENLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEDLAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYLEVAEATPPEGCEDGSTVDSSGKLCPTHHSLVLLLLAVYLMVVNVLLINLLIAIFSNIFKEIQNNSVEIWKFNMYFLVHEYHTRPVLAVPFVIVEDVFRFIRFLACRLPCCRKGK 1107          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: A0A267E1J7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g2 PE=4 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 3.008e-165
Identity = 364/1066 (34.15%), Postives = 593/1066 (55.63%), Query Frame = 1
Query:  256 DEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKIT---AGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNIL----EFAKGR---TVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELH--QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG--VLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAF------CYQKGR 3327
            +++   R +I A F+  EC  F            KC+CGE+++ H +  +P GP E W+E   M    T ++G+I    E   N     F RV   D +D +++L+   W++      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L    +   G     V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+  +  K +    +A L E   +     L +    +++  +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      ++ K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G   L +        C   +  + S + CP ++ L+ +L A Y++++N+LL+N+LIA  S I ++I  NS+ IWK++MY L+ EY+ +P+L +PF     +++ + F      C +KG+
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAK------DGKKCACGEVREKH-DGLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK--ADKKTLSESQLADLRERMISTFSENLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYLEVAEATPPEGCEDGSTVDSSGKLCPTHHSLVLLLLAVYLMVVNVLLINLLIAIFSNIFKEIQNNSVEIWKFNMYFLVHEYHTRPVLAVPFVIVEDVFRFIRFLACRLPCCRKGK 1107          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: A0A267FD75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g1 PE=4 SV=1)

HSP 1 Score: 541.962 bits (1395), Expect = 5.413e-165
Identity = 363/1066 (34.05%), Postives = 592/1066 (55.53%), Query Frame = 1
Query:  256 DEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKIT---AGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAK-------GRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELH--QVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY-ETCPKSTNFRKTFLRLIG------RPFSKGLNDVKELLSKMIGFYEYPCSEND--------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRT-SLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGF-----NINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFG--VLNLGNTVYFTWCNASTNYEVSNE-CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAF------CYQKGR 3327
            +++   R +I A F+  EC  F            KC+CGE+++ H +  +P GP E W+E   M    T ++G+I    E   N     F RV   D +D +++L+   W++      +LCISVIGG  +FK+  ++K +F  GLI+AA TTNA IIT GLN GIT V+G+A++  ++  ++K   ++ + C+G+APWGYV NR+ L   +          V Y +SN + K QP+SLN NHTHY+  DDG R +    K G  +  L+ +I+QK+    GI VVLLIVEGG DIF E    ++  + +V C+ TG+A+DII  A++++Q+  +  K +    +A L E   +     L +    +++  +VDE +  + +I++ E LITVFD+   +DLD AIL +L+K MD       +    QL L +TWNR DI  +KIF+ +     +    F   +I   K++F+ LFL+N   +++FLT   L+ LY E+   S+       +L+        P+   L D++ LL K++G +  P  + D          + PF +LF WAVL+ KQ  AKF W + DES+ LAL A+++Y    R  S  +  R   L+ +K+ FE LAV ++EEC  +D   A  LIEKK E +G  +CLELA+ +   KF+S    Q SI   W  G      N+  F   LC++ PFL+    EF       + E     +E      ++ K+R +Y AP TKF  ++  ++ FI  +S+ +L+ MK   ++  E + + ++ +M++++  E+F S++D +  +++ WW F+ WN++D+  ++ A++ + LR   A + + T         +T Y L    FYL++ RL   +  LGPK+ M+ K++KELL + +I+++ LL+YGV +QA  YP RDF+     +I+ YPY+ ++G   L +        C   +  + S + CP ++ L+ +L A Y++++N+LL+N+LIA  S I ++I  NS+ IWK++MY L+ EY+ +P+L +PF     +++ + F      C +KG+
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAK------DGKKCACGEVREKH-DGLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKIGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQKE----GISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQK--ADKKTLSESQLADLRERMISTFSDNLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLLP--FEF-----LVRVEPSVRLDEGGRCAQLAHKVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATDAITTG-------VRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYLEVAEATPPEGCEDGSTVDSSGKLCPTHHSLVLLLLAVYLMVVNVLLINLLIAIFSNIFKEIQNNSVEIWKFNMYFLVHEYHTRPVLAVPFVIVEDVFRFIRFLACRLPCCRKGK 1107          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: A0A4E0RDV5 (Transient receptor potential cation channel subfamily M member 6 OS=Fasciola hepatica OX=6192 GN=D915_004383 PE=4 SV=1)

