ATP-dependent RNA helicase dbp7

Overview
NameATP-dependent RNA helicase dbp7
Smed IDSMED30002535
Length (bp)1041
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase dbp7 (SMED30002535) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase dbp7 (SMED30002535) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase dbp7 (SMED30002535) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase dbp7 (SMED30002535) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002535

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002535SMESG000005283.1 SmedASXL_010060SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Human
Match: GNB1L (G protein subunit beta 1 like [Source:HGNC Symbol;Acc:HGNC:4397])

HSP 1 Score: 96.6709 bits (239), Expect = 4.455e-22
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL-----NNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAV--------SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            L+SG   G +  W+ ++RR       H  +C+  +Q L     L++ GRD  L  W  ++     ++ +      FC+ ++       +         ++  ++I+E P    T    +KP     +   GM M + +      +  ++  GYE G V+++      S  KV   I C           S+    I G+    L V  +D    ++  R    L NPGI+ V  R D KI ATAGWD  IRVF  + ++ L  L ++    Q         VAFTA+  L +GS D+ I  W ++
Sbjct:   40 LFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDE--VQILEMPSK--TSVCALKPKADAKL---GMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDV----SEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQ-ALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQ--------CVAFTADGLLAAGSKDQRISLWSLY 324          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Human
Match: GNB1L (G protein subunit beta 1 like [Source:HGNC Symbol;Acc:HGNC:4397])

HSP 1 Score: 96.6709 bits (239), Expect = 4.455e-22
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL-----NNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAV--------SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            L+SG   G +  W+ ++RR       H  +C+  +Q L     L++ GRD  L  W  ++     ++ +      FC+ ++       +         ++  ++I+E P    T    +KP     +   GM M + +      +  ++  GYE G V+++      S  KV   I C           S+    I G+    L V  +D    ++  R    L NPGI+ V  R D KI ATAGWD  IRVF  + ++ L  L ++    Q         VAFTA+  L +GS D+ I  W ++
Sbjct:   40 LFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDE--VQILEMPSK--TSVCALKPKADAKL---GMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDV----SEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQ-ALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQ--------CVAFTADGLLAAGSKDQRISLWSLY 324          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Human
Match: RACK1 (receptor for activated C kinase 1 [Source:HGNC Symbol;Acc:HGNC:4399])

HSP 1 Score: 54.299 bits (129), Expect = 9.973e-8
Identity = 48/271 (17.71%), Postives = 111/271 (40.96%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +   S++++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    +++++      + P  +S+ +  DG+       D L+RV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLW---------------NTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 48.1358 bits (113), Expect = 6.493e-6
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHDK-CILSIQFLKSKNHLVTHGRDGYLKFW 310
            L SGD DG +  W++ + +   KWKAHD  CI ++     K+ ++T G DG +K W
Sbjct:  511 LISGDADGKLFIWDWRTHKIVGKWKAHDSTCIAALWHPHEKSRMITAGWDGLIKMW 566          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Celegans
Match: prp-17 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:O44729])

HSP 1 Score: 48.1358 bits (113), Expect = 6.493e-6
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHDK-CILSIQFLKSKNHLVTHGRDGYLKFW 310
            L SGD DG +  W++ + +   KWKAHD  CI ++     K+ ++T G DG +K W
Sbjct:  511 LISGDADGKLFIWDWRTHKIVGKWKAHDSTCIAALWHPHEKSRMITAGWDGLIKMW 566          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Fly
Match: CG13192 (gene:FBgn0033653 transcript:FBtr0088031)

HSP 1 Score: 90.5077 bits (223), Expect = 2.749e-20
Identity = 71/311 (22.83%), Postives = 135/311 (43.41%), Query Frame = 2
Query:  128 FMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHT----IEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAVSENRLL----------IIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            F  +  L +G I G++  W+ ++ R  + ++     I S+    + + LVT  + G +  +    +++++   +  N   FC+ ALH +++   E + F   +E       +     P  I+  +    P K  S+  +      S L    +  GYESG+ + +        I  +  +  M ++++             I+G P ++LI      + + M    ++ +KNPG++ V  R D K+FA+AGWDG IR+F+ K L+ L  L  + +    D       VA      + +   D  I  WD++
Sbjct:   25 FQESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLH--HTPDRLVTQEKGGTITMFSIGGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQLP-KLGSVTCFKPFECASQL---FLLAGYESGHFLTWD-------ISSSVILDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQMQLGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRPLAVLTQHKNGGVMDLAFSSQQVAMWHAPIMAAAGMDGQISLWDLY 322          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Zebrafish
Match: gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:ZFIN;Acc:ZDB-GENE-050320-77])

HSP 1 Score: 98.5969 bits (244), Expect = 4.794e-23
Identity = 95/332 (28.61%), Postives = 150/332 (45.18%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHV-FMLNKD----LYSGDIDGNIIKWNFESRRCEIKWKAH--DKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL---NNKVMFVGYESGYVIMF--KEFQYHSAIKV-ADCIICMAVSENRLL-IIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFT-----AENYLISGSDDKIICFWDVF 1018
            +P Y+  GS   +  + F  + D    LYSG   G +  WN  +RR E   ++H  +  I    F  S++ L++ GRD  +  W  S+      + + +    FCQ +L  S        +   +   H  E+        T    +KP  +      GM+MS+ +    +  V+  GYE G V+++     +  S +KV  + ++ + V   R   I G+ +N L    +D N  S+     I + NPG+S +  R DGKI A+AGWD  IRVF  K LK L  L+    H  TD  N   +VAF+      +  L +GS D+ I  W ++
Sbjct:    7 DPLYILRGSGASVNALHFCCDGDGPPLLYSGSGKGAVHVWNLSTRRAERVLESHAGNSVIWLNTFNNSRSCLISQGRDMRVCVWDLSEGRSAVTDSLHTGSVGFCQCSLLESRLGS----TLLAHPTQHMEEVSVVEMSSWTQVCSLKPDSN-----LGMLMSMKMWQADSGPVLCAGYEDGSVVLWDVSHRRPFSLLKVHPEPVMSLDVDVCRQKGISGSSENILQSWRLD-NQQSLQMHDSIQMTNPGVSQLRIRADGKILASAGWDNNIRVFGWKKLKPLAVLQ----H-HTDMVN---SVAFSDHQDPTQRLLAAGSKDQRISVWSIY 320          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Zebrafish
Match: gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:ZFIN;Acc:ZDB-GENE-050320-77])

