Y box protein-1

Overview
NameY box protein-1
Smed IDSMED30002537
Length (bp)715
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Y box protein-1 (SMED30002537) t-SNE clustered cells

Violin plots show distribution of expression levels for Y box protein-1 (SMED30002537) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Y box protein-1 (SMED30002537) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Y box protein-1 (SMED30002537) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002537

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002537SMESG000058013.1 SmedASXL_009658SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002537SMESG000058013.1 SmedASXL_009658SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002537SMESG000058013.1 dd_Smed_v4_35_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002537SMESG000058043.1 SMED30004532smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30002537SMESG000058043.1 SMED30004532smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30002537SMESG000058043.1 SMESG000058013.1 dd_Smed_v6_35_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002537SMESG000058043.1 SMESG000058013.1 dd_Smed_v6_35_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002537SMESG000058039.1 SMED_04459_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002537SMESG000058039.1 SMED_04459_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 75.0998 bits (183), Expect = 3.881e-15
Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  113 QVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            QV+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   93 QVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVT 161          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 75.0998 bits (183), Expect = 3.881e-15
Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  113 QVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            QV+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   93 QVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVT 161          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX1 (Y-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:8014])

HSP 1 Score: 73.9442 bits (180), Expect = 6.682e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   57 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 126          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 72.4034 bits (176), Expect = 1.903e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   89 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 158          
BLAST of Y box protein-1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 72.7886 bits (177), Expect = 2.748e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   89 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 158          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-1 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62213])

HSP 1 Score: 72.4034 bits (176), Expect = 2.605e-15
Identity = 41/74 (55.41%), Postives = 50/74 (67.57%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            ++V G VKWFN KNGYGFI+    R D  +D+FVH  +I   N      SL D EEV+FDIVEG+KGLEA +VT
Sbjct:   19 TKVKGTVKWFNVKNGYGFIN----RTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVT 88          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-2 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91306])

HSP 1 Score: 62.003 bits (149), Expect = 3.099e-11
Identity = 36/71 (50.70%), Postives = 43/71 (60.56%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNAT-----SLADGEEVLFDIVEGAKGLEARNVT 313
            G VKW++    YGFIS    RND  KD+FVH  +IA +        +L D EEVLFD+VEG  G EA NVT
Sbjct:   68 GKVKWYSVLRRYGFIS----RNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVT 134          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 61.6178 bits (148), Expect = 4.727e-11
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 2
Query:  107 QSQVIGHVKWFNSKNGYGFISVDNERND-KDVFVHFKSIAATNAT-----SLADGEEVLFDIVEGAKGLEARNVT 313
            ++ V GHVKWF+ +  YGF++ D   ++ +D FVH  +I  ++       +L D E V+FDIVEG KG EA NVT
Sbjct:   86 ETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVT 160          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 61.6178 bits (148), Expect = 4.727e-11
Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 2
Query:  107 QSQVIGHVKWFNSKNGYGFISVDNERND-KDVFVHFKSIAATNAT-----SLADGEEVLFDIVEGAKGLEARNVT 313
            ++ V GHVKWF+ +  YGF++ D   ++ +D FVH  +I  ++       +L D E V+FDIVEG KG EA NVT
Sbjct:   86 ETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVT 160          
BLAST of Y box protein-1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 59.6918 bits (143), Expect = 1.989e-10
Identity = 33/69 (47.83%), Postives = 44/69 (63.77%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNAT-----SLADGEEVLFDIVEGAKGLEARNVT 313
            G VKW++    YGFIS  +   +KDVFVH  +I+ ++       +LAD EEVLFD+V+G  G EA NVT
Sbjct:   66 GKVKWYSVLRRYGFISRSD--GEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVT 132          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0076027)

HSP 1 Score: 67.3958 bits (163), Expect = 7.314e-13
Identity = 38/72 (52.78%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            ++V G VKWFN K+GYGFI+ ++ R  +DVFVH  +IA  N      S+ DGE V FD+V G KG EA NVT
Sbjct:   60 TKVTGTVKWFNVKSGYGFINRNDTR--EDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVT 129          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0305992)

HSP 1 Score: 67.3958 bits (163), Expect = 8.008e-13
Identity = 38/72 (52.78%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            ++V G VKWFN K+GYGFI+ ++ R  +DVFVH  +IA  N      S+ DGE V FD+V G KG EA NVT
Sbjct:   60 TKVTGTVKWFNVKSGYGFINRNDTR--EDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVT 129          
BLAST of Y box protein-1 vs. Ensembl Fly
Match: lin-28 (gene:FBgn0035626 transcript:FBtr0077090)

