Microprocessor complex subunit DGCR8

Overview
NameMicroprocessor complex subunit DGCR8
Smed IDSMED30002531
Length (bp)2661
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microprocessor complex subunit DGCR8 (SMED30002531) t-SNE clustered cells

Violin plots show distribution of expression levels for Microprocessor complex subunit DGCR8 (SMED30002531) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microprocessor complex subunit DGCR8 (SMED30002531) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microprocessor complex subunit DGCR8 (SMED30002531) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002531

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30002531SMESG000030239.1 SmedASXL_017034SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Human
Match: DGCR8 (DGCR8 microprocessor complex subunit [Source:HGNC Symbol;Acc:HGNC:2847])

HSP 1 Score: 124.02 bits (310), Expect = 2.025e-28
Identity = 84/280 (30.00%), Postives = 130/280 (46.43%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINL-----LRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     K N  NL     L+ +M  L EE + T +
Sbjct:  501 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQY--AKKNKPNLHILSKLQEEMKRLAEEREETRK 751          

HSP 2 Score: 76.2554 bits (186), Expect = 1.769e-13
Identity = 46/139 (33.09%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  230 NYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
            ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+TP
Sbjct:  242 DFDNDVDALLEEGLCAPKKRRTEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQSSDLTP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Human
Match: DGCR8 (DGCR8 microprocessor complex subunit [Source:HGNC Symbol;Acc:HGNC:2847])

HSP 1 Score: 92.8189 bits (229), Expect = 1.151e-18
Identity = 76/280 (27.14%), Postives = 117/280 (41.79%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINL-----LRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++           FE                            TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     K N  NL     L+ +M  L EE + T +
Sbjct:  501 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNF---------FEC------------------------ARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQY--AKKNKPNLHILSKLQEEMKRLAEEREETRK 718          

HSP 2 Score: 75.8702 bits (185), Expect = 2.053e-13
Identity = 46/139 (33.09%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  230 NYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
            ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+TP
Sbjct:  242 DFDNDVDALLEEGLCAPKKRRTEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQSSDLTP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Human
Match: DGCR8 (DGCR8 microprocessor complex subunit [Source:HGNC Symbol;Acc:HGNC:2847])

HSP 1 Score: 92.8189 bits (229), Expect = 1.151e-18
Identity = 76/280 (27.14%), Postives = 117/280 (41.79%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINL-----LRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++           FE                            TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     K N  NL     L+ +M  L EE + T +
Sbjct:  501 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNF---------FEC------------------------ARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQY--AKKNKPNLHILSKLQEEMKRLAEEREETRK 718          

HSP 2 Score: 75.8702 bits (185), Expect = 2.053e-13
Identity = 46/139 (33.09%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  230 NYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
            ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+TP
Sbjct:  242 DFDNDVDALLEEGLCAPKKRRTEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQSSDLTP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Celegans
Match: pash-1 (PArtner of DroSHa (DRSH-1 interactor) [Source:UniProtKB/TrEMBL;Acc:U4PEM4])

HSP 1 Score: 56.9954 bits (136), Expect = 5.551e-8
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  392 KFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLE 601
            K NPL  PEGW  + H SGM  Y H  T+VVT S PY ++      H +P+ SIPCL  K+++  ++++E
Sbjct:  172 KSNPL--PEGWTVISHQSGMPVYYHKFTRVVTHSKPYLVEGIVRD-HEIPVSSIPCLYKKIMDELHENVE 238          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Fly
Match: pasha (gene:FBgn0039861 transcript:FBtr0085820)

HSP 1 Score: 143.665 bits (361), Expect = 3.054e-35
Identity = 109/358 (30.45%), Postives = 164/358 (45.81%), Query Frame = 2
Query: 1103 PDQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIP--------------NKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISR-SNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFDMHEMQNLLLEDRGGVKN---NLINLLRRKMLEL 2119
            P+QL  YC+K+F F  +     RF    +          NR  IK            NI+    P  T+ +K P               K   ++  G++F CIL+ Y Q+A    P ++     +    +  T  V    Y  G G +KK AK +A  +TLEILIP   +KI                  T N+          A S++ S+FD++ I DPRV  +  K    +P  IL+ C+ R+   D  +   I+R +N  N F + +G    +  C+NKREG+QLASQ +L  LHPHIQ WG +LRLYG +S K  K   + E +  +L+ +  V      +++ L+ +ML+L
Sbjct:  288 PEQLNTYCQKLFKF--KVIRVLRF----RSWNARRKFTKNRKHIK------------NIQRPTLPDGTKLIKFPILANAGEGSTNPRGRKEWIMNPNGKSFVCILHEYVQHALKTQPTYEFKELQNAATPYSATVSVNNLKYGTGYGTSKKQAKSEAARETLEILIPDVKDKI------------------TGNNKDQKSGTAKKAQSDL-SVFDDIRIEDPRVTEFCNKTTEPSPNAILLTCLQRNYGSDVQISQEINRTANNKNEFTMTVGKHTAKVVCKNKREGKQLASQAILQILHPHIQTWGSLLRLYGNNSIKTFKEKKLEEQEITVLQSKAAVNQPNYAILDKLKSEMLKL 608          

HSP 2 Score: 75.8702 bits (185), Expect = 9.283e-14
Identity = 53/160 (33.12%), Postives = 84/160 (52.50%), Query Frame = 2
Query:  224 SSNYDND-VEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLK-DITPDVIEDKIKTDKTVDMETTELEDKSN 697
            SS +D+D +E+LL    DEK P+  +  +         +P+Y+ R   K + +EEK   +  +LPEGWV++ H+SGM  + H  T+V   S PY L T   + H VP+ +IPCL+++    E  ++E  K D  P V    +     +  E  ++E K N
Sbjct:  108 SSEFDDDEIENLL----DEKLPEELRESK---------QPKYEQRF--KTV-LEEKRLNHFEVLPEGWVQVTHNSGMPLFLHRKTRVCCASRPYFLGTGSARKHAVPLGAIPCLNYRRALEEESEVEQQKTDGAPPVAVCPMAGASALPAEAMDVEGKEN 251          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Fly
Match: pasha (gene:FBgn0039861 transcript:FBtr0337032)