HSP 1 Score: 517.309 bits (1331), Expect = 1.307e-156
Identity = 376/1098 (34.24%), Postives = 588/1098 (53.55%), Query Frame = 1
Query:  361 CSCGEIKKSHKENKIPYGP-------RESWSEGDCMEML-PTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKI---TAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAK-GRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS-QKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKL--IEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY---------ETCPKSTNFRKTF--------------------LRLIGRPFSKG---------LNDVKELLSKMIGFYEYPCSEND-----------------SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLE--TWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCIIFPFLISKRTEFTKDFKTCQS---------------ESFP------------DF-----NEDNCRTSISSKLRR----FYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQK 3321
            C CGE +K H +      P          WSE   ++ + PT +FG+IEF  E  T+ +  +FVR+S RD+L D++ L+ + W +      +LCISVIGG  +F +  + K++F  GLI+AA TTNA I+T GLN GI  V+GDA+Q  Q++ +D+ + +N + CLGI+PWGYV NRN L+     + V Y VSN +E  +P+SLN+NHTHYIF D+G RL+        FR  L  +++  +Q    GIPVVL++VEGGHD+FI+A   ++E++ +V+C GTG+ASD++  AF        R K  + D     PE  +NVL + L  I +D  E      A++ I +II++  LIT+F++   +DLD AIL++LIK          + +++QL L  TW+R DI ++K+F   + +  +     +  +++  K +F+ + L+N   ++ FLT   L  LY         E C      RK+                      RL     + G         L+ V  L+ KMIG + +   E D                 +   PF ELFLWAVL  +Q+ A FFW + D S+ LA++A  +Y    + SL + D    LE  T  + FE LAV+L+EEC+ +D E+  YL+E +   WGG +CL LA K+T  KF+S++ CQ S+ + W  G   +   F+  L      L  +  EF  D  T  S               +S P            DF     N        S  LRR     Y AP+TKF +++  +I+F+++FSY +L+ +   ++T+ E + M Y V +++D   +I  +     Y +++ W   N    +D+I I+ A+V++ LR  + ++G +T        +KT+YSL +   Y++I RL   H  LGPK+ M+ ++I EL +F  I+ + L+SYGV+ QA  +P R  F W  + ++L YPY+ ++G LNL  +  F   +  T+      CP+ NF++P+L A Y+++  ILL+N+LIA  S + Q +  NSI +WK++MY L++EYN +P++P+PFS    + +V  F  +K
Sbjct:    9 CFCGEYEKGHAKYFTSNEPSINSKFENLPWSENTHLQYIKPTEAFGQIEFLTETATSQRPAEFVRISDRDELKDVMVLMEDYWHMMEPAKPSLCISVIGGAKNFVLEGRRKDVFNTGLIQAAQTTNAWIVTSGLNLGIVRVVGDALQEGQTWHFDRRRLSNKLRCLGISPWGYVLNRNELKCDNYDKPVLYRVSNVIETGRPVSLNENHTHYIFVDEGRRLRYGGSASATFRARLGKQMALPEQAGGWGIPVVLVVVEGGHDVFIDARDCIRERIPVVICCGTGRASDLMNLAF------TYRMKQPKHDFKDFRPEE-RNVLLQALTPISRDEKE-----SALEMIIEIIQDPKLITIFNMNQSDDLDLAILFALIK--------TNSQITTQLELAFTWDRSDIAEEKVFRQGVRVGPESLEPIMMKALLRDKPEFVRILLQNGIVMRQFLTVERLSLLYNKSIHRNAFERCLSQKGLRKSIKQKTSARKVAPQQQMDVQLGTRLTRVTTTPGDTLEVAPVYLSTVSRLVRKMIGRFLHKTYEQDTQELRRYKNNWNRFRNYTFDSPFHELFLWAVLHHRQRMAMFFWERADNSIALAMIACALYADMIK-SLPNYDTETQLEYVTHMDEFERLAVQLLEECYTMDPEITLYLVEHEAPLWGGYNCLNLADKATRRKFISSVACQNSLFYAWSHGTQASPLSFTLTLFCPLLLLSDRFVEFNDDRGTEMSLDQVNDKDSSESWHHDSSPSNPNNRERNNEIDFVPRRINPTEGSKPPSLPLRRKLLVLYTAPRTKFFLNTIAYIAFLLFFSYTLLFKISSNEITVEEALTMTYFVSLLVDIIRQICVTPGAGSY-KLRLWVKINSLVYLDIIGILLALVSIFLR--IGLSGTFTA-------AKTLYSLTLIICYMRIFRLYGFHPALGPKLVMIQRMIAELFLFLLILAVILISYGVSMQALLFPNRTIFDWNTIRDVLYYPYFNLYGELNLDYS--FAIKDNCTSDADGVTCPQYNFMVPLLLAIYLMLAGILLINLLIAIFSNVFQQVEDNSIELWKFNMYGLVVEYNRRPVIPVPFSIIQAVVEVFQFLIKK 1073          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: G4VFC6 (Putative transient receptor potential cation channel,subfamily m, member OS=Schistosoma mansoni OX=6183 GN=Smp_165170 PE=4 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 2.442e-156
Identity = 371/1084 (34.23%), Postives = 586/1084 (54.06%), Query Frame = 1
Query:  277 NYINAKFKSVECRYFSVAIKEIDDKNS--KCSCGEIKKSHK--ENKIPYGPRESWSEGDCMEML-PTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAG---TLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRT-VHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKIS---QKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISEL-HQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYET---------CPKSTNFRKTFLRLIGRPFSKGLND----------VKELLSKMIG-----FYEYPCSENDSIKH---------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYH-QRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEF-----------TKDFKTCQSESFPDF-NEDNCRTS-----------ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQR-DFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSN-ECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFC 3312
            N+I   FK  EC  F     +    +   +C CGE+   H   EN I      +W+E + ++++ PT +FG+IEF+   I   K T+FVR+S  D+L+D++ L+ + WK+      +LCISVIGG   F +   +K++F  GL++AA++T A I+T GLN GI  ++G A+Q  Q + +D+ K +  + CLGIAPWGYV NR  L      T + Y +++ + +  P+SLN+NHTHYIF D+G RL+    K   FR  LE +I+   +K G   GIPVVL+IVEGGHD+FI+A   +KE V +V+C GTG+A+DI+  AF            +++D      E+   VLK+KL  Q+IS    +VD AIK IE I++NE LIT FD+    DLD AIL+SLIK          +    QL L   W R DI ++KIF             F+ +++   ++ F++LFL +  +++ FLT + L  LY           C +     +    ++    +    D          V  LL KM+G      YE      D++ +         PFQELFLWAVL ++Q  A +FW   D  L LAL+   +Y    +     DT+     E++   FE +A +L+E+C+   +E+   L++++   WG  +CL LA++S   KF+S+  CQ S+   WR G + N F  +  + FPFL+     F           +++     + S PD  N+ N  T            I S+ + FY AP+TKF  ++  ++ F+I+FSY +L+     +++IHE + + Y +  ++D   +I +S+    +G +   W   +WNK D++++   + + +LR   +           F  +K+ Y + +   YLK+  L + H +LGPK+ M+  ++ ELL+F  I+++ L+SYGV+ Q   YP R DFSW  L +IL YPY+ ++G + L     F   +A T   V N ECP +N+L P+  A Y++I  ILL+N+LIA  S + + I  NSI +WK++++S++LEY+ +P+LP+PFS+   I + + +C
Sbjct:   35 NFILRCFKYKECVKFVPDPTKPQRPHGHLQCYCGELDYKHHDYENMIKNNNDNTWTESNDIKIIGPTNAFGQIEFSDSPI--QKPTEFVRISDEDRLEDVMILMKDYWKMMEPEKPSLCISVIGGAKSFVLDGHKKDVFYSGLVQAALSTKAWIVTSGLNLGIVRMVGKALQ-DQKFHFDEWKPSESLICLGIAPWGYVLNRQTLISEDHNTPIRYEITDFITRDSPVSLNQNHTHYIFVDEGRRLRYGGSKSAEFRARLEKQIALPVEKGG--FGIPVVLVIVEGGHDVFIDARNSLKEHVPVVICSGTGRAADILTLAF---------EYRLKNDTFNGFSETELAVLKQKL--QNISGTPSKVDSAIKMIEFIVQNESLITTFDMNQSNDLDLAILFSLIK--------TSSNADKQLELAFAWKRSDIAREKIFQQGYQFDQVTLEYFMLEALKKDELDFVKLFLHHGVSMKAFLTVDRLSTLYNNSVHRDGLIKCLRKHKLLQLSTNIVKNENASQFTDTSNKKLRLATVGLLLDKMLGGFDNYLYETDADSPDNLPNVVNRSRFSSPFQELFLWAVLHQRQHMALYFWELSDNGLILALIGCCLYSNMIKLLPSYDTEARTLYESYVKEFEMIATRLLEKCYATSEELTLNLLDRETYIWGNFNCLSLAAQSLRRKFISSTACQDSLYRAWRGGVHTNAFVILATLFFPFLLCFDCLFRWDNRRAIENESQNLVESINSSNPDIRNKRNNSTDSCCGIIPKCKKIKSRFQLFYTAPRTKFIFNALVYVVFLIHFSYTLLFQTLPDKISIHESIVIGYFIAKLIDMIEQISQSQ----FGLLSAQWRDLYWNKSDVVLVCLGLFSALLRIGFSKT---------FILAKSFYVITLVGCYLKVYSLYSHHPRLGPKLVMIRSMLIELLMFIFILVVVLVSYGVSQQVLLYPYRADFSWRTLRDILYYPYWNLYGEIMLEYA--FAESDACTLTGVLNSECPMSNYLSPLFLAIYLMIAGILLINLLIAIFSNVFEKIEENSIELWKFNIFSIVLEYSSRPVLPVPFSSITAIIKFILYC 1079          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 235.728 bits (600), Expect = 1.029e-62
Identity = 278/1148 (24.22%), Postives = 513/1148 (44.69%), Query Frame = 1
Query:  469 FGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG-----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVD--EAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFL-------------RLIGRPFSKG--------LNDVKELLSKMI-----GFYEYPCSE-----------------NDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIF---PFLISKRTEFTKDFKTCQS---------------------------ESFPDFNEDNCRTSISS----KLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQ---LTIHEIMFMIYLVLMILDKFVEIFKSRSD-RIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVV-MFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLG--NTVYFTWCNASTNYE-----VSNECPE--NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKL-HIDKPMAFKHDT-LNIFSNIKSDSDLNKL-IKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKEL 3594
             G I+F G   T  K   F RVS       I  L+  +W ++   L ++++GG    +M    ++   +GL++A  +T A I+T GL  GIT  +G A++ +S +    K++    +  +GIAPW  + N+ +L  AK        + ++      SL+ +H+H+I  ++    Q      G  R  L   IS ++    G     IPV+ L+V G   I     + ++     ++  G+G  +DI+      + R C   +M++     +L E+F               LH  D    +K I+ I++N  L+TV D +   DLD  IL +L+K     C S          +L L + WNRVDI K +IF+GD+  S  +    + D+++  K  F+ LF++N  N+ +FLT   L+ELY +  + +      L             R  G P+ +         L++V ++L   +     GFY+   +E                 +   ++P+++LFLWAVL  +QK A +FW    E++  AL   +I K        + + + +++  K  +E  A+ L  EC+   ++ A  L+ +K   W   + L LA+++    F ++   Q  +   W      +     L + F   P + +   +F+ +    +                            E+  D  + +C  + S     + +RF+ AP T F  +   + +F++ F+YV+L   +       +I EI+   ++  ++L++  + F +  D  I  + K  +  ++WNK             ++   L + GV    +   +   +T+ +L    F L+++ + A HK+LGPKI ++ +++K++  F   + ++L++YGV +QA  +P      W+    +L  PY  +FG + L   +       N + + +         CP    N+L+ +L   Y+++ N+LLLN+LIA  SY  Q + GN+ + WK+  Y+LI+EY+ +P L  PF    ++ Q+L           LS  KK E     SK+ H+++ +    D  L  +  ++ ++ L +L  ++ E+  ++    +  ++    I  GI   E R  S+  E+
Sbjct:   68 LGDIDFIGSSRTRGK---FARVSSMTDPVLIYQLLTEQWGLSPPHLVVALVGGDELDQMKPWLRDTVRKGLVRATQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVR----VVAIGIAPWTMIHNKEMLLTAKPDQPAAYPTEDLPHGSVYSLDCHHSHFILVEEE---QHRSGATGDMRVKLLKHISLQRTGYGGPGSFEIPVLCLLVHGEPKILQRMYKTIQNATPWLLLAGSGGVADIL---VTLIYRGCWDTEMVQE----LLLETFTG-------------LHSTDITSWVKVIQKILENGHLLTVHDPEQTADLDTVILKALVKA----CKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFNGDVEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELYCSVSEKSLLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLKDFLHDSCKGFYQKLPAERVGKGRLFHSQKDLPDLDQHCENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEMAHLE-SEAESARSMKEAK--YEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTSISKLVLSFFCPPLIWTNLIKFSDEILQSRGGGEQFAELDSLDTEKALLLSDDDPDDSEAAGDPADQSCSQAWSQFLLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLLLDFRPPPPDGPSIAEIILYFWVFTLVLEEIRQSFFTDEDMNILKKCKL-YVEDNWNK-----------CDMVAISLFVVGVSCRMMENTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRLDWV-FRRVLYRPYLHIFGQIPLEEIDAAKMQPDNCTMDLQDIITGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQGNTDIFWKFQRYNLIVEYHSRPALAPPFIIISHLSQIL-----------LSLCKKSE-----SKIEHLERELPAGLDQKLMTWETVQKENYLARLERRHLESSEERLKSTSSKVQSLLQIVGGIKDQEKRMASMEAEV 1149          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 213.772 bits (543), Expect = 9.546e-56
Identity = 177/704 (25.14%), Postives = 329/704 (46.73%), Query Frame = 1
Query:  361 CSCGEIKKSHK----ENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGR-TVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG--YFRQALENKISQKQGDRVG-----IPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQ---VDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI---------GRPF---SKGLN--DVKELLSKMIG-----FYEYP------CSENDSIKH-----------------PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINF--FSCILCIIFPFL 2286
            C CG  + SH      +         W         PT +FG++EF G    + + ++F+R+S          ++ + W +    L +SV+GG    K+  K + +  QGL++AA +T A I++ GL +GI   +G+A++ ++ +   D +     +  +G+APWG V  R+ L   +G     Y V+N         L+ NH  ++  DDG     T ++ G   FR  LEN ISQ++  ++G     IPV+  +V G   +       +K+ +  +V  G+G  +D++ +    ++ + +   +           + K  L+ ++ E+ +        VD+ +  + ++ K++ LI+++ ++    ED D  +L +L++       S+ +  + +L L +TWNRVDI + ++F+GDI   N+   +F+ D+++  K +F+ LF+EN  N+Q+++T   L+ELY +   S+       R +         G P    +KGL   +V +LL  ++G     FY+         S   +IK                  P+  LF WAVL  + + A FFW    ES+  AL A ++ +   +    +T+   +L+     FENLA  +  +C+   +  +  L++KK+  W G +CL++A ++    F S+   Q  +   W    + N   +  +L +  P L
Sbjct:   50 CQCGGSRDSHATVSLNDYFSSAIVSHWDSALHSSEAPTDAFGEVEFGG---VSKRHSNFLRLSSDTPPATAYTILTSNWGLPKPNLVLSVVGGVGRSKVKPKLREVLRQGLVRAAQSTGAWILSGGLREGIDRCLGEAVRDHTTAASSDSLTK---VVAIGVAPWGLVNLRDELVNPEGSYPAGYFVTNT--SRDSYCLDTNHQAFLLVDDGS----TGRRGGEARFRAGLENYISQQRTGKLGSGSMDIPVLCTLVSGELYMLERLDLSLKKCIPWMVLAGSGGLADLVTDV---LENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFPSEPDVDKLVDKLLNVHKSQDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLSTEELKLAVTWNRVDIARSELFTGDIQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELYRSISDSSVAYTLLQRHLSERQGVAGTGWPAADPAKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTVLQEGEYRQQRCVFPWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKLLRELCKLE-NETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTLFIPPL 737          