HSP 1 Score: 50.0618 bits (118), Expect = 2.577e-7
Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 2
Query:  119 IGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            +G  KWFN   G+GF++ ++    ++VFVH   I  +   SL + EEV F+    ++GLEA  V+
Sbjct:   40 LGKCKWFNVAKGWGFLTPND--GGQEVFVHQSVIQMSGFRSLGEQEEVEFECQRTSRGLEATRVS 102          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 73.9442 bits (180), Expect = 3.685e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   37 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 106          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 73.9442 bits (180), Expect = 3.685e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   37 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 106          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 73.9442 bits (180), Expect = 4.861e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   37 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 106          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: lin28b (lin-28 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-140811-1])

HSP 1 Score: 54.299 bits (129), Expect = 1.530e-8
Identity = 27/69 (39.13%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            G+ KWFN + G+GFIS+ +          DVFVH   +      SL +GE+V F     +KGLE+  VT
Sbjct:   23 GYCKWFNVRMGFGFISMTSSEGKPVDPPLDVFVHQSKLVMEGFRSLREGEQVEFTFKRSSKGLESLRVT 91          
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Match: LIN28A (si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-110914-157])

HSP 1 Score: 49.6766 bits (117), Expect = 4.546e-7
Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 2
Query:  119 IGHVKWFNSKNGYGFISVDNE-----RNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            +G  KWFN + G+GF+S++           DVFVH   +      SL +GE V F   + +KGLE+  VT
Sbjct:   25 VGVCKWFNVRMGFGFLSMNTRDGVPLETPVDVFVHQSKLHMEGFRSLKEGESVEFTFKKSSKGLESVRVT 94          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 73.9442 bits (180), Expect = 5.878e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   35 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 104          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 73.1738 bits (178), Expect = 1.215e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   43 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 112          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:NCBI gene;Acc:548572])

HSP 1 Score: 67.781 bits (164), Expect = 4.590e-13
Identity = 39/74 (52.70%), Postives = 47/74 (63.51%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+V G KG EA NVT
Sbjct:   34 TKVQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVT 103          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 55.4546 bits (132), Expect = 1.381e-8
Identity = 28/69 (40.58%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNER-----NDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            GH KWFN + G+GFIS+ +       N  DVFVH   +      SL +GE V F   + +KG E+  VT
Sbjct:   59 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVT 127          
BLAST of Y box protein-1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 55.0694 bits (131), Expect = 1.508e-8
Identity = 28/69 (40.58%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNER-----NDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            GH KWFN + G+GFIS+ +       N  DVFVH   +      SL +GE V F   + +KG E+  VT
Sbjct:   35 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEGFRSLKEGEPVEFTFKKSSKGFESLRVT 103          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 75.485 bits (184), Expect = 1.829e-15
Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  113 QVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            QV+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   94 QVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVT 162          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 74.7146 bits (182), Expect = 1.973e-15
Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  113 QVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            QV+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   17 QVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVT 85          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx1 (Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146])