HSP 1 Score: 143.665 bits (361), Expect = 3.054e-35
Identity = 109/358 (30.45%), Postives = 164/358 (45.81%), Query Frame = 2
Query: 1103 PDQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIP--------------NKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISR-SNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFDMHEMQNLLLEDRGGVKN---NLINLLRRKMLEL 2119
            P+QL  YC+K+F F  +     RF    +          NR  IK            NI+    P  T+ +K P               K   ++  G++F CIL+ Y Q+A    P ++     +    +  T  V    Y  G G +KK AK +A  +TLEILIP   +KI                  T N+          A S++ S+FD++ I DPRV  +  K    +P  IL+ C+ R+   D  +   I+R +N  N F + +G    +  C+NKREG+QLASQ +L  LHPHIQ WG +LRLYG +S K  K   + E +  +L+ +  V      +++ L+ +ML+L
Sbjct:  288 PEQLNTYCQKLFKF--KVIRVLRF----RSWNARRKFTKNRKHIK------------NIQRPTLPDGTKLIKFPILANAGEGSTNPRGRKEWIMNPNGKSFVCILHEYVQHALKTQPTYEFKELQNAATPYSATVSVNNLKYGTGYGTSKKQAKSEAARETLEILIPDVKDKI------------------TGNNKDQKSGTAKKAQSDL-SVFDDIRIEDPRVTEFCNKTTEPSPNAILLTCLQRNYGSDVQISQEINRTANNKNEFTMTVGKHTAKVVCKNKREGKQLASQAILQILHPHIQTWGSLLRLYGNNSIKTFKEKKLEEQEITVLQSKAAVNQPNYAILDKLKSEMLKL 608          

HSP 2 Score: 75.8702 bits (185), Expect = 9.283e-14
Identity = 53/160 (33.12%), Postives = 84/160 (52.50%), Query Frame = 2
Query:  224 SSNYDND-VEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLK-DITPDVIEDKIKTDKTVDMETTELEDKSN 697
            SS +D+D +E+LL    DEK P+  +  +         +P+Y+ R   K + +EEK   +  +LPEGWV++ H+SGM  + H  T+V   S PY L T   + H VP+ +IPCL+++    E  ++E  K D  P V    +     +  E  ++E K N
Sbjct:  108 SSEFDDDEIENLL----DEKLPEELRESK---------QPKYEQRF--KTV-LEEKRLNHFEVLPEGWVQVTHNSGMPLFLHRKTRVCCASRPYFLGTGSARKHAVPLGAIPCLNYRRALEEESEVEQQKTDGAPPVAVCPMAGASALPAEAMDVEGKEN 251          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Fly
Match: pasha (gene:FBgn0039861 transcript:FBtr0337031)

HSP 1 Score: 142.51 bits (358), Expect = 3.905e-35
Identity = 109/358 (30.45%), Postives = 164/358 (45.81%), Query Frame = 2
Query: 1103 PDQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIP--------------NKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISR-SNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFDMHEMQNLLLEDRGGVKN---NLINLLRRKMLEL 2119
            P+QL  YC+K+F F  +     RF    +          NR  IK            NI+    P  T+ +K P               K   ++  G++F CIL+ Y Q+A    P ++     +    +  T  V    Y  G G +KK AK +A  +TLEILIP   +KI                  T N+          A S++ S+FD++ I DPRV  +  K    +P  IL+ C+ R+   D  +   I+R +N  N F + +G    +  C+NKREG+QLASQ +L  LHPHIQ WG +LRLYG +S K  K   + E +  +L+ +  V      +++ L+ +ML+L
Sbjct:  226 PEQLNTYCQKLFKF--KVIRVLRF----RSWNARRKFTKNRKHIK------------NIQRPTLPDGTKLIKFPILANAGEGSTNPRGRKEWIMNPNGKSFVCILHEYVQHALKTQPTYEFKELQNAATPYSATVSVNNLKYGTGYGTSKKQAKSEAARETLEILIPDVKDKI------------------TGNNKDQKSGTAKKAQSDL-SVFDDIRIEDPRVTEFCNKTTEPSPNAILLTCLQRNYGSDVQISQEINRTANNKNEFTMTVGKHTAKVVCKNKREGKQLASQAILQILHPHIQTWGSLLRLYGNNSIKTFKEKKLEEQEITVLQSKAAVNQPNYAILDKLKSEMLKL 546          

HSP 2 Score: 76.2554 bits (186), Expect = 5.800e-14
Identity = 53/160 (33.12%), Postives = 84/160 (52.50%), Query Frame = 2
Query:  224 SSNYDND-VEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLK-DITPDVIEDKIKTDKTVDMETTELEDKSN 697
            SS +D+D +E+LL    DEK P+  +  +         +P+Y+ R   K + +EEK   +  +LPEGWV++ H+SGM  + H  T+V   S PY L T   + H VP+ +IPCL+++    E  ++E  K D  P V    +     +  E  ++E K N
Sbjct:   46 SSEFDDDEIENLL----DEKLPEELRESK---------QPKYEQRF--KTV-LEEKRLNHFEVLPEGWVQVTHNSGMPLFLHRKTRVCCASRPYFLGTGSARKHAVPLGAIPCLNYRRALEEESEVEQQKTDGAPPVAVCPMAGASALPAEAMDVEGKEN 189          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Zebrafish
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-3421])

HSP 1 Score: 122.479 bits (306), Expect = 3.911e-28
Identity = 82/274 (29.93%), Postives = 133/274 (48.54%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFD----MHEMQNLLLEDRGGVKNNLINLLRRKMLELNEE 2128
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            + +    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S K VK+ +    + E+Q    +++  +  +++N LR +M++L  E
Sbjct:  483 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------VEGDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQMLHPHVKNWGSLLRMYGRESNKMVKKENSDKSVIELQQYAKKNKPNL--HILNKLREEMMKLARE 727          

HSP 2 Score: 78.9518 bits (193), Expect = 1.437e-14
Identity = 48/142 (33.80%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEE--KVKFNPLL--LPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
             S+S   ++DNDV+ LLE+ +    PK  +  ++K   +  +    +  V   + K++   K +  P    LP+GW+  FH+SG+  Y H  T+VVTWS PY L T   + H  P  SIPCL +K +  E ++ E   ++TP
Sbjct:  214 LSYSYEEDFDNDVDALLEEGM--PMPKKRRVAEDKYAGDSDHHSDGEAGVQPMMTKIKTILKSRGRPPTEPLPDGWIMTFHNSGIPVYLHRETRVVTWSRPYFLGTGSIRKHDPPTSSIPCLHYKKM-KEQEEREQNGEVTP 352          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Zebrafish
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-3421])

HSP 1 Score: 122.094 bits (305), Expect = 6.666e-28
Identity = 82/274 (29.93%), Postives = 133/274 (48.54%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFD----MHEMQNLLLEDRGGVKNNLINLLRRKMLELNEE 2128
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            + +    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S K VK+ +    + E+Q    +++  +  +++N LR +M++L  E
Sbjct:  510 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------VEGDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQMLHPHVKNWGSLLRMYGRESNKMVKKENSDKSVIELQQYAKKNKPNL--HILNKLREEMMKLARE 754          