HSP 2 Score: 66.6254 bits (161), Expect = 1.791e-10
Identity = 56/184 (30.43%), Postives = 98/184 (53.26%), Query Frame = 1
Query: 2776 FYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNT-VYFTW-CNASTNYEVSNECPEN------NFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
            F L+++ + A HK+LGPKI ++ K++K++  F   + +++++YGV +Q   Y     +   L  +   PY  +FG +        F W    +TN    +E  E       N+++ IL   Y+++ NILL+N+LIA  SY    +   S V WK+  + +I+EY+ +P L  PF  F + +Q +
Sbjct:  933 FTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLAVWMMAYGVANQGLIYSFDPSADRILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFIIFSHFHQFI 1116          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 214.157 bits (544), Expect = 1.591e-55
Identity = 167/523 (31.93%), Postives = 261/523 (49.90%), Query Frame = 1
Query:  265 MQYRNYINAKFKSVECRYFSVAIK---------EIDDKNSKCSCGEIKKSH---------KENKIPYG----PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1725
            M  +++I + F   EC Y     K         +I  +  +C CG + + H         K + +  G    P E WS  +  E  PT ++G I F G   ++S    +VR+S+  + + I+ L+  +W++    + ISV GG  +F +H + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F       L + D   L Q       + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:    1 MSQKSWIESTFTKRECVYILPVSKDPHRCLPGCQICQQLVRCCCGRLVRQHVGFTASLAMKYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTF------NLSQNDAVHLFQT------LMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 485          

HSP 2 Score: 157.147 bits (396), Expect = 4.744e-38
Identity = 155/566 (27.39%), Postives = 265/566 (46.82%), Query Frame = 1
Query: 1834 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVY---FTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLH 3387
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G       VY      C  ST   + + C    +L P L A Y+ I  IL++N+LIA  + +   +   S ++WKY  Y  I+ Y+DKP+LP P   F +I   L+F  ++ +  +    K F   +   KLH
Sbjct:  611 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG------EVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLFLTEEDQKKLH 1159          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 213.772 bits (543), Expect = 1.837e-55
Identity = 167/523 (31.93%), Postives = 261/523 (49.90%), Query Frame = 1
Query:  265 MQYRNYINAKFKSVECRYFSVAIK---------EIDDKNSKCSCGEIKKSH---------KENKIPYG----PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1725
            M  +++I + F   EC Y     K         +I  +  +C CG + + H         K + +  G    P E WS  +  E  PT ++G I F G   ++S    +VR+S+  + + I+ L+  +W++    + ISV GG  +F +H + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F       L + D   L Q       + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:    1 MSQKSWIESTFTKRECVYILPVSKDPHRCLPGCQICQQLVRCCCGRLVRQHVGFTASLAMKYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTF------NLSQNDAVHLFQT------LMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 485          

HSP 2 Score: 157.147 bits (396), Expect = 4.757e-38
Identity = 155/566 (27.39%), Postives = 265/566 (46.82%), Query Frame = 1
Query: 1834 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVY---FTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLH 3387
            E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G       VY      C  ST   + + C    +L P L A Y+ I  IL++N+LIA  + +   +   S ++WKY  Y  I+ Y+DKP+LP P   F +I   L+F  ++ +  +    K F   +   KLH
Sbjct:  611 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG------EVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLFLTEEDQKKLH 1159          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 213.386 bits (542), Expect = 2.568e-55
Identity = 164/504 (32.54%), Postives = 253/504 (50.20%), Query Frame = 1
Query:  295 FKSVECRYFSVAIKEIDDKNSKCSCGEIKKSH---------KENKIPYG----PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPIS----LNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTN 1725
            F   EC Y    I  +     +C CG + + H         K + +  G    P E WS  +  E  PT ++G I F G   ++S    +VR+S+  + + I+ L+  +W++    + ISV GG  +F +H + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L    GR V   V+       P+S    LN  H+H+I  D+G     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F       L + D   L Q       + + +KN+ LITVF + S  H+D+D AIL +L+K  D            QL L L W+RVDI KD +F     L  D     + D+++  +V F++L +EN  ++  FLT + L+ELY T    TN
Sbjct:    3 FTKRECVY----ILPVSKDPHRCCCGRLVRQHVGFTASLAMKYSDMKLGEAQPPHEEWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSRSARK------ICTIGIAPWGVIENRNDL---IGRDV---VAPYQTLLNPLSKLNVLNNLHSHFILVDNG-----TVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTEDDGGLPDGVETDIIATVKKTF------NLSQNDAVHLFQT------LMECMKNKELITVFHVGSEDHQDIDVAILKALLKGTD-------ASAFDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTN 464          

HSP 2 Score: 158.303 bits (399), Expect = 1.997e-38
Identity = 155/567 (27.34%), Postives = 265/567 (46.74%), Query Frame = 1
Query: 1831 SENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTKDFKTCQSESF-----------PD------FNEDNC-----------------RTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVY---FTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLH 3387
             E     +PF EL +WAVLM++QK + FFW   +ES+  ALVA ++ +   Y  + S    D SE L+ + N F  LAV L+E+    D+ ++  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E     ++  +              PD      F E                    R  I  K   FY AP  KF  ++  ++ F++ +SYVVL  +     +  E   ++Y+    ++K  E+F S   +I  +IK W++ +++N+ D I IV   V   LR+             +F   + IY L +  +Y+++L +LA +++ GP + M+ K++  +     I+ + L++YGV  +A  YP  +  W  + +++  PY+ M+G       VY      C  ST   + + C    +L P L A Y+ I  IL++N+LIA  + +   +   S ++WKY  Y  I+ Y+DKP+LP P   F +I   L+F  ++ +  +    K F   +   KLH
Sbjct:  584 PETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRFGSG---------NVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYG------EVYAYEIDVCANSTENNMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLFLTEEDQKKLH 1133          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 274.633 bits (701), Expect = 1.097e-76
Identity = 292/1049 (27.84%), Postives = 481/1049 (45.85%), Query Frame = 1
Query:  523 FVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV--HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQ---KQGDRVGIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFR---EMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFS-GDISLSNDEWAAF---LKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCP--KSTNFRKTFLRLIGRP--FSKGLNDVKELLSKMIG-------------------FYEYPCSENDS--------------------------IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKY---HQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI----------------------------SKRTEFTKD------------------------FKTCQSESFPDFNEDN--------CRTSISSKLRR---FYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQ--LAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDK 3252
            + RVSY  + D ++ L+  +W++    L ISV GG  +F++H K K +F +GLIKAA+TT A I T G+N G+ + +G+A++   S      + ++ I  +GIAPWG ++NR  L       V  +  +SN + K     LN  H+H+I  DDG     T  K G     R+ LE  I+    + G   G+PVV L+ EGG ++ +     + E+  V +VVCEGTG+A+DI+    +   +   +C        DG   L +     +K+         +H +   ++C    ++ + LITVF   S  H D+D AIL +L+K  +          + QL+L L W+RVDI K+ +F  G   +   EWA +   + D+++  +V F++L +EN  ++  FLT   L+ELY T    + +N R    R    P  +   L DV  ++  ++G                   + ++  S +++                            +PF EL  WAVLM++Q+ A FFW   +ESL  ALVA ++Y+      + S  D  + + L   +  F  LA+ L+++    D+ +A  L+  +  NW   +CL+LA  S    F+++   Q  +   W    N+   ++F  IL I+ P  I                              R   T+D                         +T  + S  D  E           R S  S  RR   FY AP  KF  ++  +I F++ F+YVVL  ++++  ++ E   ++YL +  +++  EIF S   +   +IK W    +WN  D + I+   VA+ LR Q  L I             +K +YSL V  +Y+++L + A ++ +GP I M+ K++ +  +   I+ I LLS+GV  QA  + + D SW    NI+  PY+ +FG       VY    + +T+ E    C    F+ P L A Y+ +  I+++N+LIA  + I  +    S  +WK+  Y   + Y+ K
Sbjct:    2 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHAS------RSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLN--LLNSLHSHFILVDDG-----TVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGELC--------DG---LHDEIVGTIKKTFNFSHGQAMHLLQTLLEC----MRRKELITVFHTGSEDHSDVDLAILTALLKGTNF-------SSADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILLHRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLD-GYWNINDSLGILLFFVAVALRSQSHLLIE------------AKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFG------EVYAPEIDNNTDDEYP-PCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQK 994          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 261.536 bits (667), Expect = 1.927e-72
Identity = 275/1018 (27.01%), Postives = 458/1018 (44.99%), Query Frame = 1
Query:  523 FVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTV--HYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQ--------GDRVGIPVVLLIVEGGHDIFIEASRRVKEK--VSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDI---SELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGD---ISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKS-TNFRKTFLRLIGRPFSKGLN------DVKELLSKMIGFYEYPCSENDSI------------------------------KHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKY---HQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEF-----TKDFKTCQSESFPDFNEDNCR-----------TSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKS----------RSD---RIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQ--LAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGN-----TVYFTWCNASTNYEVSNE---CPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDK 3252
            + RVSY  + D ++ L+  +W++    L ISV GG  +F++H K K +F +GLIKAA+TT A I T G+N G+ + +G+A++   S      + ++ I  +GIAPWG ++NR  L       V  +  +SN + K     LN  H+H+I  DDG     T  K G     R+ LE  I+ ++        G   G+PVV L+ EGG ++ +     + E+  V +VVCEGTG+A+DI+    +        H       + +L    + + +++L+       +  H        I      E LI +    +    +F    S   +++L                L W+RVDI K+ +F      ++L    W   + D+++  +V F++L +EN  ++  FLT   L+ELY T     TN  K  L    R    GLN       +  LL  ++G     CS   ++                               +PF EL  WAVLM++Q+ A FFW   +ESL  ALVA ++Y+      + S    D SE L+ +   F  LA+ L+++    D+ +A  L+  +  NW   +CL+LA  S    F+++   Q  +   W    N+   ++F  IL I+ P  I       + E      +++     + S  D  E   +            S+S ++  FY AP  KF  ++  +I F++ F+YVVL  ++++  ++ E   ++YL +  +++  E+             RSD     + +IK W    +WN  D + I+   VA+ LR Q  L I             +K +YSL V  +Y+++L + A ++ +GP I M+ K++  +     I+ I LLS+GV  QA  + + D SW    NI+  PY+ +FG +               C         +E   C    F+ P L A Y+ +  I+++N+LIA  + I  +    S  +WK+  Y   + Y+ K
Sbjct:    1 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHAS------RSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLN--LLNSLHSHFILVDDG-----TVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGWAHTHRHGQAMHLLQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNF----SSADQLNL---------------ALAWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKRPLLANSRSPPVGLNCTLNPPVIGNLLLMILG---GTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLD-GYWNINDSLGILLFFVAVALRSQSHLLIE------------AKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQK 969          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 142.124 bits (357), Expect = 2.476e-34
Identity = 161/663 (24.28%), Postives = 311/663 (46.91%), Query Frame = 1
Query: 1513 TWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGR----------------PFS-KGLND---------VKELLS---------KMIGFYEY-PCSENDS---------------------IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINF--FSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIF--KSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGY-YPQRDFSWIALSNILDYPYYTMFGVL--NLGNTVYFTWCNASTNYEVSN---ECP--ENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIY 3294
             WNRVDI   +IF+ D      +    +  +++  + +FI LF+E+   ++++LT   L+ LY   P S +     LR I                  P + K +N          ++ELL          KM  F +  P S+N                          P ++LF+WAVL+ +++ A FFW +  + +  AL+A+++ K   +    D+DR+  +    + +E LA+ L++EC+  D+  A  L+ ++  +WGG +CL +A  + +  F S+   Q  +   W  G +++   +  ILCIIFP LI  R      F+                T   ++ R F+ AP T F  +  ++  F+  F+YV++   +       E +   +++ +IL++  ++F    ++ +    ++Y    + WN++D++ ++   + ++ R  L  N +       F+  +++  +    F L+++ +   +K LGPKI ++ +++K++  F  ++ +++++YGV +Q      ++   WI    ++  PY  +FG     + +T + T   + TN  ++     CP    ++L  +L   Y++  NILLLN+LIA  +Y  Q +  N+  IWK+  Y L+ EY+ +P L  P   F ++Y
Sbjct:  379 AWNRVDIATSEIFTDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPAS-SLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQEE-DDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIFPLLIYTR---IITFRWVLY----------AHTCTPTRWRNFWTAPITVFWANVVSYFIFLWLFAYVIIMDFQYTP-DWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRY--IKDIWNRIDILALLLFTIGVICR--LIPNSINEST---FQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDWI-FRGVVYQPYLLIFGQFPTRVDSTTFDT--TSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPLIVFSHLY 1015          