HSP 1 Score: 98.5969 bits (244), Expect = 4.794e-23
Identity = 95/332 (28.61%), Postives = 150/332 (45.18%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHV-FMLNKD----LYSGDIDGNIIKWNFESRRCEIKWKAH--DKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL---NNKVMFVGYESGYVIMF--KEFQYHSAIKV-ADCIICMAVSENRLL-IIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFT-----AENYLISGSDDKIICFWDVF 1018
            +P Y+  GS   +  + F  + D    LYSG   G +  WN  +RR E   ++H  +  I    F  S++ L++ GRD  +  W  S+      + + +    FCQ +L  S        +   +   H  E+        T    +KP  +      GM+MS+ +    +  V+  GYE G V+++     +  S +KV  + ++ + V   R   I G+ +N L    +D N  S+     I + NPG+S +  R DGKI A+AGWD  IRVF  K LK L  L+    H  TD  N   +VAF+      +  L +GS D+ I  W ++
Sbjct:    7 DPLYILRGSGASVNALHFCCDGDGPPLLYSGSGKGAVHVWNLSTRRAERVLESHAGNSVIWLNTFNNSRSCLISQGRDMRVCVWDLSEGRSAVTDSLHTGSVGFCQCSLLESRLGS----TLLAHPTQHMEEVSVVEMSSWTQVCSLKPDSN-----LGMLMSMKMWQADSGPVLCAGYEDGSVVLWDVSHRRPFSLLKVHPEPVMSLDVDVCRQKGISGSSENILQSWRLD-NQQSLQMHDSIQMTNPGVSQLRIRADGKILASAGWDNNIRVFGWKKLKPLAVLQ----H-HTDMVN---SVAFSDHQDPTQRLLAAGSKDQRISVWSIY 320          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Zebrafish
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:30722])

HSP 1 Score: 58.9214 bits (141), Expect = 2.351e-9
Identity = 52/271 (19.19%), Postives = 109/271 (40.22%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKN-----PGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +   S+ ++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R+ I+  N     P  +S+ +  DG+       D LIRV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQDDSHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELRQDIITTNSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Xenopus
Match: gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:NCBI gene;Acc:100145018])

HSP 1 Score: 94.3597 bits (233), Expect = 2.194e-21
Identity = 82/314 (26.11%), Postives = 143/314 (45.54%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFL-KSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILN-----NKVMFVGYESGYVIMFKEFQYHSAIKVA-----------DCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWN--VDHCQTDKTNRHLAVAFTAENYLI-SGSDDKIICFWDVFRN 1024
            L+SG  +G +  WN  +RR E     H  K I  +  L  ++  L++ GRD  ++ W  ++    EI+ +      FC+ +L ++ +     ++    D    +++++     I  ++     K  +   +GM M + +       + ++ VGYE G V ++   ++    ++            DC+     S       G+ +  L V  +D    ++   K   L NPGIS VV RQD KI ATAGWD  IRVF  K +K L  L+++  + HC +       +   T E+ L+ +GS D +I  W V++N
Sbjct:   36 LFSGSSNGLVHVWNLNTRRSETVLSGHQGKSIYWLHTLFHNRELLLSQGRDLQIRTWNLAEGRREEIDSVPVESVGFCKCSLLKTESC---LLAMPGKDSSQ-VQVLDLNSKKIVSSM-----KLSTDNQWGMAMCMKLWQPISGPSPLLLVGYEDGSVALWNVLEHRLMSRLTCHMEPVMSLDFDCLKARGAS-------GSSERVLNVWSLDEQQ-NLKAYKTQELVNPGISDVVLRQDRKILATAGWDHRIRVFGWKRMKPLAVLQYHSAIVHCVS------FSDHLTPEDRLLAAGSKDHLISLWSVYQN 326          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 55.8398 bits (133), Expect = 3.040e-8
Identity = 49/271 (18.08%), Postives = 110/271 (40.59%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +   S+ ++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    +++++      + P  +S+ +  DG+       D LIRV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTVQEESHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHSGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISSSSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Xenopus
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:448353])

HSP 1 Score: 50.8322 bits (120), Expect = 1.296e-6
Identity = 49/270 (18.15%), Postives = 107/270 (39.63%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W    NT  +        +  C              + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    +++++      + P  +S+ +  DG+       D LIRV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW----NTLGDDTPESHTEWVSC--------------VRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHSGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISSSSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVW 306          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Match: Gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:MGI Symbol;Acc:MGI:1338057])

HSP 1 Score: 89.7373 bits (221), Expect = 7.808e-20
Identity = 85/311 (27.33%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  137 NKDLYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFW--LKSDNTFIEINRMESNPYSFCQMA-LHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNN-----KVMFVGYESGYVIMFKEFQYHSAIKVADCIIC-----MAV---SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            N  L+SG  +G +  W+ ++RR       H  + ++ ++ L   + L++ GRD  L  W   +  NT ++  +++S    FC+ + L R        +    +DE   ++I+E P       L     K  +    GM M + +         ++  GYE G V ++      S  KV   I C     M +   S+    I G+    L V  +D    S+  +K   L NPGI+ V  R D KI ATAGWD  IRVF  + +K L  L ++        +     VAF A+  L +GS D+ I  W ++
Sbjct:   36 NPLLFSGSQNGLVHIWSLQTRRIVTTLNGHGGQGVIWLKTLPQGHQLLSQGRDLRLCLWDLEEGRNTIMDSVQLDS--VGFCRGSILVRGQQCWMLAVPGKGSDE---VQILEMPSKTSVCTL-----KPEADARPGMPMCLGLWQTNSSLRPLLLAGYEDGSVTLWDI----SERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQ-SLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFH--------SAPVYCVAFAADGLLAAGSKDQRISIWSLY 323          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Match: Gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:MGI Symbol;Acc:MGI:1338057])

HSP 1 Score: 89.7373 bits (221), Expect = 7.808e-20
Identity = 85/311 (27.33%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  137 NKDLYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFW--LKSDNTFIEINRMESNPYSFCQMA-LHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNN-----KVMFVGYESGYVIMFKEFQYHSAIKVADCIIC-----MAV---SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            N  L+SG  +G +  W+ ++RR       H  + ++ ++ L   + L++ GRD  L  W   +  NT ++  +++S    FC+ + L R        +    +DE   ++I+E P       L     K  +    GM M + +         ++  GYE G V ++      S  KV   I C     M +   S+    I G+    L V  +D    S+  +K   L NPGI+ V  R D KI ATAGWD  IRVF  + +K L  L ++        +     VAF A+  L +GS D+ I  W ++
Sbjct:   36 NPLLFSGSQNGLVHIWSLQTRRIVTTLNGHGGQGVIWLKTLPQGHQLLSQGRDLRLCLWDLEEGRNTIMDSVQLDS--VGFCRGSILVRGQQCWMLAVPGKGSDE---VQILEMPSKTSVCTL-----KPEADARPGMPMCLGLWQTNSSLRPLLLAGYEDGSVTLWDI----SERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQ-SLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFH--------SAPVYCVAFAADGLLAAGSKDQRISIWSLY 323          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Match: Gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:MGI Symbol;Acc:MGI:1338057])