HSP 2 Score: 79.7221 bits (195), Expect = 8.302e-15
Identity = 54/182 (29.67%), Postives = 92/182 (50.55%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEE--KVKFNPLL--LPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDV-------IEDKIKTDKTVDMETTELEDKSNIVTEQDKN 721
             S+S   ++DNDV+ LLE+ +    PK  +  ++K   +  +    +  V   + K++   K +  P    LP+GW+  FH+SG+  Y H  T+VVTWS PY L T   + H  P  SIPCL +K +  E ++ E   ++TP          E+ I  ++  + ++T  E+ +   T +D +
Sbjct:  225 LSYSYEEDFDNDVDALLEEGM--PMPKKRRVAEDKYAGDSDHHSDGEAGVQPMMTKIKTILKSRGRPPTEPLPDGWIMTFHNSGIPVYLHRETRVVTWSRPYFLGTGSIRKHDPPTSSIPCLHYKKM-KEQEEREQNGEVTPTAEISPVKSGEEGISLERADEPDSTATEEPTGRPTSEDPD 403          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:NCBI gene;Acc:100144670])

HSP 1 Score: 124.405 bits (311), Expect = 1.565e-28
Identity = 82/279 (29.39%), Postives = 136/279 (48.75%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKN----NLINLLRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F   ++ +C +K                          D++    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     KN    +++N L+ +M  L +E + T +
Sbjct:  500 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDF---VKQTCMEK------------------------PKDTDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKIVKQETSDKSVIELQQYAK-KNKPNLHILNKLQEEMKRLAQEREETRK 750          

HSP 2 Score: 79.7221 bits (195), Expect = 1.213e-14
Identity = 53/145 (36.55%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  215 WSMSSNYDNDVEDLLEKS--------IDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHR--KVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDIT 619
            +S    +DNDV+ LLE+S        IDEKY  ++ +Q +        +   Q  V +   V+K   +    PL  P+GW+  FH+SG+  Y H  T+VVTWS PY L T   + H  PI SIPCL +K + + ND  E   D+ 
Sbjct:  239 YSYEDEFDNDVDALLEESLHTPKKRRIDEKYDIDSDHQSD-------GESSVQPMVTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGLPVYLHRETRVVTWSRPYFLGTGSIRKHDPPISSIPCLHYKKMKD-NDIKEQSNDVA 373          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:NCBI gene;Acc:100144670])

HSP 1 Score: 124.405 bits (311), Expect = 1.608e-28
Identity = 82/279 (29.39%), Postives = 136/279 (48.75%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKN----NLINLLRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F   ++ +C +K                          D++    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     KN    +++N L+ +M  L +E + T +
Sbjct:  491 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDF---VKQTCMEK------------------------PKDTDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKIVKQETSDKSVIELQQYAK-KNKPNLHILNKLQEEMKRLAQEREETRK 741          

HSP 2 Score: 80.1073 bits (196), Expect = 1.122e-14
Identity = 53/145 (36.55%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  215 WSMSSNYDNDVEDLLEKS--------IDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHR--KVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDIT 619
            +S    +DNDV+ LLE+S        IDEKY  ++ +Q +        +   Q  V +   V+K   +    PL  P+GW+  FH+SG+  Y H  T+VVTWS PY L T   + H  PI SIPCL +K + + ND  E   D+ 
Sbjct:  230 YSYEDEFDNDVDALLEESLHTPKKRRIDEKYDIDSDHQSD-------GESSVQPMVTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGLPVYLHRETRVVTWSRPYFLGTGSIRKHDPPISSIPCLHYKKMKD-NDIKEQSNDVA 364          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Xenopus
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:NCBI gene;Acc:100144670])

HSP 1 Score: 124.405 bits (311), Expect = 1.637e-28
Identity = 82/279 (29.39%), Postives = 136/279 (48.75%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKN----NLINLLRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F   ++ +C +K                          D++    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     KN    +++N L+ +M  L +E + T +
Sbjct:  482 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDF---VKQTCMEK------------------------PKDTDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKIVKQETSDKSVIELQQYAK-KNKPNLHILNKLQEEMKRLAQEREETRK 732          

HSP 2 Score: 78.9518 bits (193), Expect = 2.407e-14
Identity = 49/129 (37.98%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  215 WSMSSNYDNDVEDLLEKS--------IDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHR--KVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFK 571
            +S    +DNDV+ LLE+S        IDEKY  ++ +Q +        +   Q  V +   V+K   +    PL  P+GW+  FH+SG+  Y H  T+VVTWS PY L T   + H  PI SIPCL +K
Sbjct:  239 YSYEDEFDNDVDALLEESLHTPKKRRIDEKYDIDSDHQSD-------GESSVQPMVTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGLPVYLHRETRVVTWSRPYFLGTGSIRKHDPPISSIPCLHYK 358          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Mouse
Match: Dgcr8 (DGCR8, microprocessor complex subunit [Source:MGI Symbol;Acc:MGI:2151114])

HSP 1 Score: 123.635 bits (309), Expect = 2.041e-28
Identity = 91/306 (29.74%), Postives = 139/306 (45.42%), Query Frame = 2
Query: 1106 DQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSN---IETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS 2008
            ++ RNY +K F F +          VKK          NR M +   + ++ +  +N   I  SV  + T+K  + N N      G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S
Sbjct:  438 EEFRNYLEKRFDFEQ--------VTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPN------GKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRES 702          

HSP 2 Score: 73.9442 bits (180), Expect = 5.534e-13
Identity = 46/146 (31.51%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
             ++S   ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+ P
Sbjct:  235 LNFSYEDDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQNCDLAP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Mouse
Match: Dgcr8 (DGCR8, microprocessor complex subunit [Source:MGI Symbol;Acc:MGI:2151114])

HSP 1 Score: 123.635 bits (309), Expect = 2.041e-28
Identity = 91/306 (29.74%), Postives = 139/306 (45.42%), Query Frame = 2
Query: 1106 DQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSN---IETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS 2008
            ++ RNY +K F F +          VKK          NR M +   + ++ +  +N   I  SV  + T+K  + N N      G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S
Sbjct:  438 EEFRNYLEKRFDFEQ--------VTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPN------GKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRES 702          

HSP 2 Score: 73.9442 bits (180), Expect = 5.534e-13
Identity = 46/146 (31.51%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
             ++S   ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+ P
Sbjct:  235 LNFSYEDDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQNCDLAP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Mouse
Match: Gm49776 (predicted gene, 49776 [Source:MGI Symbol;Acc:MGI:6215291])