HSP 2 Score: 90.8929 bits (224), Expect = 1.439e-18
Identity = 67/241 (27.80%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  361 CSCGEIKKSHKENKI--PYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTN---ALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVG 1068
            C C   +  H    +  P    + W         PT +FG I+FTG      +L  FVRV    +   +  L+   W +    L ISV GG  +F +  + + IF  GL K A +T    A IIT G   G+   +G++++    +          I  +GIA WG + N+  L  A+G+       +E  + +   L+ NH+H+I  D+G   Q   + V   R  LE  IS +     G
Sbjct:   34 CECRHPRSEHANTALLKPTLLGQKWEPAKHTANEPTNAFGDIQFTG---LGQRLGKFVRVGNDTEPSVLFKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVR---DFALASGSKEGKIVAIGIATWGIIHNKEHLIDAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIV--LRARLEQYISTQHTGSGG 266          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 268.47 bits (685), Expect = 4.729e-73
Identity = 196/754 (25.99%), Postives = 365/754 (48.41%), Query Frame = 1
Query:  232 SNVH---FAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGP-RESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYV-KNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKI------SQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRS-DG--VAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH--EDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSK--GLNDVKELLSKMIG--FYEYPCSEN-------------------------------DSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRA--GFNINFFSCILCIIFPFLISKRTEFTKD 2316
            S+VH   F  N      +++I   F   EC  F     ++    S+C CG  ++ H +  +  G   E W+   C    PT ++G+I+F G      K   ++R+S+    + ++ L+  +W +    L ISV GG   F +  + + +F +GLIKAA TT A IIT G N G+   +G+A++  Q       +    ++ +GIA WG V K  +++    G+            HQ   L+ NH+H+   DDG     T+ K G     R  +E  I      S+ +   +G+PVVLL++EGG +        +K+KV  VV +G+G+A+ ++G A+         H + R+ DG  + ++   +++ ++ K++E  +      D+    I+D++++E +I+V+ +     +D+D AIL +L+K       +N++   +QL+L L WNR+D+ K  IF+ +   + +  +A +  +++  K +F ELFL+N  ++++FL+ +IL +LY   P +T  +    + +G+   K   ++ V E++ +++G  F  Y   +                                D +  P+ ++FLWAVL  +++ A+  W    E +  AL+A+R+ K     +  D   TD S  L      FE  AV +++EC + ++ ++  L+ ++ +++  ++ LELA  +    F+++  CQ  +   W      N  ++  ++C+  P LI     F  D
Sbjct:   16 SHVHLNKFGSNQLSQSKKSWIARNFSRRECIRFVPKSHDV----SRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEG--YGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQ----VNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDG-----TEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAY--------NHTIKRNVDGQTINVIDPQYEDEVRAKVVE--VFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLK-------ANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIFPIIYFVPD 737          

HSP 2 Score: 87.4261 bits (215), Expect = 2.979e-17
Identity = 112/516 (21.71%), Postives = 242/516 (46.90%), Query Frame = 1
Query: 2344 PDFNED--------NCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLT-----IH--EIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQ-----RDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTKLNKIQIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVNIVSTENSPVVIT 3831
            P+  ED        N +     ++  FY AP +KF  +   +++FI  ++YVVL+   R         IH  EI+   ++  +++++  ++       I  ++  +++ + WN VD+  +   I+A++LR+       +T+  + F  S+ I SL +  F ++ L++ + ++ LGPK+ M+ K++++L  F  I+ +F ++YG+   A  +P      R+ +W+ +++++ YPY+ M+G L      +          E     P+  +L P+L A Y++  NILLLN+LIA  +Y  + +  +S  +WK+  Y L+ EY+ +P+   P     +I   + + ++  RC +       +I    +++                             +  +N+  +F    + I +Q+   SG   +E R +++   ++ I ++LN++ + ++   +  + T+ NG       + +  +A +   L++N   LQ  +  + Q+  +      P+ +T
Sbjct:  807 PEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFS-DTWNFVDIFSLTVFIIAIILRF-------FTNSRI-FTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGEL------FLDEIQGEKPKEFGEVDPDGRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVWRMCRCGHPPRGSTMKIGLSPAEM-----------------------------EQMDNW--EFQAAEMYIHQQQQKNSGT--LEERVRALGDRVDCINSQLNRV-LDSMSGTRAHALTDGNGLEGGHDSEGR--LARMEVELSSNSESLQKILALLQQQPPVKGQAAVPIQLT 1271          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 157.918 bits (398), Expect = 6.675e-39
Identity = 132/433 (30.48%), Postives = 230/433 (53.12%), Query Frame = 1
Query:  454 LPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNF-ISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVG---YFRQALENKISQKQGDRV--GIPVVLLIVEGGHDIF---IEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDE------AIKCIEDIIKNELLITVFDIKSHE-DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELY 1701
            LPT +FG++EF G          ++R+++    + ++ L+  +W +    L ISV GG  +F +  K K +  +GL+KAA TT A +IT G N G+   +G+A++ ++     +++K+    +  +GIA WG V ++ +L   K   V Y +++ ++  +   L+ NH+H+I  D+G     T  + G    FR +LEN I+ K+  +   G+PVVLL++EGG +     +E+  R    V +V+ EG+G+A+DI+  A R +    S  +M    GVA + E  + +L +  IE+  +E    D        +KC+    K E  +T+F +     ++D AIL +L+K          + L  QLSL L W+R DI K +IF+ D           + ++++  +V+F++L L+N  ++ +FLT   L+ELY
Sbjct:   15 LPTDAFGELEFQGAG--QPSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSSMQS-RGACLDNNHSHFILVDNG-----TDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCP-AVPVVIAEGSGRAADILAFAHRFIAP--SNGEM---SGVADVVEH-RQLLHK--IEKSFAECSPEDRLSIYQNVLKCVA---KRE-FVTIFCVDDGGLEVDKAILRALLKSQH-------SQLEDQLSLALVWDRADIAKTEIFTEDQKWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELY 419          