HSP 1 Score: 74.3294 bits (181), Expect = 4.177e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   55 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 124          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 73.1738 bits (178), Expect = 7.956e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   81 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 150          
BLAST of Y box protein-1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 73.1738 bits (178), Expect = 1.370e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   81 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 150          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|Q9Y2T7|YBOX2_HUMAN (Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.864e-14
Identity = 41/73 (56.16%), Postives = 48/73 (65.75%), Query Frame = 2
Query:  113 QVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            QV+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   93 QVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVT 161          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P21573|YBOX1_XENLA (Y-box-binding protein 1 OS=Xenopus laevis OX=8355 GN=ybx1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.368e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   35 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 104          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P21574|YBX2A_XENLA (Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 2.713e-14
Identity = 41/74 (55.41%), Postives = 48/74 (64.86%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            +QV G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   40 TQVQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVT 109          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|B5DE31|YBOX1_DANRE (Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   37 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 106          
BLAST of Y box protein-1 vs. UniProt/SwissProt
Match: sp|P62961|YBOX1_RAT (Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 2.922e-14
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   55 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 124          
BLAST of Y box protein-1 vs. TrEMBL
Match: I1ZIB0 (Y box protein-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.898e-33
Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTXXXXXXXXXXAQH---DHSNNRGGDRDNSR 394
            M  SQV GHVKWF+SKNGYGFISVD++ N KD+FVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGP+GGDV+GG  +   D SNNR GDRDN R
Sbjct:   18 MTASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR-GDRDNYR 117          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A565DLG5 (Cold shock protein (Fragment) OS=Echiniscoides sigismundi OX=500494 GN=CSP PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.955e-14
Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 2
Query:  107 QSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAA----TNATSLADGEEVLFDIVEGAKGLEARNVT 313
            ++QV G VKWFN++ G+GFI  D   N  D+FVH  +I A    T   +LADGE+V FD+V+G KGLEA NVT
Sbjct:   12 ETQVNGSVKWFNAQKGFGFIVRDGSDNGDDIFVHHSAIKAVDPNTTYRTLADGEQVTFDVVQGNKGLEAANVT 84          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A3N5Z465 (Cold-shock protein OS=Alteromonas sp. U0105 OX=2259342 GN=DRW07_17875 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.652e-14
Identity = 36/67 (53.73%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNV 310
            S+V G VKWFN++ GYGF++ DN   +KDVFVHF++I A    +L +G+ V F+I EG KGL+A NV
Sbjct:    2 SKVTGTVKWFNAEKGYGFLTQDN--GEKDVFVHFRAIVAEGYKTLLEGQRVEFEIEEGQKGLQAANV 66          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A4Q7PML7 (Putative cold-shock DNA-binding protein OS=Cuneatibacter caecimuris OX=1796618 GN=EV209_0277 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.063e-14
Identity = 38/64 (59.38%), Postives = 46/64 (71.88%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            G VKWFNS+ G+GFI+  N    +DVFVHF  IA+    SL DG+EV+FDI EG KGL+A NVT
Sbjct:    4 GTVKWFNSQKGFGFIT--NAATGEDVFVHFSGIASDGFKSLEDGQEVVFDIAEGNKGLQAVNVT 65          
BLAST of Y box protein-1 vs. TrEMBL
Match: A0A3D8M3N3 (Cold-shock protein OS=Alteromonas aestuariivivens OX=1938339 GN=DXV75_15155 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.009e-14
Identity = 35/68 (51.47%), Postives = 50/68 (73.53%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            S+V G VKWFN+  GYGF++ D+   DKDVFVHF++I +    +LA+G+ V F++ +G KGL+A NVT
Sbjct:    2 SKVTGTVKWFNADKGYGFLTQDS--GDKDVFVHFRAIVSEGYKTLAEGQRVEFEVEQGQKGLQAANVT 67          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:103040011])

HSP 1 Score: 73.559 bits (179), Expect = 5.245e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   38 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 107          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 67.781 bits (164), Expect = 5.828e-13
Identity = 39/72 (54.17%), Postives = 45/72 (62.50%), Query Frame = 2
Query:  116 VIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            V G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VE  KG EA NVT
Sbjct:   31 VQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVT 98          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 66.2402 bits (160), Expect = 1.650e-12
Identity = 39/72 (54.17%), Postives = 45/72 (62.50%), Query Frame = 2
Query:  116 VIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            V G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VE  KG EA NVT
Sbjct:   24 VQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVT 91          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: lin28b (protein lin-28 homolog B-like [Source:NCBI gene;Acc:103047343])

HSP 1 Score: 54.299 bits (129), Expect = 1.383e-8
Identity = 27/69 (39.13%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            G+ KWFN + G+GFIS+ +   +      DVFVH   +      SL +GE+V F     +KGLE+  VT
Sbjct:   29 GYCKWFNVRMGFGFISMTHSEGNPVEPPLDVFVHQSKLVMEGFRSLREGEQVEFTFKRSSKGLESLRVT 97          
BLAST of Y box protein-1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 53.9138 bits (128), Expect = 2.495e-8
Identity = 28/69 (40.58%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            GH KWFN + G+GFIS+ +   +      DVFVH   +      SL +GE V F   + +KGLE   VT
Sbjct:   39 GHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSSKGLECVRVT 107          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO41469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S475])