HSP 1 Score: 52.373 bits (124), Expect = 7.613e-8
Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 2
Query: 1901 ENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS 2008
            +NKR G+QLASQ +L  LHPH++ WG +LR+YG +S
Sbjct:    2 KNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRES 37          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Mouse
Match: Gm49776 (predicted gene, 49776 [Source:MGI Symbol;Acc:MGI:6215291])

HSP 1 Score: 52.373 bits (124), Expect = 7.613e-8
Identity = 21/36 (58.33%), Postives = 29/36 (80.56%), Query Frame = 2
Query: 1901 ENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS 2008
            +NKR G+QLASQ +L  LHPH++ WG +LR+YG +S
Sbjct:    2 KNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRES 37          
BLAST of Microprocessor complex subunit DGCR8 vs. UniProt/SwissProt
Match: sp|Q8WYQ5|DGCR8_HUMAN (Microprocessor complex subunit DGCR8 OS=Homo sapiens OX=9606 GN=DGCR8 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 9.727e-28
Identity = 84/280 (30.00%), Postives = 130/280 (46.43%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINL-----LRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +  +   + L+     K N  NL     L+ +M  L EE + T +
Sbjct:  501 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQY--AKKNKPNLHILSKLQEEMKRLAEEREETRK 751          

HSP 2 Score: 76.2554 bits (186), Expect = 8.494e-13
Identity = 46/139 (33.09%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  230 NYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
            ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+TP
Sbjct:  242 DFDNDVDALLEEGLCAPKKRRTEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQSSDLTP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. UniProt/SwissProt
Match: sp|A6QR44|DGCR8_BOVIN (Microprocessor complex subunit DGCR8 OS=Bos taurus OX=9913 GN=DGCR8 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.137e-27
Identity = 99/357 (27.73%), Postives = 163/357 (45.66%), Query Frame = 2
Query: 1106 DQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSN---IETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMH-----EMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQ 2146
            ++ RNY +K F F +          VKK          NR M +   + ++ +  +N   I  SV  + T+K  + N N      G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S  + + +       E+Q    +++  +  ++++ L+ +M  L EE + T +
Sbjct:  425 EEFRNYLEKRFDFEQ--------VTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPN------GKSEVCILHEYMQRVLKVRPVYSFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------RDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQFARKNKPNL--HILSKLQEEMRRLAEEREETRK 738          

HSP 2 Score: 71.2478 bits (173), Expect = 2.543e-11
Identity = 41/136 (30.15%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNEND 592
             ++S   ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL ++ + +  +
Sbjct:  235 LNFSYEDDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHGPPLTSIPCLHYRKMKDSEE 363          
BLAST of Microprocessor complex subunit DGCR8 vs. UniProt/SwissProt
Match: sp|Q9EQM6|DGCR8_MOUSE (Microprocessor complex subunit DGCR8 OS=Mus musculus OX=10090 GN=Dgcr8 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.427e-27
Identity = 91/306 (29.74%), Postives = 139/306 (45.42%), Query Frame = 2
Query: 1106 DQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSN---IETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS 2008
            ++ RNY +K F F +          VKK          NR M +   + ++ +  +N   I  SV  + T+K  + N N      G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            DSE    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    +   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S
Sbjct:  438 EEFRNYLEKRFDFEQ--------VTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPN------GKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------KDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRES 702          