HSP 1 Score: 81.2629 bits (199), Expect = 6.353e-17
Identity = 82/306 (26.80%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  137 NKDLYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFW--LKSDNTFIEINRMESNPYSFCQMA-LHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIIC-----MAV---SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            N  L+SG  +G +  W+ ++RR       H  + ++ ++ L   + L++ GRD  L  W   +  NT ++  +++S    FC+ + L R        +    +DE   ++I+E P       L     K  +    GM M + +         ++ G V ++      S  KV   I C     M +   S+    I G+    L V  +D    S+  +K   L NPGI+ V  R D KI ATAGWD  IRVF  + +K L  L ++        +     VAF A+  L +GS D+ I  W ++
Sbjct:   36 NPLLFSGSQNGLVHIWSLQTRRIVTTLNGHGGQGVIWLKTLPQGHQLLSQGRDLRLCLWDLEEGRNTIMDSVQLDS--VGFCRGSILVRGQQCWMLAVPGKGSDE---VQILEMPSKTSVCTL-----KPEADARPGMPMCLGL---------WQDGSVTLWDI----SERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQ-SLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFH--------SAPVYCVAFAADGLLAAGSKDQRISIWSLY 309          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Match: Gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:MGI Symbol;Acc:MGI:1338057])

HSP 1 Score: 69.707 bits (169), Expect = 8.573e-13
Identity = 63/223 (28.25%), Postives = 92/223 (41.26%), Query Frame = 2
Query:  389 RSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNN-----KVMFVGYESGYVIMFKEFQYHSAIKVADCIIC-----MAV---SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            +    DY  I      +   ++I+E P       L     K  +    GM M + +         ++  GYE G V ++      S  KV   I C     M +   S+    I G+    L V  +D    S+  +K   L NPGI+ V  R D KI ATAGWD  IRVF  + +K L  L ++        +     VAF A+  L +GS D+ I  W ++
Sbjct:  156 QPKGRDYALI------QTLRVQILEMPSKTSVCTL-----KPEADARPGMPMCLGLWQTNSSLRPLLLAGYEDGSVTLWDI----SERKVCSQITCHEEPVMGLDFDSQKAKGISGSAGKVLAVWSLDDQQ-SLQVKKTHELTNPGIAEVTIRPDHKILATAGWDHRIRVFHWRTMKPLAVLAFH--------SAPVYCVAFAADGLLAAGSKDQRISIWSLY 354          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Match: Rack1 (receptor for activated C kinase 1 [Source:MGI Symbol;Acc:MGI:101849])