HSP 1 Score: 73.9442 bits (180), Expect = 2.644e-17
Identity = 40/75 (53.33%), Postives = 51/75 (68.00%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            +A ++V G VKWFN KNGYGFI+ D+  N +D+FVH  +IA  N      S+ DGE V F++V G KGLEA NVT
Sbjct:    3 IAATKVTGTVKWFNVKNGYGFINRDD--NKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVT 75          
BLAST of Y box protein-1 vs. Ensembl Nematostella
Match: EDO44703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV03])

HSP 1 Score: 48.1358 bits (113), Expect = 1.372e-6
Identity = 29/64 (45.31%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  122 GHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            G VKWFN   G+GFI+ D+    +DVFVH  +I A+   SL +GE V   I    KG  A  VT
Sbjct:  485 GSVKWFNLIKGFGFITRDD--GGEDVFVHQSAIKASGYRSLEEGEHVQLTISNSDKGKVAICVT 546          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:100049221])

HSP 1 Score: 73.1738 bits (178), Expect = 6.273e-15
Identity = 40/74 (54.05%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  110 SQVIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNA----TSLADGEEVLFDIVEGAKGLEARNVT 313
            ++V+G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD+VEG KG EA NVT
Sbjct:   39 TKVLGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVT 108          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007880.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 69.707 bits (169), Expect = 1.672e-13
Identity = 39/72 (54.17%), Postives = 46/72 (63.89%), Query Frame = 2
Query:  116 VIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            V G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD++E AKG EA NVT
Sbjct:  112 VQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVT 179          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: ENSORLT00000007875.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 69.3218 bits (168), Expect = 2.260e-13
Identity = 39/72 (54.17%), Postives = 46/72 (63.89%), Query Frame = 2
Query:  116 VIGHVKWFNSKNGYGFISVDNERND--KDVFVHFKSIAATNAT----SLADGEEVLFDIVEGAKGLEARNVT 313
            V G VKWFN +NGYGFI+    RND  +DVFVH  +I   N      S+ DGE V FD++E AKG EA NVT
Sbjct:  112 VQGTVKWFNVRNGYGFIN----RNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVT 179          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 54.6842 bits (130), Expect = 9.823e-9
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  107 QSQVI---GHVKWFNSKNGYGFISVDNERNDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            + QV+   G  KWFN + G+GFIS+ N          DVFVH   +      SL +GE+V F   + +KGLE+  VT
Sbjct:   27 RPQVLSGSGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVT 103          
BLAST of Y box protein-1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 54.6842 bits (130), Expect = 1.102e-8
Identity = 30/77 (38.96%), Postives = 41/77 (53.25%), Query Frame = 2
Query:  107 QSQVI---GHVKWFNSKNGYGFISVDNERNDK-----DVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            + QV+   G  KWFN + G+GFIS+ N          DVFVH   +      SL +GE+V F   + +KGLE+  VT
Sbjct:   34 RPQVLSGSGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEGFRSLKEGEQVEFTYKKSSKGLESLRVT 110          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058013.1 (SMESG000058013.1)

HSP 1 Score: 177.178 bits (448), Expect = 7.524e-57
Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTXXXXXXXXXXAQHDHSNNRGGDRDNSRS 397
            MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPDGGDVVGGAQHDHSNNRGGDRDNSRS
Sbjct:    1 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPDGGDVVGGAQHDHSNNRGGDRDNSRS 99          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058039.1 (SMESG000058039.1)

HSP 1 Score: 158.688 bits (400), Expect = 2.073e-49
Identity = 92/103 (89.32%), Postives = 95/103 (92.23%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTXXXXXXXXXXAQH----DHSNNRGGDRDNSRS 397
            MAQSQV GHVKWFNSKNGYGFISVDNER DKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGP+GGDVVGGAQ+    D  NNRGGDRDN+RS
Sbjct:    1 MAQSQVTGHVKWFNSKNGYGFISVDNERCDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAQYEQNNDRFNNRGGDRDNNRS 103          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058043.1 (SMESG000058043.1)

HSP 1 Score: 152.91 bits (385), Expect = 3.842e-47
Identity = 88/103 (85.44%), Postives = 94/103 (91.26%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTXXXXXXXXXXAQH----DHSNNRGGDRDNSRS 397
            MAQSQV+GHVKWFNSKNGYGFISVDN+ +DKD+FVHFKSIAA NATSLADGEEVLFDIVEGAKGLEARNVTGP+GGDVVGGA +    D  NNRGGDRDNSRS
Sbjct:    1 MAQSQVVGHVKWFNSKNGYGFISVDNDNSDKDIFVHFKSIAAGNATSLADGEEVLFDIVEGAKGLEARNVTGPNGGDVVGGAPYEQNNDRFNNRGGDRDNSRS 103          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000058066.1 (SMESG000058066.1)