HSP 2 Score: 73.9442 bits (180), Expect = 3.871e-12
Identity = 46/146 (31.51%), Postives = 77/146 (52.74%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSI--------DEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITP 622
             ++S   ++DNDV+ LLE+ +        +EKY  ++ +     P + +   +      + V+K   +    PL  P+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P+ SIPCL +K + + N++ E   D+ P
Sbjct:  235 LNFSYEDDFDNDVDALLEEGLCAPKKRRMEEKYGGDSDH-----PSDGETSVQPMMTKIKTVLKSRGRPPTEPL--PDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKD-NEEREQNCDLAP 372          
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Match: C1LG44 (Protein DGCR8 (DiGeorge syndrome critical region 8) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.556e-57
Identity = 108/302 (35.76%), Postives = 178/302 (58.94%), Query Frame = 2
Query: 1316 KIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLIST-ISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTY---AKFKVPFENVPIIVFHPDS 2209
            K P + M I++ G+++ CIL+ YCQN     P ++     +  + +++T  + GT Y  G G++KK A+ +A  K LE+LIP F          K++    H            Q     A      +FD++ +TDPR++  +++M   TPYN+LVEC++R+CV +S L S+ IS+    + F L+L +  V+  C+NKREGR L++Q++LA+LHP +  W G+LR+YGP SKP K+ ++  +Q+  ++ +  VK +LI LL+ KM EL ++W+ ++ +     KF V   N+P++ FHPDS
Sbjct:   66 KQPKEGM-INMTGKSYVCILHEYCQNVIRHPPTYQTTVLENDKNPYQMTVFINGTPYGTGTGQSKKCARLEAARKALEVLIPDFQ---------KIVCTSTH------------QTGPVVASDRDMQLFDSISVTDPRLYELSVRMALPTPYNLLVECLSRNCVPESDLKSSMISQGRSKHFFTLQLREHTVKVRCKNKREGRHLSAQHLLARLHPEVSTWSGLLRMYGPGSKPDKKNELETIQDAQIQQKSAVKASLIRLLKAKMNELADQWEKSDGSIHPKGKFFVSPYNLPVVAFHPDS 345          
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Match: A0A5K4EHZ9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.690e-57
Identity = 106/292 (36.30%), Postives = 169/292 (57.88%), Query Frame = 2
Query: 1346 LAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLIS-TISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTY---AKFKVPFENVPIIVFHPDS 2209
            + G+++ CIL+ YCQN     P ++     +  + +++T  + G  Y  G G++KK A+ +A  K LE+LIP F          K++  D+H            Q     A      +FD++ +TDPR++  +++M   TPYN+LVEC+NR CV +S L S  IS+    + F L+L +  V+  C+NKREGR L++Q++LA+LHP +  W G+LR+YGP SKP KR ++  +Q+   + +  VK +LI LL+ KM EL ++W+ +  +     KF V   N+P++ FHPDS
Sbjct:    1 MTGKSYVCILHEYCQNVIRRPPTYQTTVLENEKNPYQMTVFINGNPYGTGAGQSKKCARLEAARKALEVLIPDF---------QKIVCNDSH------------QTGPVVASDRDMQLFDSISVTDPRLYELSVRMALPTPYNLLVECLNRSCVPESDLKSNMISQGRSKHFFTLQLREHTVKVRCKNKREGRHLSAQHLLARLHPEVNTWSGLLRMYGPGSKPDKRNELETIQDAQTQQKSAVKASLIRLLKAKMSELADQWEKSGGSLNPKGKFFVSPYNLPVVAFHPDS 271          
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Match: A0A183RM53 (DRBM domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.832e-57
Identity = 106/292 (36.30%), Postives = 169/292 (57.88%), Query Frame = 2
Query: 1346 LAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLIS-TISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTY---AKFKVPFENVPIIVFHPDS 2209
            + G+++ CIL+ YCQN     P ++     +  + +++T  + G  Y  G G++KK A+ +A  K LE+LIP F          K++  D+H            Q     A      +FD++ +TDPR++  +++M   TPYN+LVEC+NR CV +S L S  IS+    + F L+L +  V+  C+NKREGR L++Q++LA+LHP +  W G+LR+YGP SKP KR ++  +Q+   + +  VK +LI LL+ KM EL ++W+ +  +     KF V   N+P++ FHPDS
Sbjct:    1 MTGKSYVCILHEYCQNVIRRPPTYQTTVLENEKNPYQMTVFINGNPYGTGTGQSKKCARLEAARKALEVLIPDF---------QKIVCNDSH------------QTGPVVASDRDMQLFDSISVTDPRLYELSVRMALPTPYNLLVECLNRSCVPESDLKSNMISQGRSKHFFTLQLREHTVKVRCKNKREGRHLSAQHLLARLHPEVNTWSGLLRMYGPGSKPDKRNELETIQDAQTQQKSAVKASLIRLLKAKMSELADQWEKSGGSLNPKGKFFVSPYNLPVVAFHPDS 271          
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Match: A0A1S8X5Q2 (DRBM domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_02127 PE=4 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.464e-57
Identity = 113/299 (37.79%), Postives = 175/299 (58.53%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTY---AKFKVPFENVPIIVFHPDSR 2212
            K   I+L G++F CIL+ YCQ      P ++     +  + +++T  +GGT YA G G++KK A+ +A    L  LIP F         DK+  + +HN   T+  TV        A      +FD + ITDPR++  +++M   TP+N LVEC++R+CV +S L  + +S+    + F L+L +  ++  C NKREGR LA+Q++LA+LHP I  WGGILR+YGP +KP KR ++  +Q    +++  VK +LI LL+ KM EL ++W+   Q      KF V  +N+P++ FHPDS+
Sbjct:   85 KEGVINLTGKSFVCILHEYCQTVIRSPPTYQTVVLENEKNPYKLTVLIGGTPYATGVGRSKKQARLEAARNALSRLIPDF---------DKI--VGSHN--PTNGPTV--------ASERDLQLFDGVSITDPRLYEMSVRMAFPTPHNCLVECLSRNCVPESDLKANMMSQGRSKHFFTLQLREHSIKVPCRNKREGRHLAAQHLLARLHPEITSWGGILRIYGPGTKPDKRGELETIQGAQNQEKSAVKTSLIRLLKTKMRELADQWEKGGQNIHHKGKFIVSADNLPVVTFHPDSQ 362          
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Match: A0A074ZUH6 (DRBM domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13119 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.956e-57
Identity = 112/295 (37.97%), Postives = 174/295 (58.98%), Query Frame = 2
Query: 1340 IDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTY---AKFKVPFENVPIIVFHPDSR 2212
            I+L G++F CIL+ YCQ      P ++     +  + +++T  +GGT YA G G++KK A+ +A    L  LIP F         DK+  + +HN   T+  TV        A      +FD + ITDPR++  +++M   TP+N LVEC++R+CV +S L  + +S+    + F L+L +  ++  C NKREGR LA+Q++LA+LHP I  WGGILR+YGP +KP KR ++  +Q    +++  VK +LI LL+ KM EL ++W+   Q      KF V  +N+P++ FHPDS+
Sbjct:    5 INLTGKSFVCILHEYCQTVIRSPPTYQTVVLENEKNPYKLTVLIGGTPYATGVGRSKKQARLEAARNALSRLIPDF---------DKI--VGSHN--PTNGPTV--------ASERDLQLFDGVSITDPRLYEMSVRMAFPTPHNCLVECLSRNCVPESDLKANMMSQGRSKHFFTLQLREHSIKVPCRNKREGRHLAAQHLLARLHPEITSWGGILRIYGPGTKPDKRGELETIQGAQNQEKSAVKTSLIRLLKTKMRELADQWEKGGQNIHHKGKFIVSADNLPVVTFHPDSQ 278          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Cavefish
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:NCBI gene;Acc:103025771])

HSP 1 Score: 120.939 bits (302), Expect = 1.267e-27
Identity = 82/280 (29.29%), Postives = 136/280 (48.57%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDS-KPVKRFD----MHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F  +     P                            + +    F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG +S K VK+ +    + E+Q    +++  +  +++N L+ +M +L +E + T +
Sbjct:  513 KEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDFVKQTSEEKP---------------------------VEGDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPGKNQKSEYVMTCGKHSVRGWCKNKRVGKQLASQKILQMLHPHVKNWGSLLRMYGRESNKMVKKENSDKSVIELQQFAKKNKPNL--HILNKLQEEMRKLAKEREETQK 763          

HSP 2 Score: 78.1814 bits (191), Expect = 2.245e-14
Identity = 45/145 (31.03%), Postives = 79/145 (54.48%), Query Frame = 2
Query:  209 FSWSMSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEE--KVKFNPLL--LPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVI 631
              ++   ++DNDV+ LLE+ +    PK  +  ++K   +  ++   ++ V   + K++   K +  P    LP+GW+  FH+SG+  Y H  ++VVTWS PY L T   + H  P  SIPCL +K +  E ++ E   ++TP+ +
Sbjct:  235 LGYAYEEDFDNDVDALLEEGM--PVPKKMRLAEDKYQADSDHQSDGESGVQPMMTKIKTVLKSRGRPPTEPLPDGWLMTFHNSGIPVYLHRESRVVTWSRPYFLGTGSIRKHDPPTSSIPCLHYKKM-KEQEEREQNGEVTPNTV 376          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Nematostella
Match: EDO44598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV81])