HSP 1 Score: 54.299 bits (129), Expect = 6.847e-8
Identity = 48/271 (17.71%), Postives = 111/271 (40.96%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +   S++++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    +++++      + P  +S+ +  DG+       D L+RV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLW---------------NTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Match: sp|Q54HW5|GNB1L_DICDI (Guanine nucleotide-binding protein subunit beta-like protein 1 homolog OS=Dictyostelium discoideum OX=44689 GN=gnb1l PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.074e-22
Identity = 96/356 (26.97%), Postives = 153/356 (42.98%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHVFM--LNKDL-YSGDIDGNIIKWNFESRRCEIKWKAHDKCI----LSIQFLKSK-------------NHLVTHGRDGYLKFWLKSDN-TFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKV-------------MFVGYESGYVIMFKEFQYHSAIKVA-----DCIICMAVSENRLL-IIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRNK 1027
            +P Y+  G    +  V    +N +L YSG  DG +  WN E ++C     AH + I    LS+Q+L +               ++++ GRDG +K W   DN TF    R+E+N  S  + +   S+       + D       +EI +     +   L  KP+     +  G+ MS+ +                  +  GYE+G ++++ + +  S   V+     + I+  A+S N    I G+ D  +I   I+      N  K   L N GIS +  R D KI+ATAGWD  IR+F  K    L  LK++ +           ++ F + N L SGS D  I  WD++  K
Sbjct:   14 DPYYILRGHKFNVNSVLFDKVNPNLLYSGSGDGELKLWNIEEKKCISTQIAHSEGIGGGVLSLQWLSNDNNNENNNNNDEICGNILSQGRDGVIKIWSIIDNCTFKNTYRLETNSLSLGKCSSLSSNLLSISGSAIDPTSSTSQVEIWDLKNKQVINKL--KPNNQQLFEKLGLPMSLKLYYENENNDNSNQSNDQIRLCTGYENGELLIW-DLRNTSIPLVSSKLHNEPILSFALSNNSTKGISGSGDTNIIEFNINYESKQFNITKTHKLNNGGISEIKIRNDEKIYATAGWDKRIRIFNFKKQTPLAILKYHTESV--------YSIDFNSNNILASGSKDCKIALWDIYTTK 358          
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Match: sp|Q9BYB4|GNB1L_HUMAN (Guanine nucleotide-binding protein subunit beta-like protein 1 OS=Homo sapiens OX=9606 GN=GNB1L PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 2.140e-21
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL-----NNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAV--------SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            L+SG   G +  W+ ++RR       H  +C+  +Q L     L++ GRD  L  W  ++     ++ +      FC+ ++       +         ++  ++I+E P    T    +KP     +   GM M + +      +  ++  GYE G V+++      S  KV   I C           S+    I G+    L V  +D    ++  R    L NPGI+ V  R D KI ATAGWD  IRVF  + ++ L  L ++    Q         VAFTA+  L +GS D+ I  W ++
Sbjct:   40 LFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDE--VQILEMPSK--TSVCALKPKADAKL---GMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDV----SEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQ-ALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQ--------CVAFTADGLLAAGSKDQRISLWSLY 324          
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Match: sp|B8NG55|ASA1_ASPFN (ASTRA-associated protein 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=asa1 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.008e-20
Identity = 88/357 (24.65%), Postives = 144/357 (40.34%), Query Frame = 2
Query:   83 PAYLFIGSTHYI--THVFMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVT----HGRDGYLKFWL--KSDNTFIE--------------------INRMESNPYSFCQMAL------------HRSSNNDYEFISFDLNDEDH-------------TIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL--NNKVMFVG--YESGYVIMF--------KEFQYHSAI---KVADCIICMAVSENRLLI---------IGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQT 922
            P Y+  G    I   H+F  N  L SGD DG II W+   +R    WKAH+  IL ++     N  VT    HGRD  L  W     D   ++                    ++ +  N  +FC  ++               +++     S   N   H              I+I   P++     LC  P+        GMVM++++   + + +++   YE G+V++F        ++F   ++    K     +  A S+  L I         + +  + L+V      F  +   KK+  K+ G   V  R DG++FATAGWD  +RV++ K L++L  LKW+ + C T
Sbjct:   13 PTYILRGHASPIHGLHIFHQNLRLISGDADGWIIVWDLVFKRPVAVWKAHEGAILEVKGFTFSNQTVTEVYTHGRDHKLCVWRFRAQDEDLLQKTLPVDISEQNQSQATQPWLVHSLPVNALNFCAFSMLFLDEEESPDTGEPEASDKTSTQSPGKNPPQHHSLFAVPNALNSGAIDIFHLPRE---RRLCTIPADQ--TTQTGMVMAVTLFYSSTRELYIASAYEDGHVMVFALRGQLTTQDFSGKASSDSWKWERVYVARAHSQPALSIDVFPAGGYFVSSSADALVVKHPVPGFGEVGTVKKVDTKHSGQQGVRIRSDGRVFATAGWDSRVRVYSCKTLRELAVLKWHKEGCYT 364          
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Match: sp|C9STX5|ASA1_VERA1 (ASTRA-associated protein 1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) OX=526221 GN=asa1 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.107e-19
Identity = 83/362 (22.93%), Postives = 147/362 (40.61%), Query Frame = 2
Query:  164 DGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFW-------------LKSDNT-----------FIEINRMESNPYSFCQMALHRSSNNDYEFISFDLND-EDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYG---MVMSISIL---NNKVMFVGYESGYVIMFK------------EFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIV---IEIDSNFISMNERKKIL-LKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHC-------------------QTDKT-----------NRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            +G +  W+    R    W+ HD  IL IQ   + + ++THGRD  L  W             L  D+T            I++N M    ++ C       + +D E +    N     +I+I   P            ++ H++KS G   MVM+++++   ++  +  GYE+G                    Q HS       ++ + VS + L  + +  + ++    +   +    + +  K++  K+ G  S+ FR DG++FAT GWD ++RV++ K +K++  LKW+   C                   + D T            R +A A  A ++L +GS D  I  WD+F
Sbjct:   60 EGYVALWDLTIMRPTAVWQPHDNAILGIQGWGA-DRIITHGRDHKLAVWKLATSDEANLSKKLPLDDTSEPRPQPWLLHLIDVNTMNFCAFAACVPTDPPPAGDDPELLLAVPNTLASESIDIYHLPTQ----------TRRHTVKSPGQNGMVMALALVPQGDSLTLLAGYENGVTTAMHLSAASGTWNTTYRTQPHS-----QPVLSLDVSPDGLSFVTSSADAVVARHPVPPPAGMEVLEQPLKVVNTKHSGQQSLRFRDDGRVFATGGWDAMVRVYSGKTMKEVAVLKWHEVGCYAVAFASALKAPQAAGGVEERDGTVVRRAGEVSVRERRIAHA-EAAHWLAAGSKDGKISLWDIF 404          
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Match: sp|F1DLK1|DSE1_NICBE (Protein DECREASED SIZE EXCLUSION LIMIT 1 OS=Nicotiana benthamiana OX=4100 GN=DSE1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.352e-19
Identity = 84/355 (23.66%), Postives = 153/355 (43.10%), Query Frame = 2
Query:  137 NKDLYSGDIDGNIIKWN-FESRRCEIKW---KAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTF--IEINRMESNPYSFCQMALHRSSNNDYEFISFDLND----------EDHTI--------EIVEYPK---------------DIITYNLCVK-PSKSHSIKSY-----GMVMSI-SILNNKV-----MFVGYESGYV---------IMFKEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLI-SGSDDKIICFWDVF 1018
            N  L+SG  DG +  WN  + R     W    AH    ++   +   N +++ GRDG +K W           +  +++N Y FC++++ +S +   +    ++N+           D           E++E PK               D+ T     + P  S S  +      GM M++ + L ++      +  GYE G +         +     ++HS   ++ CI        +  + G  D ++++  +D +  S   RK+I+L+ PGI+    R DGKI ATAGWD  +R++  +  K L  LK++   C T        V+F+A++ L+ S S+D  +  W+++
Sbjct:   29 NSILFSGSTDGELRIWNTVQYRTVSSAWVHSAAHGIICVAASPVLGDNKVISQGRDGTVKCWDFGGGGLSRTPLLTIKTNSYHFCKLSIAKSPSEAMKIDDLEVNEIVDGMQREEQGDQPTDSIKFKGKELIEGPKYVAIAGEQASVVEIWDVNTAERIAQLPHSSGSPSNQTPNQRGMCMAVQAFLPSESQGLLSIMAGYEDGSIAWWDLRNLGVPLTSVKFHSEPVLSLCID----GSCKGGLSGAADEKILMFALDHSMGSCLIRKEIVLERPGIAGTSIRPDGKIAATAGWDHRVRIYNYRKGKPLAILKYHNATCNT--------VSFSADSKLLASASEDTTVALWELY 371          
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Match: A0A2T7P5G9 (WD_REPEATS_REGION domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11269 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.164e-32
Identity = 90/338 (26.63%), Postives = 163/338 (48.22%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHVF---MLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFI---------SFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMF--------KEFQYHSAIKVADCIICM--AVSENRLLIIGTPDNELIVIEIDS-NFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRN 1024
            +P Y+  GS+  +T +    +L   L SG+ DG +  W+ ++RR + K  AH   +L ++     + L+THGRDGY + W   +  F   ++++ +   FC   +   +   Y  +          +D + +    E+V  P   +   +C++P    +  ++G            + VGYESG ++++         E   HS     D ++C   + S NR    G+ DN+L+   I + N   M+   K ++ N G + +V R D KI ATAGWD  +RVF++K L+ +  L ++    +        A++F+ +  L +GS+D++I  WDV+R+
Sbjct:   12 DPVYILRGSSSPVTSLHFLPILTNTLLSGNQDGKVYVWDLKTRRIQQKINAHLDSVLQVEASPVADSLLTHGRDGYARIWRTGEAAFTCTDQIQVSSKGFCAAKMLPQTGKSYLIVLPGESSSVTVYDSSTKQLVRELVP-PSTKLGMCMCMQPVLDSTGSAWG------------LLVGYESGSLLLWDVVSGKLLSELMLHS-----DAVMCFKYSSSANRGF-SGSVDNQLLEWTISAENENKMSLIDKTVVTNQGFNDIVIRCDNKIVATAGWDSNVRVFSTKKLRPIALLSFHRGSVK--------ALSFSCDGLLAAGSEDRLISVWDVYRS 322          
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Match: A0A2C9LBJ8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065231 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.780e-31
Identity = 94/307 (30.62%), Postives = 151/307 (49.19%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDE--DHTIEIVEYPKDIITYNLCVKPSKSH--SIKSYGMVMSISILNNKV----MFVGYESGYVIMFKEFQYHSAIKVAD------CIICMAVSENRLL--IIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            LYSG  DG +IKWN+ +RR E    AH + I+ +  +  K  LV+ GRDG +KFW  +D  +  I  +      FC  ++   +N     +  D   +   H +E +  P+     +L   P + H    KS+GM M I    +KV    +FV YESG + M+   +     +++       C+ C A  +   +  I G+ D +L + ++D+  + +  +K + + NPG+ S+  R DGKI A  GWDG  R+F+ K +K L  L ++    Q         VAF + NYL +GS D  I  W+++
Sbjct:   39 LYSGHQDGKVIKWNWVTRRPESSTLAHGESIIWLMCVAEK--LVSQGRDGVVKFWSVTDPEWTVIGEIPCAALIFCNSSICIFNNQHLLSVPSDSVGQVTTHCLEQL-LPESSHIVHLST-PIRLHHKDTKSHGMCMRIKSEADKVPSPYLFVAYESGTLTMWDLLRGEILTEISAHEESIMCMDCWAGIDTGTIKCITGSVDEQLKLWQVDN--LKLTHKKTVKVLNPGMGSISVRADGKIIAVGGWDGRCRLFSLKSMKALAVLTFHRSSVQ--------CVAFASNNYLATGSKDGYIAVWNIY 331          
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Match: A0A2B4RLP2 (Guanine nucleotide-binding protein subunit beta-like protein 1 OS=Stylophora pistillata OX=50429 GN=Gnb1l PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.823e-31
Identity = 99/334 (29.64%), Postives = 161/334 (48.20%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHVFMLNKD------LYSGDIDGNIIKWNFESRRCEIKWKAHDK-CILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHT-IEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNK-----VMFVGYESGYV----IMFKEFQYHSAIKVADCIICMAVSENRLLII-GTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRNK 1027
            +P Y+  G+   +  V    K       L SG   G I  WN +++R E+    H+   IL+ +F    N +++HGRDGYL+ W  S+     +N + +    FCQ  +    +  Y+     L    H+ + I++     I ++L     K  + KS GM M IS++++      ++  GYESG +    +M ++    +    A+ ++CM V +  L I+ G+ D++L V  +     S+   K+I LKNPGI+SV  R+D +I AT GWDG IR+++ + LK L  L +   H QT  T       F     L +G  D  I  W ++  K
Sbjct:    8 DPLYVLRGTEAALNVVKFAPKTVREEGLLLSGSAKGIISLWNLKTKRSEVTLDGHNGHAILAAEFQPCGN-VISHGRDGYLQTWQCSEGRHEIVNSISAPFLGFCQFCIM---SRGYKSHWIGLPSASHSQVNILDLESKEILFSL-----KPDNEKSLGMCMCISLISDPATDKPLLIAGYESGQLLLWDVMARQILGRNPTH-AESVLCMDVDKEDLRIVSGSADSKLCVSSVTPQH-SITADKEIELKNPGIASVKIRKDCQILATGGWDGRIRIYSWRTLKPLAYLNY---HTQTINTVDFSEDLFGHGQLLAAGGKDSRISLWSIYNEK 327          
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Match: A0A0B6ZKB4 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF68709 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.940e-29
Identity = 87/322 (27.02%), Postives = 156/322 (48.45%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSD-NTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHT-IEIVE-------YPKDIITYNLCVKPSKSHSIK-----SYGMVMSISIL----NNKVMFVGYESGYVIMFKEF---------QYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVD--HCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRN 1024
            ++SG   G+I++W+  ++R    W AH   ++ + +    + L++ GRDG ++ W +   +T+I    +    + FC  A+   SN  +  ++  +N+  H  + ++E        P+       C   + SHSIK     +YGM M I +     ++  + VG+ESG + ++             Y+ +I   DC +C   +  R  + G+ DN L +  ++++ +  N    I + NPGIS++  RQDG+IFA+ GWD  +R+ + +  K L  L ++    HC T          F  +N L +GS D  I  WDV++N
Sbjct:   61 IFSGHEKGHIMEWSVVTQRATASWHAHSHSVIWLAW-TLPDKLLSQGRDGVIRLWGRDGVDTWISFGEIPCALFLFCDSAVMHHSN--HFKLAVPMNEAGHIDVHVLEESTLAALLPRKSAA-ETCPMSTVSHSIKPPSATAYGMCMRIRMFIAKNSDPYLLVGFESGSLTLWNLLNGVLLNEVKAYNDSIMSMDCWVCQETNSVRC-VTGSADNVLKMWLVEADKLVQN--VSISVTNPGISAISIRQDGRIFASGGWDHRVRIASLRKFKPLAVLAYHTGSVHCTT----------FGPDNTLATGSQDGYIALWDVYQN 365          
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Match: A0A1X2H331 (WD40-repeat-containing domain protein OS=Syncephalastrum racemosum OX=13706 GN=BCR43DRAFT_497894 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.372e-28
Identity = 91/326 (27.91%), Postives = 157/326 (48.16%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFW-LKSDNTFIEINRMESNPY---SFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILN-NKVMFVGYESGYVIMFKEFQYHSAIKVA-------DCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            P Y+F G    +  +   N D Y  SGD  G +  W   +RR  ++W+AH++  LS+   ++ + L+T GRD  +  W L  DN+  + + + +  Y   +FC+++L  +   D   I+     +   I+I    K    +    K       KS G+ M+I +    + +   YESG V  +   +     ++        + ++ +A+   +   I T   E  +I+ D   +   + KK  +K PG+S+V  RQDGKIFATAG+DG IRVF++K LK L  L ++ D   +      LA     +++L++GS +  I  W ++
Sbjct:    9 PVYIFRGHEAGVNDLVFFNDDQYFVSGDAKGIVQIWKMRTRRAILQWQAHEESCLSVHVYEN-DKLITQGRDNTIHVWQLLLDNSTPDKHHLYTLIYDSLTFCRLSLAFNDRQD-AIIAIPAQADHSAIDIYNLSKRKWVFRDVGKRPIEEGTKSRGICMAIKLFEAGRRVVAAYESGEVTTWALDEEKDLFELVWSVQEQHEPVLDLALDPLQTFAIST-SAENAIIKYD---LVTGQTKKTTIKKPGLSAVTIRQDGKIFATAGYDGRIRVFSAKSLKPLAILSYHRDSVYSVSFASRLAEG--EDHWLMAGSKESRISLWSIY 326          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Cavefish
Match: gnb1l (guanine nucleotide binding protein (G protein), beta polypeptide 1-like [Source:ZFIN;Acc:ZDB-GENE-050320-77])