HSP 1 Score: 127.102 bits (318), Expect = 1.438e-36
Identity = 76/101 (75.25%), Postives = 84/101 (83.17%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVTXXXXXXXXXXAQH---DHSNNRGGDRDNSR 394
            M  SQV GHVKWF+SKNGYGFISVD++ N KD+FVH  SI A NATSLADGEEVLFDIV+GAKGLEARNVTGP+GGDV+GG  +   D SNNR GDRDN R
Sbjct:    1 MTASQVTGHVKWFSSKNGYGFISVDDDNNSKDIFVHHSSITANNATSLADGEEVLFDIVQGAKGLEARNVTGPNGGDVIGGKPYEPSDRSNNR-GDRDNYR 100          
BLAST of Y box protein-1 vs. Planmine SMEST
Match: SMESG000078868.1 (SMESG000078868.1)

HSP 1 Score: 100.908 bits (250), Expect = 9.740e-27
Identity = 49/71 (69.01%), Postives = 59/71 (83.10%), Query Frame = 2
Query:  101 MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLADGEEVLFDIVEGAKGLEARNVT 313
            + +++V GHVKWFNSK+GYGFI  + +R D DVFVH  SI ATNA SLADGEEV FD+V+G+KGLEARNVT
Sbjct:    4 IIETKVNGHVKWFNSKSGYGFIRRE-DRKDSDVFVHHSSIVATNANSLADGEEVQFDVVQGSKGLEARNVT 73          
The following BLAST results are available for this feature:
BLAST of Y box protein-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YBX23.881e-1556.16Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX23.881e-1556.16Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX16.682e-1554.05Y-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
YBX31.903e-1454.05Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX32.748e-1454.05Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cey-12.605e-1555.41C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62... [more]
cey-23.099e-1150.70C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-44.727e-1144.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-44.727e-1144.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-31.989e-1047.83C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
yps7.314e-1352.78gene:FBgn0022959 transcript:FBtr0076027[more]
yps8.008e-1352.78gene:FBgn0022959 transcript:FBtr0305992[more]
lin-282.577e-736.92gene:FBgn0035626 transcript:FBtr0077090[more]
back to top
BLAST of Y box protein-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx13.685e-1554.05Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx13.685e-1554.05Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx14.861e-1554.05Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
lin28b1.530e-839.13lin-28 homolog B (C. elegans) [Source:ZFIN;Acc:ZDB... [more]
LIN28A4.546e-737.14si:ch1073-284b18.2 [Source:ZFIN;Acc:ZDB-GENE-11091... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcs15.878e-1554.053-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
hmgcs11.215e-1454.053-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
ybx34.590e-1352.70Y-box binding protein 3 [Source:NCBI gene;Acc:5485... [more]
lin28b1.381e-840.58lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
lin28b1.508e-840.58lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
back to top
BLAST of Y box protein-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ybx21.829e-1556.16Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx21.973e-1556.16Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx14.177e-1554.05Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146][more]
Ybx37.956e-1554.05Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx31.370e-1454.05Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
back to top
BLAST of Y box protein-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2T7|YBOX2_HUMAN1.864e-1456.16Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN... [more]
sp|P21573|YBOX1_XENLA2.368e-1454.05Y-box-binding protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|P21574|YBX2A_XENLA2.713e-1455.41Y-box-binding protein 2-A OS=Xenopus laevis OX=835... [more]
sp|B5DE31|YBOX1_DANRE2.782e-1454.05Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=... [more]
sp|P62961|YBOX1_RAT2.922e-1454.05Y-box-binding protein 1 OS=Rattus norvegicus OX=10... [more]
back to top
BLAST of Y box protein-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIB08.898e-3375.25Y box protein-1 (Fragment) OS=Schmidtea mediterran... [more]
A0A565DLG51.955e-1453.42Cold shock protein (Fragment) OS=Echiniscoides sig... [more]
A0A3N5Z4653.652e-1453.73Cold-shock protein OS=Alteromonas sp. U0105 OX=225... [more]
A0A4Q7PML74.063e-1459.38Putative cold-shock DNA-binding protein OS=Cuneati... [more]
A0A3D8M3N35.009e-1451.47Cold-shock protein OS=Alteromonas aestuariivivens ... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx15.245e-1554.05Y-box binding protein 1 [Source:NCBI gene;Acc:1030... [more]
YBX25.828e-1354.17Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
YBX21.650e-1254.17Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
lin28b1.383e-839.13protein lin-28 homolog B-like [Source:NCBI gene;Ac... [more]
LIN28B2.495e-840.58protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box protein-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO414692.644e-1753.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447031.372e-645.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Y box protein-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx16.273e-1554.05Y-box binding protein 1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007880.21.672e-1354.17Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007875.22.260e-1354.17Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
lin28b9.823e-938.96lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
lin28b1.102e-838.96lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
back to top
BLAST of Y box protein-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058013.17.524e-57100.00SMESG000058013.1[more]
SMESG000058039.12.073e-4989.32SMESG000058039.1[more]
SMESG000058043.13.842e-4785.44SMESG000058043.1[more]
SMESG000058066.11.438e-3675.25SMESG000058066.1[more]
SMESG000078868.19.740e-2769.01SMESG000078868.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002537 ID=SMED30002537|Name=Y box protein-1|organism=Schmidtea mediterranea sexual|type=transcript|length=715bp
ATTTGAATTTAATTAAAAATTAAATTTTGTTAAAGTTATTAAATATTGTT
TTGTTTTAATTACTACTATTATAATAACTATTATAATTAAAATATTAATC
ATGGCTCAATCTCAAGTGATCGGACACGTTAAGTGGTTTAATTCGAAGAA
CGGATATGGATTCATTAGTGTTGACAATGAACGCAACGATAAAGATGTCT
TTGTACATTTTAAATCTATTGCTGCAACAAACGCAACTTCATTAGCTGAC
GGTGAAGAAGTTCTCTTCGATATTGTCGAAGGTGCAAAGGGTCTTGAAGC
AAGAAATGTTACTGGTCCAGATGGAGGCGATGTTGTTGGCGGTGCGCAAC
ATGATCATAGCAACAATAGAGGAGGTGATAGAGATAATAGCAGATCTTAT
GGTAATCGTGATGGTGGTAATAGAAGAGATCAAGGTGGATATGGTAATTA
TGGTGGTCGAAGAGAAGACAACTATTAATGGATTTCAAGAGAATTGAAAT
TGTTTAGAATACTGCATTAAATTTAATAAATTTGTGTAAATTTTTAAATT
TGTTATTTTTACGTAGTGTTTATTTCTTAGTTAAAAAATGATATTTTAAA
TTTATTTGTGTCTTTAACAGGATAAAGGAAACAGTTTATTTAAAGCCTAA
ATGTTGTATTAGTTTATAAACTTTGTATGTGTAATATTTTAAATACATAA
GTGTTAATGTACAAA
back to top