HSP 1 Score: 117.087 bits (292), Expect = 5.773e-28
Identity = 71/226 (31.42%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISR---SNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLY 1996
            K   I+  G+    IL+ Y Q    V P +      +    F     + G  Y  GEG +K++AKQ A    LE+LIP   NKI            NH + S                 E + IFD + I D +VF  T K  S++PY+IL EC+ R+  +    I    +     + + +++          C+NK+ GRQLA+Q +L KLHPHI+ WG +LR+Y
Sbjct:  205 KEWVINPGGKTPVAILHEYAQRELKVKPEYSHTEGNNAATPFVAEVRISGMVYGKGEGASKRLAKQHAAETALEVLIPEVFNKI-----------SNHEITS-----------------EEHQIFDKLKIDDSKVFEVTTKSGSLSPYHILQECLKRYQGVYQSTIDFKMKPEPDQRQHTYEITCAGHTATGFCKNKKIGRQLAAQAILKKLHPHIKTWGALLRIY 402          

HSP 2 Score: 57.7658 bits (138), Expect = 1.244e-8
Identity = 24/58 (41.38%), Postives = 33/58 (56.90%), Query Frame = 2
Query:  389 VKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCL 562
            +K   L LP+GW+ L H SG   Y H  T+V TWS PY + +   + H +P  +IPC 
Sbjct:    1 MKLPNLSLPDGWLALNHRSGGIIYLHRPTRVCTWSRPYHIGSGSVRKHDIPAAAIPCF 58          
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Medaka
Match: dgcr8 (DGCR8 microprocessor complex subunit [Source:ZFIN;Acc:ZDB-GENE-030131-3421])

HSP 1 Score: 120.553 bits (301), Expect = 1.586e-27
Identity = 82/280 (29.29%), Postives = 139/280 (49.64%), Query Frame = 2
Query: 1328 KNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNR-HCVLDSHL-ISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPD-SKPVKRFD----MHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQ 2146
            K   I+  G++  CIL+ Y Q    V P++      +    F  +  + G  Y  G   +KK+AK KA   TLEILIP F   ++ +  +K +  D                            F+++ I D RV+  T K   ++PY IL EC+ R H + D+ +    I   N+ + + +  G   V+  C+NKR G+QLASQ +L  LHPH++ WG +LR+YG + SK VK+ +    + E+Q    +++  +  +++N L+ +M++L  + + T +
Sbjct:  497 KEFVINPNGKSEVCILHEYMQRVLKVRPVYDFFDCENSSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLEILIPDF---VKQTAEEKPVEGDE------------------------LEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGMGDTSIKFEVIPDKNQRSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQMLHPHVKNWGSLLRMYGRESSKMVKKENSDKSVIELQQYAKKNKPNL--HILNKLQEEMMKLAAQREETRK 747          

HSP 2 Score: 72.4034 bits (176), Expect = 1.256e-12
Identity = 40/124 (32.26%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  233 YDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEE--KVKFNPLL--LPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNEND 592
            +D DV+ LLE+ +    PK  +  ++K   +  ++   +  V   + K++   K +  P    LP+GW+  FH+SG+  Y H  T+VVTWS PY + T   + H  P  SIPCL +K +  +++
Sbjct:  229 FDTDVDALLEEGM--PMPKKMRQAEDKYGGDSDHQSDGEGGVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGIPVYLHRETRVVTWSRPYFIGTGSIRKHDPPTSSIPCLHYKKMREQDE 350          
BLAST of Microprocessor complex subunit DGCR8 vs. Planmine SMEST
Match: SMESG000030239.1 (SMESG000030239.1)

HSP 1 Score: 1249.96 bits (3233), Expect = 0.000e+0
Identity = 663/668 (99.25%), Postives = 665/668 (99.55%), Query Frame = 2
Query:  221 MSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVDMETTELEDKSNIVTEQDKNSFXXXXXXXXXXXXXXXXXXXXXANDETSGKEIVLPKQYQIEPINHKPNRAKHSSANDVIRNTNTVVPSKRRKTVSFDEQVELNKQTDKISXXXXXXXXXARKTKTEAPDEINPXXXXXXXXXXXXEPDQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTYAKFKVPFENVPIIVFHPDSRDQSK 2224
            MSSNYDNDVEDLLEKSIDEKYPKN KNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVD+ETTELEDKSNIVTEQDKNSFIEPIEKDIEEGEIESSDEGEE NDETSGKEIVLPKQYQIEPINHKPNRAKHSSAND+IRNTNTVVPSKRRKTVSFDEQVELNKQTDKISNNDNIDNDNARKTKTEAPDEINPALDLLDKSAKLLEPDQLRNYCKKMFTFVEEAKHFPRFFFVKKK KNTNPNNTNRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTYAKFKVPFENVPIIVFHPDSRDQSK
Sbjct:    1 MSSNYDNDVEDLLEKSIDEKYPKNTKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVDVETTELEDKSNIVTEQDKNSFIEPIEKDIEEGEIESSDEGEEVNDETSGKEIVLPKQYQIEPINHKPNRAKHSSANDLIRNTNTVVPSKRRKTVSFDEQVELNKQTDKISNNDNIDNDNARKTKTEAPDEINPALDLLDKSAKLLEPDQLRNYCKKMFTFVEEAKHFPRFFFVKKKVKNTNPNNTNRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTYAKFKVPFENVPIIVFHPDSRDQSK 668          
BLAST of Microprocessor complex subunit DGCR8 vs. Planmine SMEST
Match: SMESG000030239.1 (SMESG000030239.1)