HSP 2 Score: 88.1965 bits (217), Expect = 1.628e-17
Identity = 112/462 (24.24%), Postives = 203/462 (43.94%), Query Frame = 1
Query: 2041 FENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINF---FSCILCIIFPFLIS----KRTEFTKDFKTCQSESF----PDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHE----------IMFMIYLVLM-----------------ILDKFVEIFKSRSDRIYGRIKYW---------WTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPE----NNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPF 3273
            F ++A+ L++EC+  +  +A  L+      WGG + L LA  S   +F+++  CQK +   W       +      +L I+FP LI     +  E  +   T   +S     PDF+  + R   S++    Y+     F  +  +  +       + L G+ +  +  +           I+++++LV+                  +L  FV    +   R    I  W         W  N WN  D   +V   +A+ LR                R    +YSL +  + +++L + +  K LGP + M+ ++  +++ F  I+++FLL+YGV  QA  +P    SW  ++ I   PY+ ++G L + +  Y     +S + E +   P+       L+ ++ A Y+++ NILLLN+LIA  +    ++  NS  IWK+  +SL++EY  +P L  PF
Sbjct:  595 FYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVLLGILFPPLIFALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVPSIEEWVLIGFVFSLCAEEVRQVRVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLRLNPGT----------LRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELITKIFFRPYFQVYGELFIEDVDY-----SSNSRETAFSTPKFDEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPF 1041          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 259.996 bits (663), Expect = 4.683e-70
Identity = 289/1074 (26.91%), Postives = 488/1074 (45.44%), Query Frame = 1
Query:  361 CSCGEIKKSHKENKIPYGPR----ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQGDR----VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLP-ESFKNVLKRKLIEQDISELHQ------VDEAIKCIEDIIKNELLITVFDIK--SHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFL-TANILKELYETCPKSTNFRKTFLRLIGRP---------FSKGLNDVKELLSKMIGFYEYP----------------CSENDSIKHPFQE---------LFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCIIFPFLI----------------SKRTEFTKDFKTCQSE--------SFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKY-WWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD--FSWIALSNILDYPYYTMFGVL--NLGNTVY-FTWCNASTNYEVSNECP---ENN------FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYI 3291
            C CG  K++H    I   P     E+W++   +  +PT +FG+I+F G   T +K   + RVS     + + DL+  +W +    L ISV GG  +F +    +N+F +GLIK A TT A IIT G N G+   +G A++ YS S           I  +G+A WG + NR  L   +G      ++++  + +   L+KNHTH++  DDG     T    G     R  LE  IS KQ  +    V IPVV +++EGG          +K     V+ EGTG+ +D+I +                   V+ LP +     L  +L+E+   + ++      V E  K I+DI++   L+T+F +   SH D+D AIL +L+K          +   +QL L + WNRVDI K +IF+ D   S+ +    +  +++  K +F+ L LEN  +++ FL     L  LY   P     RK   R+  +           +   ++V+ LL         P                 S+N+    P  E         +FLWAVL   +  A+  W +C +S+  AL ATRI K        D + +E +    +++E  A+ +  EC++ D+E A  L+   +  WGG + L LA K+ D +F++    Q  +   W    +++      ++C++F  LI                +K+ E  K  K             S PD        S   +L   Y +PQ KF  +  ++  F+  F+ V++        ++ E++  +++  ++ ++F ++F   SD    +IK   +  + WN +D++ I+  ++ +  R  L     Y  K+V+          +V  F L+++ +    + LGPKI ++ +++K+L  F  ++ I++++YGV  Q G     D    WI    I + PY  +FG    NL    +    C+ +    +  +CP   EN+      +L   +   Y++  NILLLN+LIA  ++  Q++  N+  IWK+  Y LI EY+ +P  P PF  F ++
Sbjct:   55 CKCGYSKEAHNVEAI--KPEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAK---YARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQ-----IVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDG-----THGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQ-------------------VSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILK-KLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDKP-----LSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATP-SVPELLLYVWVFSLVCEEFRQLF-CNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFR--LTSELFYAGKIVL------CIDFVV--FCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQ-GILIHNDTRLDWIFRGAIYE-PYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHL 1074          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 259.61 bits (662), Expect = 6.223e-70
Identity = 289/1074 (26.91%), Postives = 488/1074 (45.44%), Query Frame = 1
Query:  361 CSCGEIKKSHKENKIPYGPR----ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKISQKQGDR----VGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLP-ESFKNVLKRKLIEQDISELHQ------VDEAIKCIEDIIKNELLITVFDIK--SHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFL-TANILKELYETCPKSTNFRKTFLRLIGRP---------FSKGLNDVKELLSKMIGFYEYP----------------CSENDSIKHPFQE---------LFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNIN--FFSCILCIIFPFLI----------------SKRTEFTKDFKTCQSE--------SFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKY-WWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD--FSWIALSNILDYPYYTMFGVL--NLGNTVY-FTWCNASTNYEVSNECP---ENN------FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYI 3291
            C CG  K++H    I   P     E+W++   +  +PT +FG+I+F G   T +K   + RVS     + + DL+  +W +    L ISV GG  +F +    +N+F +GLIK A TT A IIT G N G+   +G A++ YS S           I  +G+A WG + NR  L   +G      ++++  + +   L+KNHTH++  DDG     T    G     R  LE  IS KQ  +    V IPVV +++EGG          +K     V+ EGTG+ +D+I +                   V+ LP +     L  +L+E+   + ++      V E  K I+DI++   L+T+F +   SH D+D AIL +L+K          +   +QL L + WNRVDI K +IF+ D   S+ +    +  +++  K +F+ L LEN  +++ FL     L  LY   P     RK   R+  +           +   ++V+ LL         P                 S+N+    P  E         +FLWAVL   +  A+  W +C +S+  AL ATRI K        D + +E +    +++E  A+ +  EC++ D+E A  L+   +  WGG + L LA K+ D +F++    Q  +   W    +++      ++C++F  LI                +K+ E  K  K             S PD        S   +L   Y +PQ KF  +  ++  F+  F+ V++        ++ E++  +++  ++ ++F ++F   SD    +IK   +  + WN +D++ I+  ++ +  R  L     Y  K+V+          +V  F L+++ +    + LGPKI ++ +++K+L  F  ++ I++++YGV  Q G     D    WI    I + PY  +FG    NL    +    C+ +    +  +CP   EN+      +L   +   Y++  NILLLN+LIA  ++  Q++  N+  IWK+  Y LI EY+ +P  P PF  F ++
Sbjct:   55 CKCGYSKEAHNVEAIK--PEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAK---YARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQ-----IVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDG-----THGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQ-------------------VSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILK-KLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDK-----PLSCWDRLVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATP-SVPELLLYVWVFSLVCEEFRQLF-CNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFR--LTSELFYAGKIVL------CIDFVV--FCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQ-GILIHNDTRLDWIFRGAIYE-PYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITMLCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHL 1074          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 249.98 bits (637), Expect = 1.192e-66
Identity = 220/740 (29.73%), Postives = 343/740 (46.35%), Query Frame = 1
Query:  274 RNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYG-----------------PRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDI--FIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKS--HEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAA-----FLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKG---------LNDVKELLSKMIGFYEYPCS------------------------------------------ENDSIKH---PFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRD---TDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTW 2226
            +++I   F   EC +  V+ K+      +C CG +   H    +P G                   E WS     ++ PT +FG IEF G   +N  +  +VRVSY  K D ++ L+  +W++    L ISV GG  +F++  K K +F +GLIKAA+TT A I T G+N G+   +GDA++   S      K    I  +GIAPWG V+N+  L        +  +SN + K     LN  H+H+I  D+G     T  K G     R+ LE  IS QK   R+  G+PVV LIVEGG ++   +    R    V +VVC+G+G+ASDI+  AF         HK     G+  + ES ++ L   + +       Q       + + +K + LITVF + S  H+D+D AIL +L+K  +            QLSL L WNRVDI + +IF     +   +W        + D+++  +V F++L +EN  ++  FLT + L+ELY T    +N   T   L+ R   KG         L D+  ++  ++G   Y C+                                          ++  I H   PF EL +WAVLM++QK A FFW   +E++  ALVA ++ K     +  +    D S+ L      F  LAV+L+++ +  D+++A  L+  + +NW   +CL+LA  +    F+++   Q  +   W
Sbjct:   44 KSWIERAFSKRECVHIIVSAKD----PHRCCCGRLIGQHV--GLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS------KSRGKICTIGIAPWGIVENQEDLVGKDVVRPYQTMSNPLSKL--TVLNSLHSHFILADNG-----TTGKYGAEVRLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL--AF--------GHKYSEEGGI--INESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGAN-------ASAPDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSN---TLYHLV-RDVKKGNLPPDYRISLIDIGLVIEYLMGG-AYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSREFAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMW 733          

HSP 2 Score: 83.5741 bits (205), Expect = 1.277e-15
Identity = 88/312 (28.21%), Postives = 163/312 (52.24%), Query Frame = 1
Query: 2377 ISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVS---NECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL 3303
            +  K+  FY AP  KF  H+  ++ +++ F+Y+VL  M  +  +  E + + Y+    ++K  EI  S   ++  ++K W    +WN  D++ I+   V MVLR Q         +     + + IY + +  +Y+++L +   +K LGP + M+ K++ +++ F  I+L+ L+S+GV  QA   P  D SW+   NI   PY+ ++G +           N +T+  V      C    +++P + A Y+++ NILL+N+LIA  +    ++   S  +WK+  Y LI+ ++++P+LP P   F +I  VL
Sbjct:  830 LGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMD-LWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSVGMVLRLQ---------EPPFMSYGRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDPPCGQNITTDDGVVVALPACKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHITMVL 1130          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 213.386 bits (542), Expect = 9.174e-56
Identity = 255/1020 (25.00%), Postives = 457/1020 (44.80%), Query Frame = 1
Query:  472 GKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQ-YSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFD-DGYRLQMTKKKVGYFRQALENKIS-QKQGDRVG---IPVVLLIVEGGHDIFIEASRRVK---EKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSH-EDLDFAILYSLIKRMDLLCDXXXXXXXX---XXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLR-------LIGRPFSKG---------------LNDVKELLSKMI-----GFYEYPCSENDS-----------------IKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSI--EFTWRAGFNINFFSCILCIIF--PFLISKRTEFT-KDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKR--MQLTIHEIMFMIYLVLMILDKFVE-IFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRD-FSWIALSNILDYPYYTMFGVLNLGNT---VYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSS--------YICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQV 3300
            G I+F G + T  K   FV+V    +   I  ++  +W ++   L ++V+GG    +M    ++   +GL+KAA +T A I+T GL  GIT  +G A++ +S +     ++    +  +GIAPW  + NR  L  AK   V Y    ++      SL+ NH+H++  + D  R   T +     R  L   IS Q+ G   G   IPV+ L+V G   I     R  K        ++  G+G  +DI+      M R C     +      +L ++F N         DIS        +K I+ I+ +  L+TV D +    +LD  IL +L+K     C S          +L L + WNRVDI K  IF+GD+     +    + D++I  K  F+ LF++N  N+ +FLT   L+ELY +  + +      L+       L+G   + G               L +V ++L   +     GFY+   +E                     +HP+++LFLWAVL  +Q+ A +FW    E++  AL   +I K   R    + + + +++  K  +E  A+ +  EC+   ++ A  L+ ++   W   + L LA+++    F ++   Q+++  +  W A       S ++   F  P + +   +F   +  +  +E      +D+       + RRF+ AP T F  +   + +F+  F+YV+L   K       + EIM   ++  ++L++  +  F      I  + K  +  ++WNK DM+ I+           L + GV       +   +T+ ++    F L+++ + A HK+LGPKI ++ +++K++  F   + ++L++YGV +QA  +P      W+     L  PY  +FG + L      +    C   +N  V    P      P ++A +++I+ +++  ++             Y  Q + GN+ + WK+  Y+LI+EY  +P L  PF    ++ Q+
Sbjct:   38 GDIDFCGTNKTRGK---FVKVRSNTEPVQIYQMLTQEWGLSPPHLVVAVVGGDELAQMKPWLRDTLRKGLVKAAQST-AWILTNGLRFGITKHLGQAVRDHSLASTSSTVR----VVAIGIAPWNMIHNREALLSAKDEPVVYT-PQDLPHGSVYSLDNNHSHFVLVEEDPARPGATSE----MRVKLLKHISLQRTGYGAGSFEIPVLCLLVHGEPKILKFLQRMYKGIANSTPWLILAGSGGVADIL---VTLMNRGCWDTDSVHE----LLLDTFPNAHH----SADISNW------VKLIQKILDHGHLLTVHDPEQETSELDTVILKALVK-----CKSQSQEAQDFLDELKLAVAWNRVDIAKSDIFNGDVEWKACDLEEVMMDALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYWSVSEKSLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRLFQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEMARLE-SEAESARSMKEAK--YEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQQALLTKIWWGAMTTDTAISKLVVSFFCPPLIWTNLIKFQFVELDSLDTEKALMLTDDDDPRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQGPGVPEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKL-YVEDNWNKCDMVAIL-----------LFVVGVSCMAAGTYEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDWV-FRRALYRPYLHIFGQIPLEEIDARMPKINCTDDSNEIVMGLLPP----CPNIYANWLVILLLVIFLLVTNVLLLNLLIAMFYTFQVVQGNTDIFWKFQRYNLIVEYYSRPALAPPFIIISHLSQL 1002          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 206.068 bits (523), Expect = 4.969e-53
Identity = 165/537 (30.73%), Postives = 262/537 (48.79%), Query Frame = 1
Query:  253 NDEKMQ-YRNYINAKFKSVECRYFSVAIK---------EIDDKNSKCSCGEIKKSHK----------------ENKIPYGPR-ESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGY---FRQALENKIS-QKQGDRV--GIPVVLLIVEGGHDIFIEASRRVKE--KVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHE--DLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLI 1752
            +DE +Q  + +I   F   EC Y     K         +I  +  +C CG + + H                 EN  P  P  E WS     E+ PT ++G I F G   ++S    +VR+SY  + + ++ L+  +W +    + ISV GG  +F++H + K +  +GLIKAA+TT A I+T G+N G+   +GDA++   S    K      I  +GIAPWG ++NRN L        +  + N + K     LN  H+H++  DDG     T  K G     R+ LE  I+ Q+   R+  G+PVV LI EGG ++ +     ++E   V +VVCEGTG+A+DI+    ++ +        + +D +A + ++F           D   L Q+      + + +K++ LITVFDI S E  D+D AIL +L++  +       +    QL L L W+RVDI K+ +F     L        + D+++  +V F++L +EN  ++  FLT N L+ELY T  K +    T L L+
Sbjct:   11 DDEDIQSQKPWIEVTFTKRECVYILPVSKDPHRCLPGCQICQQLVRCCCGRLVRQHAGFTASLATKYSDVKLGENPNPPMPELEEWSVEKHTEVSPTDAYGVINFQGG--SHSYRAKYVRLSYDSRPESVLRLMLKEWHMELPKILISVHGGVQNFELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSRSAKK------ICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLN--VLNNLHSHFLLVDDG-----TVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADILAYVHKQTEEGGGLPDGVETDIIATIKKTF------NFSHSDAIHLFQM------LMECMKSKELITVFDISSEEQQDIDVAILKALLQGTN-------SSPFDQLVLTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNT--KQSPNNPTLLHLV 511          