HSP 1 Score: 83.5741 bits (205), Expect = 9.305e-18
Identity = 75/307 (24.43%), Postives = 135/307 (43.97%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKF---------WLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISIL---NNKVMFVGYESGYVIMF--KEFQYHSAIKV-ADCIICMAV-SENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            LYSG   G++  WN  +RR E     H+    S+ ++++   ++       +           W  ++      + + +    FCQ +L  S+       +       HT EI     +  T    + P  +      GM+M + +    +  ++  GYE G ++++     +  S +K   D ++C+ V S  +  + G+ D  LI     S+  ++  +  + L NPG+S V  R DG+I ATAGWDG +RVF  + LK L  L+ + D  Q+ + + H       +  L +GS D+ I  W ++
Sbjct:   34 LYSGSGKGSVHVWNLNTRRAETVLDGHNGA--SVIWIRTSVCVMCVCVCVCVLCVCVGVCVCVWDLAEGRAAVTHSLHTGSVGFCQCSLLESTRTLLALPT------QHTEEIKVVELETQTPVCSLIPDSTR-----GMLMCMKMWQADSGPLLCAGYEDGSLVLWDVSNRRPLSCLKAHPDPVMCLDVDSGTQKGVSGSSDQNLISWSF-SDQQNLQVQDSVPLTNPGVSQVRIRGDGRIVATAGWDGSVRVFGWRRLKPLAVLQHHQDPVQSLEFSDH---QDPTQRLLAAGSTDQRISMWSIY 323          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Cavefish
Match: rack1 (guanine nucleotide-binding protein subunit beta-2-like 1 [Source:NCBI gene;Acc:103029614])