HSP 1 Score: 1245.34 bits (3221), Expect = 0.000e+0
Identity = 663/669 (99.10%), Postives = 665/669 (99.40%), Query Frame = 2
Query:  221 MSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVDMETTELEDKSNIVTEQDKNSFXXXXXXXXXXXXXXXXXXXXXANDETSGKEIVLPKQYQIEPINHKPNRAKHSSANDVIRNTNTVVPSKRRKTVSFDEQVELNKQTDKISXXXXXXXXXARKTKTEAPDEINPXXXXXXXXXXXXEPDQLRNYCKKMFTFVEEAKHFPRFFFVXXXXXXXXXXXXXRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEW-QSTNQTYAKFKVPFENVPIIVFHPDSRDQSK 2224
            MSSNYDNDVEDLLEKSIDEKYPKN KNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVD+ETTELEDKSNIVTEQDKNSFIEPIEKDIEEGEIESSDEGEE NDETSGKEIVLPKQYQIEPINHKPNRAKHSSAND+IRNTNTVVPSKRRKTVSFDEQVELNKQTDKISNNDNIDNDNARKTKTEAPDEINPALDLLDKSAKLLEPDQLRNYCKKMFTFVEEAKHFPRFFFVKKK KNTNPNNTNRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEW QSTNQTYAKFKVPFENVPIIVFHPDSRDQSK
Sbjct:    1 MSSNYDNDVEDLLEKSIDEKYPKNTKNQQNKCPFNYKNKPRYQNRVHRKVIKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEPHQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVDVETTELEDKSNIVTEQDKNSFIEPIEKDIEEGEIESSDEGEEVNDETSGKEIVLPKQYQIEPINHKPNRAKHSSANDLIRNTNTVVPSKRRKTVSFDEQVELNKQTDKISNNDNIDNDNARKTKTEAPDEINPALDLLDKSAKLLEPDQLRNYCKKMFTFVEEAKHFPRFFFVKKKVKNTNPNNTNRPMIKPAEQGQQAVTNSNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFKANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFSNKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDITDPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLKLGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVKRFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQQSTNQTYAKFKVPFENVPIIVFHPDSRDQSK 669          
The following BLAST results are available for this feature:
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DGCR82.025e-2830.00DGCR8 microprocessor complex subunit [Source:HGNC ... [more]
DGCR81.151e-1827.14DGCR8 microprocessor complex subunit [Source:HGNC ... [more]
DGCR81.151e-1827.14DGCR8 microprocessor complex subunit [Source:HGNC ... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pash-15.551e-842.86PArtner of DroSHa (DRSH-1 interactor) [Source:Uni... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pasha3.054e-3530.45gene:FBgn0039861 transcript:FBtr0085820[more]
pasha3.054e-3530.45gene:FBgn0039861 transcript:FBtr0337032[more]
pasha3.905e-3530.45gene:FBgn0039861 transcript:FBtr0337031[more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dgcr83.911e-2829.93DGCR8 microprocessor complex subunit [Source:ZFIN;... [more]
dgcr86.666e-2829.93DGCR8 microprocessor complex subunit [Source:ZFIN;... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dgcr81.565e-2829.39DGCR8 microprocessor complex subunit [Source:NCBI ... [more]
dgcr81.608e-2829.39DGCR8 microprocessor complex subunit [Source:NCBI ... [more]
dgcr81.637e-2829.39DGCR8 microprocessor complex subunit [Source:NCBI ... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dgcr82.041e-2829.74DGCR8, microprocessor complex subunit [Source:MGI ... [more]
Dgcr82.041e-2829.74DGCR8, microprocessor complex subunit [Source:MGI ... [more]
Gm497767.613e-858.33predicted gene, 49776 [Source:MGI Symbol;Acc:MGI:6... [more]
Gm497767.613e-858.33predicted gene, 49776 [Source:MGI Symbol;Acc:MGI:6... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8WYQ5|DGCR8_HUMAN9.727e-2830.00Microprocessor complex subunit DGCR8 OS=Homo sapie... [more]
sp|A6QR44|DGCR8_BOVIN1.137e-2727.73Microprocessor complex subunit DGCR8 OS=Bos taurus... [more]
sp|Q9EQM6|DGCR8_MOUSE1.427e-2729.74Microprocessor complex subunit DGCR8 OS=Mus muscul... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LG441.556e-5735.76Protein DGCR8 (DiGeorge syndrome critical region 8... [more]
A0A5K4EHZ91.690e-5736.30Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183RM531.832e-5736.30DRBM domain-containing protein OS=Schistosoma rodh... [more]
A0A1S8X5Q23.464e-5737.79DRBM domain-containing protein (Fragment) OS=Opist... [more]
A0A074ZUH63.956e-5737.97DRBM domain-containing protein (Fragment) OS=Opist... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dgcr81.267e-2729.29DGCR8 microprocessor complex subunit [Source:NCBI ... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445985.773e-2831.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dgcr81.586e-2729.29DGCR8 microprocessor complex subunit [Source:ZFIN;... [more]
back to top
BLAST of Microprocessor complex subunit DGCR8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000030239.10.000e+099.25SMESG000030239.1[more]
SMESG000030239.10.000e+099.10SMESG000030239.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002531 ID=SMED30002531|Name=Microprocessor complex subunit DGCR8|organism=Schmidtea mediterranea sexual|type=transcript|length=2661bp
AGTTTTTGTAGAATTGGTTTAACAGATAATTTTATTGATTTTAAATATAA
CTATAGTATATTAATCACTTGTAACATGAAATATTATTTAAAAATGCTAT
TGAATTGCATTTTTAAAAGTTCTCATGTATTAAGTGATGGTCATCTTTTT
CCACTAGAGAATTATTAATTATTTGATTTTATGAATTTGTTAAACATGTG
CGAAATATTTTAGTTGGTCAATGTCTAGTAATTATGATAATGACGTTGAA
GATCTTCTAGAAAAGTCTATCGATGAGAAATATCCAAAAAATGCTAAAAA
TCAACAAAATAAATGCCCGTTCAATTACAAAAACAAGCCACGATATCAAA
ATAGAGTTCATCGAAAAGTCATAAAAGTTGAAGAAAAAGTCAAATTCAAT
CCTTTACTCCTACCTGAAGGTTGGGTGCGTCTGTTTCATGATTCAGGAAT
GTTTTTCTACTGCCATGTGTCGACGAAAGTTGTCACTTGGTCAATGCCTT
ATCAATTACAAACTGAACCTCATCAATACCACCGTGTACCTATTCGATCA
ATACCTTGTCTTTCGTTTAAACTGATCAATAATGAAAATGACGACTTGGA
ATCTTTGAAAGACATAACACCCGATGTTATTGAAGATAAAATTAAAACAG
ATAAAACAGTAGATATGGAAACTACAGAGTTGGAAGATAAAAGCAACATT
GTGACCGAACAAGATAAAAATAGCTTTATTGAACCTATCGAAAAAGATAT
TGAGGAAGGGGAAATTGAATCCTCTGATGAAGGGGAGGAAGCAAATGATG
AAACTTCAGGCAAAGAAATAGTTCTCCCTAAGCAGTACCAGATTGAGCCT
ATTAACCACAAACCGAACCGTGCCAAACACAGTTCAGCAAATGATGTGAT
CAGAAATACTAACACTGTTGTGCCCTCAAAACGACGGAAAACAGTTAGTT
TTGATGAGCAAGTCGAACTGAATAAGCAGACTGATAAAATCAGTAATAAT
GATAATATTGATAATGATAATGCAAGAAAAACAAAAACCGAAGCACCAGA
CGAAATAAATCCAGCATTAGATCTATTAGACAAATCAGCAAAATTGCTGG
AGCCAGATCAATTAAGGAATTATTGTAAGAAAATGTTCACTTTCGTTGAA
GAAGCAAAACATTTTCCAAGGTTTTTTTTCGTCAAAAAGAAAGCTAAAAA
TACAAATCCCAATAACACAAACAGACCGATGATAAAACCAGCAGAACAAG
GGCAACAAGCGGTGACAAACTCAAATATCGAAACATCGGTCTCGCCTAGC
TGCACTGAGAAATTGAAAATACCCAATAAAAATATGTATATTGATCTTGC
CGGTCGAAACTTCAATTGTATCCTGAACATGTATTGCCAGAACGCTTATA
GCGTAACCCCTATATTCAAAGCAAACAGCAGCCTATCTGGCATTCATGAT
TTCGAGGTGACCTGTGAGGTCGGTGGAACGCACTATGCTGTCGGTGAAGG
GAAAACCAAGAAAATTGCTAAACAAAAAGCTGTATTGAAAACATTAGAAA
TTCTGATTCCCGGGTTTTCCAATAAGATCCAGATGAGTTGCCCCGACAAA
CTGCTGGCAATCGATAATCATAACATGGCCAGCACCAGCAACAGCACCGT
GAGCTGTCAAATTGCCGACTCAGCTGCCGACAGTGAGATCTATTCGATAT
TCGACAACATGGATATCACTGATCCCAGAGTGTTCAGCTATACCATGAAA
ATGAATTCAATGACTCCTTATAATATACTGGTTGAATGCATGAATCGCCA
CTGCGTTCTAGATAGCCATCTGATCTCCACCATCTCACGCAGCAACAAGC
ACAATGTTTTCAAATTGAAATTAGGCGATAAAGAAGTTCAAGCAAATTGT
GAAAATAAGCGCGAAGGCCGCCAGCTGGCATCGCAATATATGTTGGCGAA
ACTGCATCCGCACATCCAGAGGTGGGGGGGAATCCTGAGGCTTTACGGGC
CTGACAGCAAACCGGTGAAACGGTTCGACATGCACGAAATGCAGAACCTG
CTGCTCGAGGACCGGGGTGGAGTCAAGAACAATCTGATCAATTTGCTGCG
GCGCAAAATGCTGGAACTGAATGAGGAATGGCAATCGACCAATCAGACAT
ACGCCAAGTTCAAGGTCCCGTTCGAGAACGTGCCGATCATCGTGTTCCAT
CCAGATTCCAGAGATCAATCGAAATGAATGAATAAATACATTTTATTACA
TCCAAAAAACATCTTTCTGTGGATTGTTTTTTTATCATTTCCACAGCAAA
CTCAGAATTAGTGCATTTATGAGAGAAAGCTTTGTGTGGGGAAATGCGAA
TTCGATATTTTTCACTCGGTTTCGTTTCCATGGTGATAAATTGTCAACTC
TACTCTTTTTATTATGTTTTTAATTTATCAAATTATTATTATTATTTGCT
TGGTTATTATACTTTTATGAATCAATGGTTTTGAGTGGGTTTTAGTTGGT
GGTACCTTGACTGTGGGGAGGAGATAATTGCCGGCCGTAATGTGTTCTGT
GTGTTCCTAGCTTGCCCGCCTGTCACAGAGGGAGGTTCCTCTTGACATTT
TTTGATTAGCTGAGGTGGTGATTTATCATTCCTAATGTACTTTAGTTACA
ATAAATTCTGC
back to top