HSP 2 Score: 154.066 bits (388), Expect = 4.804e-37
Identity = 153/568 (26.94%), Postives = 273/568 (48.06%), Query Frame = 1
Query: 1834 ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYK---YHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNI---NFFSCILCIIFPFLI-----SKRTEFTK------DFKTCQSES---FPDFNED--------------------------NCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVY---FTWCNASTNYEVSNECPENN-FLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLH 3387
            E     +PF EL +WAVLM++QK + FFW   +E++  ALVA ++ +   Y  + S    D S+ L+ + N F  LAV L+E+    D+ +A  L+  + +NW   +CL+LA  S    F+++   Q  +   W    N+   +++  IL I+ P  I       + E         D +    +S   F + +ED                          + +  ++ K+  FY AP  KF  ++  ++ F++ ++YVVL  M +   T  E + ++Y+    ++K  E+F S + +I  +IK W++ +++N  D + IV   +   LR  LA           F   + +Y L +  +Y+++L +LA +++ GP + M++K++  +     I+L+ LLSYGV  +A  YP  + SW    +++  PY+ M+G       VY      C  ++   V   C     +L P L A Y+ +  IL++N+LIA  + +   +   S ++WK+  Y  I+ Y++KP+LP PF    ++Y +   C +K +  +    K F   +   KLH
Sbjct:  631 ETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPST-QEWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFS-DYFNVSDFLAIVTFFIGCGLR--LAGGDA-------FLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLARDVVFQPYWMMYG------EVYAYEIDVCANNSEDSVKPLCASAGVWLTPFLQAVYLFVQYILMVNLLIAFFNNVYMQVKSISNLVWKFQRYHFIMAYHEKPVLPPPFILLCHVYSLFCMC-RKRKKESTYGPKLFLTEEDQKKLH 1180          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064622.1 (SMESG000064622.1)

HSP 1 Score: 2150.17 bits (5570), Expect = 0.000e+0
Identity = 1122/1146 (97.91%), Postives = 1127/1146 (98.34%), Query Frame = 1
Query:  133 MIKRPSSKRTSQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR 3570
            MIKRPSSKRT+QNEDYTVTIRQARCKINES RESNVHFAENDEKMQYRNYINAKF+SVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNR ILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQ                +CILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFY+APQTKFCIHSFTFISFIIYFSYVVLYGMKRMQ+TIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVIIINILLLNILIATSSYICQDIH NSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR
Sbjct:    1 MIKRPSSKRTTQNEDYTVTIRQARCKINESYRESNVHFAENDEKMQYRNYINAKFQSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRKILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQ----------------NCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISSKLRRFYLAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQVTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVIIINILLLNILIATSSYICQDIHRNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIR 1130          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 1291.56 bits (3341), Expect = 0.000e+0
Identity = 684/1077 (63.51%), Postives = 836/1077 (77.62%), Query Frame = 1
Query:  133 MIKRPSSKRTSQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCS-ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTC---QSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSK 3351
            M K P  K++  N++++ +IRQAR KI +S R S++ F+ENDEK  YR ++ + F S+ECR FS   + +D  N+KC CGE KK+HK +K P+   + W E + ME++ T SFGKIEF GEDITN+KLTDFVRVSY DKLDDI++L+FNKW I  GTLCISVIGGTIDFKM  KEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVK RNILE AKGRTVHYNVSNEVE++QP+SLNK+HTHYIF DDGYRLQM++KKV YFRQALENKISQK G+R  IPVVLLIVEGGH++ +E SR                AS+I+GE F+E+     + +  RS   ++  E+++  LK KLIEQ+I ELHQVDE +KCIE+I+K E LIT+F IKSH+DLDFAIL+SLIKRMD LCD   NPLSSQLSLCL WNR+DIVKDKIF GDISLSN EW AF K+SI+ G++ FIELFLENVSN+ DFLT  IL +LY+T PKS NFRKTFL LIGR FSKGL++ KEL+ KMIG         ND   HPFQELFLW+VLMEK KCA+FFWGKCD++L LALVATRIYK  + TS+RDTDR  TL  WK  FENLAVKLIEECHDIDQE AAYLIEK+   + GI+CLELA+KS +LKFMSNIVCQ SI+FTWRAGF I+F+ CILCI+FPFLI  + ++TKD K     +++   D+ E        +KL+RFY+APQTKF IHS TF SF++YFSYVVLYGM+RM L+ HE +FM YLV++I +  +E+F+SRS  I+ R+KYWW FN+ NK+D III+ AI AM LRY LA   +  D ++++R SKTIYSLIVG  Y++ LRLL  HKKLGPK+ MM++++K+L+I+  II+IFL SYGVTSQAGYY QRDFSW AL+N+  YPYYTM GV+     VY +WC+ + N   S +CPE N ++PILFA +V+I NIL++NIL+AT+  +C++IH +SI IWKY+ YSL+LEY  KPI+P+PFS  ++IY +L     +  CYNL NSK
Sbjct:    1 MRKTPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGSR----------------ASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYRKALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLILMQNKYTKDLKPLKLHRAQECQDYIEVRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVIFSKYNVYLSWCDPAMNTTESKDCPEQNVVMPILFAAFVMISNILIMNILVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCGESECYNLKNSK 1061          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 1288.48 bits (3333), Expect = 0.000e+0
Identity = 684/1090 (62.75%), Postives = 839/1090 (76.97%), Query Frame = 1
Query:  133 MIKRPSSKRTSQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCS-ENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTC---QSESFPDFNEDNCRTSISSKLRRFYVAPQTKXXXXXXXXXXXXXXXXYVVLYGMKRMQLTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKXXXXXXXXXXXXXXLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHI 3390
            M K P  K++  N++++ +IRQAR KI +S R S++ F+ENDEK  YR ++ + F S+ECR FS   + +D  N+KC CGE KK+HK +K P+   + W E + ME++ T SFGKIEF GEDITN+KLTDFVRVSY DKLDDI++L+FNKW I  GTLCISVIGGTIDFKM  KEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVK RNILE AKGRTVHYNVSNEVE++QP+SLNK+HTHYIF DDGYRLQM++KKV YFRQALENKISQK G+R  IPVVLLIVEGGH++ +E SR                AS+I+GE F+E+     + +  RS   ++  E+++  LK KLIEQ+I ELHQVDE +KCIE+I+K E LIT+F IKSH+DLDFAIL+SLIKRMD LCD   NPLSSQLSLCL WNR+DIVKDKIF GDISLSN EW AF K+SI+ G++ FIELFLENVSN+ DFLT  IL +LY+T PKS NFRKTFL LIGR FSKGL++ KEL+ KMIG         ND   HPFQELFLW+VLMEK KCA+FFWGKCD++L LALVATRIYK  + TS+RDTDR  TL  WK  FENLAVKLIEECHDIDQE AAYLIEK+   + GI+CLELA+KS +LKFMSNIVCQ SI+FTWRAGF I+F+ CILCI+FPFLI  + ++TKD K     +++   D+ E        +KL+RFY+APQTKF IHS TF SF++YFSYVVLYGM+RM L+ HE +FM YLV++I +  +E+F+SRS  I+ R+KYWW FN+ NK+D III+ AI AM LRY LA   +  D ++++R SKTIYSLIVG  Y++ LRLL  HKKLGPK+ MM++++K+L+I+  II+IFL SYGVTSQAGYY QRDFSW AL+N+  YPYYTM GV+     VY +WC+ + N   S +CPE N ++PILFA +V+I NIL++NIL+AT+  +C++IH +SI IWKY+ YSL+LEY  KPI+P+PFS  ++IY +L     +  CYNL N  +    +    LH+
Sbjct:    1 MRKTPLKKQSFINDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGSR----------------ASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYRKALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLILMQNKYTKDLKPLKLHRAQECQDYIEVRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVIFSKYNVYLSWCDPAMNTTESKDCPEQNVVMPILFAAFVMISNILIMNILVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCGESECYNLKNKDEMMRYEQFPSLHM 1074          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 427/757 (56.41%), Postives = 547/757 (72.26%), Query Frame = 1
Query:  163 SQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSEND-SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISS---KLRRFYVAPQTK 2421
            SQNE +   + QAR ++ +  + SNV+F  NDEK   + +I  KF S++CR+F    KE+ +K +KC CGE+K  HK++KIPY     WS   C E +PT SFGKIEF GED+TN+KLT+FVR+S+ D LDD++ L+F+ W I  GTLCISV+GGT +FKM  KEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VKN+ ILE AKG  + Y VSNE+   +P+SLNKNHTHY+F D+  R   +  K   FR+ALE K+SQ+  ++  IPVVLL++EG +D+F EAS+R+KE V IV+C GTG+ASD++GEAFREMQ+     K +R DGV MLPE ++N LK+KLI++++S   +V+EA+  IE+II  E LIT+FD+K   DL+ AILYSLIKRMD   DS  N LSSQLSLCL WNRVDI KDKIFSG +SLS + WA FLK+SII GK +F+ELFL+N + + DFLT   L++LYE CP+S N ++T    +GR FS GL DVK+LL+K+ G+YE  C+  D  I HPFQELF+W+VLME  +CA +FW K +ESL LALVAT+IYK     S  DT R ETL  WK+YFENLA+KL+EECHD DQE AAY+IEK+N  WGG +CLE+A K+ D KF+S +VCQ S++FTWRAGFNIN F CILCI  PFLI +R+ F   +   +S+   D +     T+  +   KL +FY+APQTK
Sbjct:   13 SQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKY--PIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRS-FDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTK 766          