HSP 1 Score: 57.3806 bits (137), Expect = 6.407e-9
Identity = 50/271 (18.45%), Postives = 111/271 (40.96%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKN-----PGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +   S++++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R++++  N     P  +++ +  DG+       D LIRV+
Sbjct:   55 PQRALKGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQDESHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDMINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELRQEVISTNSKAEPPQCTALAWSADGQTLFAGYTDNLIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Cavefish
Match: ENSAMXT00000047239.1 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 56.225 bits (134), Expect = 1.364e-8
Identity = 49/271 (18.08%), Postives = 110/271 (40.59%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +    ++++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R++++      + P  +S+ +  DG+       D LIRV+
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQDEGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELRQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Cavefish
Match: ENSAMXT00000007662.2 (receptor of activated protein C kinase 1 [Source:NCBI gene;Acc:103033914])

HSP 1 Score: 50.8322 bits (120), Expect = 7.947e-7
Identity = 44/259 (16.99%), Postives = 104/259 (40.15%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIF 826
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +    ++++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R++++      + P  +S+ +  DG+  
Sbjct:   55 PQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQDEGHSEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGFLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELRQEVISTSSKAEPPQCTSLAWSADGQTL 298          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.450e-7
Identity = 48/271 (17.71%), Postives = 107/271 (39.48%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKIL-----LKNPGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G  H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +    + ++   + F  N+ +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R++++      + P   S+ +  DG+       D  IRV+
Sbjct:   55 PQRSLHGHGHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTNCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDTINALCFSPNRYWLCAATGPSIKIWDLEGKVIVDELRQEVISTSSKAEPPQCISLAWSADGQTLFAGYTDNFIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Nematostella
Match: EDO44526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV82])

HSP 1 Score: 98.2117 bits (243), Expect = 2.221e-23
Identity = 90/342 (26.32%), Postives = 154/342 (45.03%), Query Frame = 2
Query:   80 EPAYLFIGSTHYITHVFMLNKD------LYSGDIDGNIIKWNFESRRCEIKW-KAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSK-SHSIK-----SYGMVMSI-----SILNNKVMFVGYESGYVI--------MFKEFQYHSAIKVADCIICMAVSE-NRLLIIGTPDNELIVIE--IDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVF 1018
            +P Y+  G+   +  +  + K       L SG  +G I  WN +++R +      H K ++ +  L +K +L++HGRDG +  W  S +    +++ME     FC+ ++              L+D+        Y  +++  +L  K SK +H +K     S+GM M +     S  ++ ++  GYE+G V         M      HS     + ++C+ V E N   + G+ DN+L +    +D    S  E   + LK  G++SV  R D +I A+  WDG +RV + K LK L  L +   HC T  T    + +      + +GS D  I  WD++
Sbjct:    8 DPVYVLRGTIGSVNALKFVPKPISNDEMLVSGSSNGIISLWNLKTKRVQSSIDNHHGKAVIELG-LTNKPNLISHGRDGKIFIWDISSSEPRLLSQMEGPVLGFCKFSI--------------LDDDKVQWLATAYQSEVVINDL--KTSKVAHRLKPQDHMSFGMCMCMKMFCCSQTSHPMILCGYENGKVALWDISMCRMMSHLASHS-----ESVMCLNVDEVNHKAVTGSADNKLSITTFGLDGQLSSTGE---VQLKTEGVASVKVRCDSRILASGAWDGRVRVHSWKSLKPLAVLNY---HCATVNTVEFSSESSAGRMLMAAGSKDSRISLWDIY 321          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Medaka
Match: gnb1l (G protein subunit beta 1 like [Source:NCBI gene;Acc:101156661])

HSP 1 Score: 114.775 bits (286), Expect = 5.599e-29
Identity = 86/307 (28.01%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILN-----NKVMFVGYESGYVIMFKEFQYHSAIKV---ADCIICMAVSENRLL-IIGTPDNELIVIEIDS-NFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFT-----AENYLISGSDDKIICFWDVF 1018
            L+SG   G I  WN  SRR E  ++AH    IL ++ L+SK+ L++ GRD  +  W         ++ + +  + FCQ +L  + +     ++F    +   I+IVE P       L  +          GMVM + +         ++  GYE G ++++   Q     +V    + ++C+     RL  I G+ + +L    +DS N I + E  K++  NPG+S +  R DGK+ A+AGWD  +R+F  K L+ L  L+++ D          L+VAF+      +  L +GS D+ I  W ++
Sbjct:   34 LFSGSAKGMIHMWNLNSRRPEKSFEAHGGSSILWVRTLQSKDALISQGRDMQVCMWDLRGGCGELVDSVFTGSFGFCQCSLIET-DQTKSLLAFA-TQQSEEIKIVEIPSKTTVCTLVPE-------AKLGMVMCLKLWQPDSGPGPLLLAGYEDGSLLLWDVTQRSKLSQVKAHPEPVMCLTFDPQRLRGISGSAETKLSSWILDSQNNIQLQECVKLV--NPGVSQLCIRADGKLLASAGWDHRVRIFGWKKLRPLAVLQYHSDMV--------LSVAFSDHLDPRQRLLAAGSKDQRISLWSIY 321          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Medaka
Match: gnb1l (G protein subunit beta 1 like [Source:NCBI gene;Acc:101156661])