protein sequence of SMED30002531-orf-1

>SMED30002531-orf-1 ID=SMED30002531-orf-1|Name=SMED30002531-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=669bp
MSSNYDNDVEDLLEKSIDEKYPKNAKNQQNKCPFNYKNKPRYQNRVHRKV
IKVEEKVKFNPLLLPEGWVRLFHDSGMFFYCHVSTKVVTWSMPYQLQTEP
HQYHRVPIRSIPCLSFKLINNENDDLESLKDITPDVIEDKIKTDKTVDME
TTELEDKSNIVTEQDKNSFIEPIEKDIEEGEIESSDEGEEANDETSGKEI
VLPKQYQIEPINHKPNRAKHSSANDVIRNTNTVVPSKRRKTVSFDEQVEL
NKQTDKISNNDNIDNDNARKTKTEAPDEINPALDLLDKSAKLLEPDQLRN
YCKKMFTFVEEAKHFPRFFFVKKKAKNTNPNNTNRPMIKPAEQGQQAVTN
SNIETSVSPSCTEKLKIPNKNMYIDLAGRNFNCILNMYCQNAYSVTPIFK
ANSSLSGIHDFEVTCEVGGTHYAVGEGKTKKIAKQKAVLKTLEILIPGFS
NKIQMSCPDKLLAIDNHNMASTSNSTVSCQIADSAADSEIYSIFDNMDIT
DPRVFSYTMKMNSMTPYNILVECMNRHCVLDSHLISTISRSNKHNVFKLK
LGDKEVQANCENKREGRQLASQYMLAKLHPHIQRWGGILRLYGPDSKPVK
RFDMHEMQNLLLEDRGGVKNNLINLLRRKMLELNEEWQSTNQTYAKFKVP
FENVPIIVFHPDSRDQSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0005515protein binding
GO:0003723RNA binding
GO:0003725double-stranded RNA binding
GO:0004525ribonuclease III activity
GO:0020037heme binding
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0070878primary miRNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR040375DGCR8
IPR036020WW_dom_sf
IPR014720dsRBD_dom
IPR001202WW_dom
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0070877microprocessor complex
Vocabulary: biological process
TermDefinition
GO:0031053primary miRNA processing
GO:0072091regulation of stem cell proliferation
GO:0090501RNA phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014720Double-stranded RNA-binding domainSMARTSM00358DRBM_3coord: 381..446
e-value: 4.6E-4
score: 29.5
IPR014720Double-stranded RNA-binding domainPFAMPF00035dsrmcoord: 385..445
e-value: 1.4E-7
score: 32.1
IPR014720Double-stranded RNA-binding domainPROSITEPS50137DS_RBDcoord: 380..447
score: 12.184
IPR014720Double-stranded RNA-binding domainCDDcd00048DSRMcoord: 383..445
e-value: 7.67966E-12
score: 58.8231
NoneNo IPR availableGENE3DG3DSA:3.30.160.20coord: 371..454
e-value: 1.3E-12
score: 49.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.20coord: 489..594
e-value: 5.4E-29
score: 102.5
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 63..114
e-value: 8.1E-15
score: 56.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..193
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..197
NoneNo IPR availableSUPERFAMILYSSF54768dsRNA-binding domain-likecoord: 372..447
IPR040375Microprocessor complex subunit DGCR8PANTHERPTHR13482DGCR8 PROTEIN DIGEORGE SYNDROME CRITICAL REGION 8coord: 5..643
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 62..95
score: 10.581
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 58..94