HSP 2 Score: 247.284 bits (630), Expect = 2.320e-66
Identity = 173/496 (34.88%), Postives = 269/496 (54.23%), Query Frame = 1
Query: 2683 LRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKEXXXXXXXXXXXXXXYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTVYFTWC-NASTNYEVSNECPENNFLIPILFAGYVXXXXXXXXXXXXATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVLAFCYQKGRCYNL-----SNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSIFKELENIQTK------------------------LNKIQIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLTSLNNNILVLQDEVNRIGQEVNIVSTENSPVVITDNNCMESNISSSQRVIESISLNHNASNILFVMXXXXXXXXXXXXXXXXXXXAKELRNVHEKFDNFRNQTLNSLNNIELMMRKL 4080
            LR+ L +     D V+++R SKTIYSLIVG FYL+ LRL++ HK LGPKI M+SK++ +L+ +  I+LI LL+YG+T Q  Y+PQRDFS   L NI+DYPY+ +FG + L   VY  WC + +TNY +SNECPE N+ +P+L A Y+ I  ILLLNIL A  +YI Q IH NSI IWK++M+SL++EY  KP+ P+PFS F +     AF +    C N       N K  +    +S++    P   K       + I  +S+++KL+KYFEN SQK V+K +  EK++ I+SG+SR+E R K++   +++I++K                        +++ +++N     E    NTN E               + SL +++   Q  V+      N+ S+   P +I D NC ++N S     +    L +  + ++ +                + E   E++N+ +K  +F++  + S   IE  ++ L
Sbjct:  784 LRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKMLYQLMFYIIIMLIILLAYGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLVYLPWCDDKTTNYNISNECPELNYFVPVLTAIYIFIAAILLLNILTAVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAH-----AFDFFYSLCGNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLA-IPLESEIDKLVKYFENNSQKCVVKELVEEKEQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYYPTLDISEFEVQNPTTFIEEDIINTNKE---------------IVSLIHDLRTGQLSVSAPSSNANVRSSFLIPRIIVDENC-DNNFSDPNSDLGGNKLKNWVTELINI----------------DSETVLEVQNLQKKLCDFQDHVVESFTKIESFLQSL 1241          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 427/757 (56.41%), Postives = 547/757 (72.26%), Query Frame = 1
Query:  163 SQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNYINAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDXXXXXXXXXXXXXXTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSEND-SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRAGFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISS---KLRRFYVAPQTK 2421
            SQNE +   + QAR ++ +  + SNV+F  NDEK   + +I  KF S++CR+F    KE+ +K +KC CGE+K  HK++KIPY     WS   C E +PT SFGKIEF GED+TN+KLT+FVR+S+ D LDD++ L+F+ W I  GTLCISV+GGT +FKM  KEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VKN+ ILE AKG  + Y VSNE+   +P+SLNKNHTHY+F D+  R   +  K   FR+ALE K+SQ+  ++  IPVVLL++EG +D+F EAS+R+KE V IV+C GTG+ASD++GEAFREMQ+     K +R DGV MLPE ++N LK+KLI++++S   +V+EA+  IE+II  E LIT+FD+K   DL+ AILYSLIKRMD   DS  N LSSQLSLCL WNRVDI KDKIFSG +SLS + WA FLK+SII GK +F+ELFL+N + + DFLT   L++LYE CP+S N ++T    +GR FS GL DVK+LL+K+ G+YE  C+  D  I HPFQELF+W+VLME  +CA +FW K +ESL LALVAT+IYK     S  DT R ETL  WK+YFENLA+KL+EECHD DQE AAY+IEK+N  WGG +CLE+A K+ D KF+S +VCQ S++FTWRAGFNIN F CILCI  PFLI +R+ F   +   +S+   D +     T+  +   KL +FY+APQTK
Sbjct:   13 SQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKY--PIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRS-FDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTK 766          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM12.275e-8127.07transient receptor potential cation channel subfam... [more]
TRPM17.655e-8126.99transient receptor potential cation channel subfam... [more]
TRPM14.696e-8027.28transient receptor potential cation channel subfam... [more]
TRPM15.465e-8027.15transient receptor potential cation channel subfam... [more]
TRPM32.296e-7326.65transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-27.458e-5425.09Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gon-27.860e-4527.44Transient receptor potential channel [Source:UniP... [more]
gon-28.248e-4527.44Transient receptor potential channel [Source:UniP... [more]
gon-21.124e-4427.60Transient receptor potential channel [Source:UniP... [more]
gtl-13.263e-4326.94GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm6.569e-8026.17gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm7.674e-7826.03gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm1.710e-7725.98gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm2.756e-7725.78gene:FBgn0265194 transcript:FBtr0339076[more]
Trpm5.731e-7725.94gene:FBgn0265194 transcript:FBtr0339079[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm26.542e-7725.98transient receptor potential cation channel, subfa... [more]
trpm51.328e-6525.24transient receptor potential cation channel, subfa... [more]
trpm53.081e-6525.21transient receptor potential cation channel, subfa... [more]
trpm53.442e-6525.21transient receptor potential cation channel, subfa... [more]
hrc9.338e-6524.71histidine rich calcium binding protein [Source:ZFI... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM17.633e-9228.77transient receptor potential cation channel subfam... [more]
TRPM61.337e-8727.28transient receptor potential cation channel, subfa... [more]
TRPM11.034e-8429.44transient receptor potential cation channel subfam... [more]
ENSXETT00000055613.15.133e-8425.91transient receptor potential cation channel subfam... [more]
aldh3a23.890e-8227.50aldehyde dehydrogenase 3 family member A2 [Source:... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm37.731e-8327.56transient receptor potential cation channel, subfa... [more]
Trpm31.416e-8227.56transient receptor potential cation channel, subfa... [more]
Trpm32.769e-7927.40transient receptor potential cation channel, subfa... [more]
Trpm37.378e-7926.44transient receptor potential cation channel, subfa... [more]
Trpm22.090e-6625.70transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0R4IMY7|TRPM2_DANRE4.939e-7625.98Transient receptor potential cation channel subfam... [more]
sp|A7T1N0|TMP2L_NEMVE1.154e-7125.99Transient receptor potential cation channel subfam... [more]
sp|E9PTA2|TRPM2_RAT1.287e-6625.38Transient receptor potential cation channel subfam... [more]
sp|Q91YD4|TRPM2_MOUSE1.462e-6525.70Transient receptor potential cation channel subfam... [more]
sp|O94759|TRPM2_HUMAN1.805e-6326.85Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FX171.332e-16534.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1J73.008e-16534.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FD755.413e-16534.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4E0RDV51.307e-15634.24Transient receptor potential cation channel subfam... [more]
G4VFC62.442e-15634.23Putative transient receptor potential cation chann... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm51.029e-6224.22transient receptor potential cation channel subfam... [more]
hrc9.546e-5625.14transient receptor potential cation channel subfam... [more]
trpm71.591e-5531.93transient receptor potential cation channel subfam... [more]
trpm71.837e-5531.93transient receptor potential cation channel subfam... [more]
trpm72.568e-5532.54transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm71.097e-7627.84transient receptor potential cation channel, subfa... [more]
trpm71.927e-7227.01transient receptor potential cation channel, subfa... [more]
trpm22.476e-3424.28transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301354.729e-7325.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476586.675e-3930.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm24.683e-7026.91transient receptor potential cation channel subfam... [more]
trpm26.223e-7026.91transient receptor potential cation channel subfam... [more]
trpm31.192e-6629.73transient receptor potential cation channel subfam... [more]
trpm59.174e-5625.00transient receptor potential cation channel subfam... [more]
trpm74.969e-5330.73transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064622.10.000e+097.91SMESG000064622.1[more]
SMESG000064632.10.000e+063.51SMESG000064632.1[more]
SMESG000064632.10.000e+062.75SMESG000064632.1[more]
SMESG000064637.12.320e-6656.41SMESG000064637.1[more]
SMESG000064637.10.000e+056.41SMESG000064637.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002539 ID=SMED30002539|Name=Transient receptor potential cation channel subfamily M member 6|organism=Schmidtea mediterranea sexual|type=transcript|length=4112bp
TAAAGAATTGAATTTCAACATCTGTATTTATTTAATTATCTAATTAAATA
CGAAACTGGACATTTTTTATTAAAATTTCAAATAATTTTATGATAAATTT
GTGAGGATTGAGTACTAATTTATTTATGTAAAATGATCAAGAGACCATCT
AGTAAACGAACATCACAAAATGAAGATTACACAGTAACTATAAGACAGGC
AAGATGCAAAATAAATGAGAGCTGTCGAGAAAGCAATGTTCACTTTGCAG
AAAATGATGAGAAAATGCAATACCGAAACTATATAAATGCCAAATTTAAA
TCAGTTGAATGCAGATATTTCTCTGTTGCGATAAAAGAAATTGACGATAA
AAATTCAAAGTGCAGTTGCGGTGAAATCAAAAAATCGCATAAAGAAAATA
AAATTCCTTATGGTCCACGTGAATCATGGTCAGAAGGCGATTGTATGGAA
ATGCTGCCCACATATTCCTTTGGGAAAATCGAATTCACAGGGGAAGATAT
AACTAATAGTAAATTGACAGATTTTGTTCGAGTGAGTTATAGAGATAAAC
TAGATGATATAGTGGATTTAATATTCAACAAGTGGAAGATCACAGCCGGA
ACTCTATGCATCTCTGTCATTGGGGGAACAATAGACTTCAAAATGCATCA
TAAAGAAAAAAATATATTTTGTCAGGGTTTAATTAAAGCTGCAATTACTA
CAAATGCCTTGATTATTACTCCTGGGTTAAATAAAGGCATTACAAGTGTT
ATTGGGGATGCCATTCAATACAGCCAGTCTTACCTCTATGATAAAATGAA
GCACAACAATTTCATTTCTTGTCTTGGAATTGCGCCTTGGGGTTATGTTA
AAAATCGAAACATTTTGGAATTTGCAAAGGGGAGAACTGTTCACTATAAT
GTTTCAAATGAAGTCGAAAAACATCAACCGATTTCTCTTAATAAAAATCA
TACTCATTATATATTTTTTGATGATGGTTATCGGCTTCAAATGACTAAGA
AAAAAGTGGGATATTTTCGACAAGCTCTTGAAAATAAGATAAGTCAAAAA
CAAGGGGATAGAGTAGGCATACCAGTGGTGTTACTTATTGTAGAGGGAGG
CCATGATATTTTTATAGAAGCTAGCAGACGAGTGAAGGAAAAAGTTTCAA
TTGTTGTGTGTGAAGGAACAGGTAAAGCTTCTGATATTATTGGTGAAGCT
TTTCGTGAGATGCAAAGAATCTGTTCTAGACATAAAATGATTCGATCTGA
CGGCGTGGCAATGCTCCCTGAAAGTTTTAAAAACGTTTTAAAAAGAAAAC
TCATTGAGCAGGATATTTCTGAGCTACATCAAGTTGATGAAGCCATTAAA
TGCATTGAAGATATTATCAAAAATGAATTACTTATTACGGTTTTTGATAT
AAAATCGCATGAAGATTTAGATTTTGCAATTCTGTATTCTCTTATCAAAC
GGATGGACCTTTTGTGTGATTCTAATCAAAATCCATTGTCTAGCCAATTA
TCTCTTTGTCTCACTTGGAATAGAGTTGATATTGTGAAAGATAAAATTTT
CTCAGGAGACATCTCCTTGTCAAATGATGAATGGGCGGCTTTTCTGAAAG
ATTCAATAATCACTGGAAAAGTGAAATTTATTGAATTGTTTTTGGAAAAC
GTTTCCAATATCCAAGATTTTCTAACCGCTAATATTTTGAAAGAGTTATA
TGAAACTTGCCCAAAATCTACAAATTTTCGGAAAACCTTTTTGCGATTAA
TTGGTCGGCCATTTTCAAAGGGATTAAATGATGTCAAAGAATTGCTTTCG
AAAATGATTGGATTTTATGAATATCCTTGCTCTGAAAACGATAGTATAAA
GCATCCATTTCAGGAATTATTTTTATGGGCTGTTCTGATGGAAAAACAAA
AGTGTGCCAAATTCTTTTGGGGAAAATGTGACGAATCTCTATTTCTTGCA
TTAGTAGCAACAAGAATCTACAAATATCACCAGAGGACATCTCTCCGAGA
TACTGATAGAAGCGAGACTTTGGAAACCTGGAAAAATTATTTCGAAAATC
TAGCCGTGAAACTCATTGAAGAGTGTCATGATATTGATCAAGAAGTTGCA
GCTTATTTAATTGAGAAAAAGAATGAAAACTGGGGTGGGATTAGCTGCTT
GGAGTTAGCCAGCAAATCGACAGATCTGAAATTTATGAGCAATATTGTAT
GTCAGAAGTCTATAGAATTCACATGGAGAGCGGGATTTAATATCAACTTT
TTTAGTTGTATTCTTTGTATAATATTTCCCTTTTTGATTTCCAAACGAAC
GGAGTTCACCAAAGACTTCAAAACTTGCCAATCTGAATCATTTCCAGATT
TCAATGAAGACAACTGCCGCACTTCGATTTCTTCGAAGTTGCGAAGGTTT
TATGTAGCTCCTCAAACGAAGTTCTGTATCCATAGTTTTACATTTATTTC
ATTTATCATTTATTTTTCCTACGTTGTTTTATACGGAATGAAACGAATGC
AGCTAACAATTCATGAAATAATGTTTATGATTTATCTGGTTCTGATGATT
TTGGATAAATTTGTCGAGATATTCAAGTCAAGATCCGATAGAATTTATGG
TCGCATAAAGTATTGGTGGACCTTTAATCACTGGAACAAGGTTGATATGA
TTATTATAGTTTTTGCAATAGTGGCGATGGTATTGCGATACCAACTGGCC
ATCAATGGTGTCTACACAGACAAAGTTGTTATGTTTCGCTGGTCAAAAAC
CATATATAGTCTAATAGTCGGATCGTTTTACTTGAAAATTTTGCGGCTAC
TGGCATGTCACAAAAAATTGGGTCCGAAAATTTTTATGATGTCAAAAATT
ATTAAAGAGCTTCTGATATTTTCAACGATCATATTAATCTTTCTTTTGTC
ATATGGCGTTACAAGTCAGGCTGGATATTATCCACAAAGAGATTTTTCAT
GGATTGCACTATCAAATATTTTAGATTACCCTTACTATACGATGTTCGGG
GTTTTAAATTTGGGGAACACTGTCTATTTCACTTGGTGCAACGCCAGTAC
AAATTACGAGGTATCTAATGAATGTCCTGAGAATAATTTTTTAATTCCAA
TCTTATTTGCGGGATATGTGATAATTATCAACATTTTATTATTGAATATT
CTTATAGCCACCTCCAGTTACATTTGTCAAGATATTCATGGAAATTCAAT
TGTCATATGGAAATACAGCATGTATTCTTTGATTCTTGAATATAATGATA
AACCGATTCTACCAATGCCATTTTCAACATTTGTTTACATATACCAAGTT
CTTGCATTTTGTTACCAGAAGGGTCGATGCTACAATCTCAGCAATAGTAA
AAAATTCGAAATTACCAAACACAATTCAAAATTGCACATTGACAAGCCAA
TGGCATTCAAGCACGATACACTGAACATATTTTCCAACATTAAAAGCGAT
TCTGATTTAAACAAACTTATCAAATATTTCGAAAATTATTCTCAGAAATT
TGTAATCAAAAACATTGCAATTGAAAAACAAAAGTCAATCAAGTCCGGAA
TTTCTCGAATGGAAATTAGATCAAAATCAATTTTCAAAGAATTAGAAAAT
ATTCAAACAAAATTGAATAAAATCCAAATTAAAAATGTGAAAAAGGTTCA
GGAAGGCTCATTTACAAATACAAATGGTGAATATCAGAATATAACTAAAC
AACCTAAAGACTCCATGGCATTGCTTTTGACAAGCCTCAACAACAACATT
TTGGTGTTACAAGATGAAGTCAACAGAATTGGACAAGAAGTGAACATTGT
GTCCACAGAAAACTCACCAGTTGTCATAACTGATAATAATTGCATGGAAT
CAAACATATCCAGCAGTCAAAGAGTCATTGAAAGTATTTCTTTGAATCAC
AACGCATCGAATATTTTATTTGTTATGAATGAGAATGAAAAAGAAAATAT
TATCAATGAATTCAAAAGGAAAAATATTGAAAATGCCAAAGAATTGAGAA
ATGTCCATGAAAAATTTGATAACTTCAGAAATCAAACGCTAAACTCTCTA
AATAATATTGAGTTGATGATGAGAAAACTATGAATTAGGATGACTAAAAT
AAATTAAATGAC
back to top