HSP 1 Score: 102.449 bits (254), Expect = 1.413e-24
Identity = 84/307 (27.36%), Postives = 139/307 (45.28%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILN-----NKVMFVGYESGYVIMFKEFQYHSAIKV---ADCIICMAVSENRLL-IIGTPDNELIVIEIDS-NFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFT-----AENYLISGSDDKIICFWDVF 1018
            L+SG   G I  WN  SRR E  ++AH    IL ++ L+SK+ L++ GRD           + IE ++ +S                    ++F    +   I+IVE P       L  +          GMVM + +         ++  GYE G ++++   Q     +V    + ++C+     RL  I G+ + +L    +DS N I + E  K++  NPG+S +  R DGK+ A+AGWD  +R+F  K L+ L  L+++ D          L+VAF+      +  L +GS D+ I  W ++
Sbjct:   34 LFSGSAKGMIHMWNLNSRRPEKSFEAHGGSSILWVRTLQSKDALISQGRD--------MQCSLIETDQTKS-------------------LLAFA-TQQSEEIKIVEIPSKTTVCTLVPE-------AKLGMVMCLKLWQPDSGPGPLLLAGYEDGSLLLWDVTQRSKLSQVKAHPEPVMCLTFDPQRLRGISGSAETKLSSWILDSQNNIQLQECVKLV--NPGVSQLCIRADGKLLASAGWDHRVRIFGWKKLRPLAVLQYHSDMV--------LSVAFSDHLDPRQRLLAAGSKDQRISLWSIY 295          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Medaka
Match: gnb1l (G protein subunit beta 1 like [Source:NCBI gene;Acc:101156661])

HSP 1 Score: 95.5153 bits (236), Expect = 3.659e-22
Identity = 79/302 (26.16%), Postives = 135/302 (44.70%), Query Frame = 2
Query:  146 LYSGDIDGNIIKWNFESRRCEIKWKAHD-KCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKV---ADCIICMAVSENRLL-IIGTPDNELIVIEIDS-NFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFT-----AENYLISGSDDKIICFWDVF 1018
            L+SG   G I  WN  SRR E  ++AH    IL ++ L+SK+ L++ GRD  +  W         ++ + +  + FCQ +L                + D T  ++ +              +S    S             ++  GYE G ++++   Q     +V    + ++C+     RL  I G+ + +L    +DS N I + E  K++  NPG+S +  R DGK+ A+AGWD  +R+F  K L+ L  L+++ D          L+VAF+      +  L +GS D+ I  W ++
Sbjct:   34 LFSGSAKGMIHMWNLNSRRPEKSFEAHGGSSILWVRTLQSKDALISQGRDMQVCMWDLRGGCGELVDSVFTGSFGFCQCSL---------------IETDQTKSLLAFATQ-----------QSEEPDSG---------PGPLLLAGYEDGSLLLWDVTQRSKLSQVKAHPEPVMCLTFDPQRLRGISGSAETKLSSWILDSQNNIQLQECVKLV--NPGVSQLCIRADGKLLASAGWDHRVRIFGWKKLRPLAVLQYHSDMV--------LSVAFSDHLDPRQRLLAAGSKDQRISLWSIY 290          
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Medaka
Match: rack1 (receptor for activated C kinase 1 [Source:NCBI gene;Acc:101162055])

HSP 1 Score: 55.4546 bits (132), Expect = 2.831e-8
Identity = 50/271 (18.45%), Postives = 109/271 (40.22%), Query Frame = 2
Query:   83 PAYLFIGSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKN-----PGISSVVFRQDGKIFATAGWDGLIRVF 862
            P     G +H+++ V + +   +  SG  DG +  W+  +     ++  H K +LS+ F      +V+  RD  +K W               N    C+  +    + ++   + F  N  +  I    + K +  +NL     K++ I   G + ++++  +  +   G + G  +++   E ++   +   D I  +  S NR  +       + + +++   I    R++++  N     P  +S+ +  DG+       D LIRV+
Sbjct:   55 PQRSLKGHSHFVSDVVISSDGQFALSGAWDGTLRLWDLTTGLTTRQFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLW---------------NTLGVCKYTIQDEGHTEWVSCVRFSPNSSNPIIVSCGWDKMVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDSGDVINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELRQEVISTNSKAEPPQCTSLAWSADGQTLFAGYTDNLIRVW 310          
BLAST of ATP-dependent RNA helicase dbp7 vs. Planmine SMEST
Match: SMESG000005283.1 (SMESG000005283.1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 316/317 (99.68%), Postives = 316/317 (99.68%), Query Frame = 2
Query:   77 MEPAYLFIGSTHYITHVFMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRNK 1027
            MEPAYLFIGSTHYITHVFMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDN FIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRNK
Sbjct:    1 MEPAYLFIGSTHYITHVFMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNKFIEINRMESNPYSFCQMALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIFATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLISGSDDKIICFWDVFRNK 317          
BLAST of ATP-dependent RNA helicase dbp7 vs. Planmine SMEST
Match: SMESG000076568.1 (SMESG000076568.1)