protein sequence of SMED30002537-orf-1

>SMED30002537-orf-1 ID=SMED30002537-orf-1|Name=SMED30002537-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MAQSQVIGHVKWFNSKNGYGFISVDNERNDKDVFVHFKSIAATNATSLAD
GEEVLFDIVEGAKGLEARNVTGPDGGDVVGGAQHDHSNNRGGDRDNSRSY
GNRDGGNRRDQGGYGNYGGRREDNY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002059CSP_DNA-bd
IPR011129CSD
IPR012340NA-bd_OB-fold
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002059Cold-shock protein, DNA-bindingPRINTSPR00050COLDSHOCKcoord: 46..64
score: 50.21
coord: 8..23
score: 66.08
IPR002059Cold-shock protein, DNA-bindingPFAMPF00313CSDcoord: 8..72
e-value: 2.9E-23
score: 81.5
IPR002059Cold-shock protein, DNA-bindingCDDcd04458CSP_CDScoord: 8..71
e-value: 3.30408E-20
score: 75.693
IPR011129Cold shock domainSMARTSM00357csp_8coord: 7..73
e-value: 1.2E-18
score: 78.0
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 1..84
e-value: 2.2E-26
score: 93.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..125
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..105
NoneNo IPR availablePANTHERPTHR11544COLD SHOCK DOMAIN CONTAINING PROTEINScoord: 3..120
NoneNo IPR availablePANTHERPTHR11544:SF60LD37574Pcoord: 3..120
NoneNo IPR availablePROSITEPS51857CSD_2coord: 5..72
score: 27.18
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 5..72