protein sequence of SMED30002539-orf-1

>SMED30002539-orf-1 ID=SMED30002539-orf-1|Name=SMED30002539-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1317bp
MIKRPSSKRTSQNEDYTVTIRQARCKINESCRESNVHFAENDEKMQYRNY
INAKFKSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWS
EGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNK
WKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLN
KGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRNILEFAKG
RTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALE
NKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKAS
DIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQ
VDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQN
PLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFI
ELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLND
VKELLSKMIGFYEYPCSENDSIKHPFQELFLWAVLMEKQKCAKFFWGKCD
ESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHD
IDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQKSIEFTWRA
GFNINFFSCILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSIS
SKLRRFYVAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQLTIHEIMFMI
YLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMV
LRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKI
FMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYP
YYTMFGVLNLGNTVYFTWCNASTNYEVSNECPENNFLIPILFAGYVIIIN
ILLLNILIATSSYICQDIHGNSIVIWKYSMYSLILEYNDKPILPMPFSTF
VYIYQVLAFCYQKGRCYNLSNSKKFEITKHNSKLHIDKPMAFKHDTLNIF
SNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRSKSI
FKELENIQTKLNKIQIKNVKKVQEGSFTNTNGEYQNITKQPKDSMALLLT
SLNNNILVLQDEVNRIGQEVNIVSTENSPVVITDNNCMESNISSSQRVIE
SISLNHNASNILFVMNENEKENIINEFKRKNIENAKELRNVHEKFDNFRN
QTLNSLNNIELMMRKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1199..1219
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 48..1193
NoneNo IPR availableTMHMMTMhelixcoord: 986..1008
NoneNo IPR availableTMHMMTMhelixcoord: 791..813
NoneNo IPR availableTMHMMTMhelixcoord: 873..890
NoneNo IPR availableTMHMMTMhelixcoord: 952..974
NoneNo IPR availableTMHMMTMhelixcoord: 910..932
NoneNo IPR availableTMHMMTMhelixcoord: 1042..1061
NoneNo IPR availableTMHMMTMhelixcoord: 764..786
NoneNo IPR availableTMHMMTMhelixcoord: 698..720
NoneNo IPR availableTMHMMTMhelixcoord: 834..853
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 130..383
e-value: 6.3E-56
score: 189.7