HSP 1 Score: 51.2174 bits (121), Expect = 5.189e-7
Identity = 48/265 (18.11%), Postives = 111/265 (41.89%), Query Frame = 2
Query:  101 GSTHYITHVFMLNKDLY--SGDIDGNIIKWNFESRRCEIKWKAHDKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQMALHRSSNNDY-EFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIKSYGMVMSISI-LNNKVMFVGYESGYVIMF--KEFQYHSAIKVADCIICMAVSENRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPG-----ISSVVFRQDGKIFATAGWDGLIRVF 862
            G   +++ V M +   +  SG  DG +  W+  S +   ++  H K +LS+ F      +V+  RDG +K W               N    C+  +    + D+   + F    E+ +I    + K +  +NL     +++     G + ++++  +  +   G + G  +++   E ++   ++  D I  +  S NR  +     + + + +++ N + + + K  ++ N       ++ + + QDG+       D +IRV+
Sbjct:   61 GHNGFVSDVVMSSDGQFALSGSWDGTLRLWDLTSGQTTRRFVGHTKDVLSVAFSADNRQIVSGSRDGTIKLW---------------NTLGVCKYTIQEDGHTDWVSCVRFSPTSENPSIVSCGWDKVVKVWNLSNCKLRTNHFGHNGYLNTVAVSPDGSLCASGGKDGQAMLWDLSEGRHLYTLEGGDIINALIFSPNRYWLCAATGSSIKIWDLE-NKVLVGDLKAEVIDNKSKATAEVTCLSWSQDGQTLFAGYSDNVIRVW 309          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GNB1L4.455e-2225.90G protein subunit beta 1 like [Source:HGNC Symbol;... [more]
GNB1L4.455e-2225.90G protein subunit beta 1 like [Source:HGNC Symbol;... [more]
RACK19.973e-817.71receptor for activated C kinase 1 [Source:HGNC Sym... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prp-176.493e-639.29Yeast PRP (Splicing factor) related [Source:UniPr... [more]
prp-176.493e-639.29Yeast PRP (Splicing factor) related [Source:UniPr... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG131922.749e-2022.83gene:FBgn0033653 transcript:FBtr0088031[more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gnb1l4.794e-2328.61guanine nucleotide binding protein (G protein), be... [more]
gnb1l4.794e-2328.61guanine nucleotide binding protein (G protein), be... [more]
rack12.351e-919.19receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gnb1l2.194e-2126.11guanine nucleotide binding protein (G protein), be... [more]
rack13.040e-818.08receptor for activated C kinase 1 [Source:NCBI gen... [more]
rack11.296e-618.15receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnb1l7.808e-2027.33guanine nucleotide binding protein (G protein), be... [more]
Gnb1l7.808e-2027.33guanine nucleotide binding protein (G protein), be... [more]
Gnb1l6.353e-1726.80guanine nucleotide binding protein (G protein), be... [more]
Gnb1l8.573e-1328.25guanine nucleotide binding protein (G protein), be... [more]
Rack16.847e-817.71receptor for activated C kinase 1 [Source:MGI Symb... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54HW5|GNB1L_DICDI1.074e-2226.97Guanine nucleotide-binding protein subunit beta-li... [more]
sp|Q9BYB4|GNB1L_HUMAN2.140e-2125.90Guanine nucleotide-binding protein subunit beta-li... [more]
sp|B8NG55|ASA1_ASPFN2.008e-2024.65ASTRA-associated protein 1 OS=Aspergillus flavus (... [more]
sp|C9STX5|ASA1_VERA11.107e-1922.93ASTRA-associated protein 1 OS=Verticillium alfalfa... [more]
sp|F1DLK1|DSE1_NICBE2.352e-1923.66Protein DECREASED SIZE EXCLUSION LIMIT 1 OS=Nicoti... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P5G91.164e-3226.63WD_REPEATS_REGION domain-containing protein OS=Pom... [more]
A0A2C9LBJ83.780e-3130.62Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2B4RLP27.823e-3129.64Guanine nucleotide-binding protein subunit beta-li... [more]
A0A0B6ZKB42.940e-2927.02WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A1X2H3311.372e-2827.91WD40-repeat-containing domain protein OS=Syncephal... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gnb1l9.305e-1824.43guanine nucleotide binding protein (G protein), be... [more]
rack16.407e-918.45guanine nucleotide-binding protein subunit beta-2-... [more]
ENSAMXT00000047239.11.364e-818.08receptor of activated protein C kinase 1 [Source:N... [more]
ENSAMXT00000007662.27.947e-716.99receptor of activated protein C kinase 1 [Source:N... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002506.11.450e-717.71pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445262.221e-2326.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gnb1l5.599e-2928.01G protein subunit beta 1 like [Source:NCBI gene;Ac... [more]
gnb1l1.413e-2427.36G protein subunit beta 1 like [Source:NCBI gene;Ac... [more]
gnb1l3.659e-2226.16G protein subunit beta 1 like [Source:NCBI gene;Ac... [more]
rack12.831e-818.45receptor for activated C kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of ATP-dependent RNA helicase dbp7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005283.10.000e+099.68SMESG000005283.1[more]
SMESG000076568.15.189e-718.11SMESG000076568.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002535 ID=SMED30002535|Name=ATP-dependent RNA helicase dbp7|organism=Schmidtea mediterranea sexual|type=transcript|length=1041bp
CATGATTTCAGTATTATTAAATTATTATTTAATTTTTATTATTTAAAGTA
TAGGAAATAAGCGTTATTATATATTAATGGAACCAGCTTATCTGTTCATT
GGGTCAACGCATTATATTACACATGTATTCATGTTGAATAAAGATTTGTA
TTCTGGTGATATTGATGGAAATATAATTAAATGGAATTTTGAGTCCAGGC
GTTGTGAAATTAAATGGAAAGCACATGATAAATGTATTTTAAGTATTCAA
TTTTTGAAAAGCAAAAATCATTTAGTAACTCATGGTAGAGATGGATACCT
GAAATTTTGGCTGAAATCAGATAATACATTTATTGAAATAAACCGTATGG
AATCAAATCCTTATAGTTTCTGTCAAATGGCATTACATCGTTCGAGTAAT
AATGATTATGAGTTTATTTCTTTTGATCTAAATGACGAAGATCATACTAT
TGAAATAGTTGAATATCCTAAAGACATAATTACATACAACTTGTGTGTTA
AACCCTCTAAAAGCCATTCTATAAAATCATATGGAATGGTTATGTCTATT
TCGATATTAAACAACAAAGTAATGTTTGTAGGATATGAATCTGGATACGT
GATTATGTTCAAAGAATTTCAATATCACTCAGCTATTAAAGTAGCTGATT
GTATAATATGCATGGCAGTTAGTGAAAATCGATTACTAATTATTGGAACT
CCGGATAATGAATTAATTGTTATAGAAATTGATAGCAATTTCATTTCTAT
GAATGAAAGAAAGAAAATATTACTTAAAAACCCTGGAATTAGTTCAGTTG
TATTTAGACAAGATGGGAAAATATTTGCAACGGCTGGTTGGGATGGACTA
ATTAGAGTATTTACTAGCAAGGGCTTGAAACAGTTAGTGGCTCTCAAATG
GAATGTTGACCATTGCCAAACTGACAAAACTAACCGCCATTTGGCTGTCG
CTTTCACTGCTGAGAATTATTTGATATCGGGATCCGATGATAAAATTATC
TGTTTTTGGGATGTTTTTCGTAATAAATAAATTATGACTTG
back to top

protein sequence of SMED30002535-orf-1

>SMED30002535-orf-1 ID=SMED30002535-orf-1|Name=SMED30002535-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MEPAYLFIGSTHYITHVFMLNKDLYSGDIDGNIIKWNFESRRCEIKWKAH
DKCILSIQFLKSKNHLVTHGRDGYLKFWLKSDNTFIEINRMESNPYSFCQ
MALHRSSNNDYEFISFDLNDEDHTIEIVEYPKDIITYNLCVKPSKSHSIK
SYGMVMSISILNNKVMFVGYESGYVIMFKEFQYHSAIKVADCIICMAVSE
NRLLIIGTPDNELIVIEIDSNFISMNERKKILLKNPGISSVVFRQDGKIF
ATAGWDGLIRVFTSKGLKQLVALKWNVDHCQTDKTNRHLAVAFTAENYLI
SGSDDKIICFWDVFRNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 225..263
e-value: 0.2
score: 20.7
coord: 40..79
e-value: 0.14
score: 21.2
coord: 274..312
e-value: 0.32
score: 20.0
coord: 180..217
e-value: 79.0
score: 5.0
coord: 142..179
e-value: 88.0
score: 4.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 297..312
e-value: 0.17
score: 12.8
coord: 238..262
e-value: 0.26
score: 12.2
coord: 42..78
e-value: 0.19
score: 12.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 297..317
score: 8.67
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 47..78
score: 9.239
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..96
e-value: 5.0E-9
score: 37.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 97..317
e-value: 6.3E-18
score: 67.2
NoneNo IPR availablePANTHERPTHR19854:SF1GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-LIKE PROTEIN 1coord: 5..314
NoneNo IPR availablePANTHERPTHR19854TRANSDUCIN BETA-LIKE 3coord: 5..314
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 299..313
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 24..88
score: 10.944
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 231..317
score: 10.047
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 6..312