Ubiquitin-associated domain-containing protein 1

Overview
NameUbiquitin-associated domain-containing protein 1
Smed IDSMED30002530
Length (bp)2761
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-associated domain-containing protein 1 (SMED30002530) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-associated domain-containing protein 1 (SMED30002530) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-associated domain-containing protein 1 (SMED30002530) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-associated domain-containing protein 1 (SMED30002530) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002530

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002530SMESG000023203.1 dd_Smed_v4_8499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002530SMESG000023203.1 dd_Smed_v4_8499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002530SMESG000023203.1 dd_Smed_v4_8499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Human
Match: UBAC1 (UBA domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30221])

HSP 1 Score: 68.5514 bits (166), Expect = 1.975e-11
Identity = 78/313 (24.92%), Postives = 135/313 (43.13%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNLKNINEKSKGSN-ERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV----------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S E  +  D K  +K+ I  AT NL   N+     ++   + +  LR +LV+LIE++Q +L LN  A +LF+     +    D+ +    +  +  L EMG    +A++AL                            QL   +V ++++W ++   +     P+P +                             + ++++   RK  FR        L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  D  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SAEEKKKQDQKAPDKEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVD---EAALRQLTEMGFPENRATKAL----------------------------QLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDR---KPSPEELD-KGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 384          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Fly
Match: isopeptidase-T-3 (gene:FBgn0028372 transcript:FBtr0086474)

HSP 1 Score: 52.7582 bits (125), Expect = 1.196e-6
Identity = 61/238 (25.63%), Postives = 111/238 (46.64%), Query Frame = 2
Query:  350 NINEKSKGSN-ERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDV-EGLALDHEMIQTILANPDIHLGLLNIYSLLVF 1057
            +INE  + SN +  +R VL++L + S  ++     A  L   +++ + +  ++       + +  L++MG  RE A+ AL   N   +  +  +  NQ+ E+         + ++S         NNE       T  ++++ R Y+ +   P   I E L +MGFEE+ V  AL+   NN+ +A + L +     N S    ++ EGLA D  +++ IL  P + + L N  + L F
Sbjct:  164 DINEIFQQSNIQYDVRKVLISLAQASAAVIGAGPYAPRLIAMLKQRLINRRNQ-----QADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEPPGMNMQHSLSSISPSTIVTNNETIEN---TAALIEIVRIYSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCD-----NRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAF 388          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Fly
Match: isopeptidase-T-3 (gene:FBgn0028372 transcript:FBtr0330247)

HSP 1 Score: 51.2174 bits (121), Expect = 4.121e-6
Identity = 56/224 (25.00%), Postives = 103/224 (45.98%), Query Frame = 2
Query:  389 LRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDV-EGLALDHEMIQTILANPDIHLGLLNIYSLLVF 1057
            +R VL++L + S  ++     A  L   +++ + +  ++       + +  L++MG  RE A+ AL   N   +  +  +  NQ+ E+         + ++S         NNE       T  ++++ R Y+ +   P   I E L +MGFEE+ V  AL+   NN+ +A + L +     N S    ++ EGLA D  +++ IL  P + + L N  + L F
Sbjct:  304 VRKVLISLAQASAAVIGAGPYAPRLIAMLKQRLINRRNQ-----QADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEPPGMNMQHSLSSISPSTIVTNNETIEN---TAALIEIVRIYSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCD-----NRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAF 514          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Fly
Match: isopeptidase-T-3 (gene:FBgn0028372 transcript:FBtr0086473)

HSP 1 Score: 51.2174 bits (121), Expect = 4.359e-6
Identity = 56/224 (25.00%), Postives = 103/224 (45.98%), Query Frame = 2
Query:  389 LRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDV-EGLALDHEMIQTILANPDIHLGLLNIYSLLVF 1057
            +R VL++L + S  ++     A  L   +++ + +  ++       + +  L++MG  RE A+ AL   N   +  +  +  NQ+ E+         + ++S         NNE       T  ++++ R Y+ +   P   I E L +MGFEE+ V  AL+   NN+ +A + L +     N S    ++ EGLA D  +++ IL  P + + L N  + L F
Sbjct:  300 VRKVLISLAQASAAVIGAGPYAPRLIAMLKQRLINRRNQ-----QADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEPPGMNMQHSLSSISPSTIVTNNETIEN---TAALIEIVRIYSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCD-----NRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAF 510          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Zebrafish
Match: ubac1 (UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9372])

HSP 1 Score: 70.4774 bits (171), Expect = 3.726e-12
Identity = 79/326 (24.23%), Postives = 142/326 (43.56%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV--------------------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S+E  +  DNK  +KD I +AT +L  +N  + + + +    +  LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +A                    L  N+ S        V+++++W ++ V++ +   P+P +                                       + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SSEEKKKQDNKAPDKDAILKATASLSTRNTDRTVTQHNIRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEEDRVD---ETALQQLTEMGFPESRAVKA--------------------LRLNHMS--------VTQAMEWLIEHVDDPMVDAPLPGQESPGAAAAAAPAPGASATALAARARLISQASIDEAKQDELTEIFKRIRRKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 394          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Zebrafish
Match: ubac1 (UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9372])

HSP 1 Score: 70.4774 bits (171), Expect = 3.726e-12
Identity = 79/326 (24.23%), Postives = 142/326 (43.56%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV--------------------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S+E  +  DNK  +KD I +AT +L  +N  + + + +    +  LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +A                    L  N+ S        V+++++W ++ V++ +   P+P +                                       + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SSEEKKKQDNKAPDKDAILKATASLSTRNTDRTVTQHNIRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEEDRVD---ETALQQLTEMGFPESRAVKA--------------------LRLNHMS--------VTQAMEWLIEHVDDPMVDAPLPGQESPGAAAAAAPAPGASATALAARARLISQASIDEAKQDELTEIFKRIRRKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 394          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Zebrafish
Match: ubac1 (UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9372])

HSP 1 Score: 68.9366 bits (167), Expect = 9.844e-12
Identity = 80/326 (24.54%), Postives = 142/326 (43.56%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV--------------------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S+E  +  DNK  +KD I +AT +L  +N  + + + +    E  LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +A                    L  N+ S        V+++++W ++ V++ +   P+P +                                       + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SSEEKKKQDNKAPDKDAILKATASLSTRNTDRTVTQHNIRDTE--LRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEEDRVD---ETALQQLTEMGFPESRAVKA--------------------LRLNHMS--------VTQAMEWLIEHVDDPMVDAPLPGQESPGAAAAAAPAPGASATALAARARLISQASIDEAKQDELTEIFKRIRRKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 392          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Xenopus
Match: ubac1 (UBA domain containing 1 [Source:NCBI gene;Acc:549580])

HSP 1 Score: 72.0182 bits (175), Expect = 3.452e-13
Identity = 72/255 (28.24%), Postives = 121/255 (47.45%), Query Frame = 2
Query:  389 LRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLE------SNYNSGSQLQEENVSESIKWVKDVNNELFVKPM-------PTKVILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +AL +++ S+          Q++E       +  + + L  EN SE+   +     E   KP        P   + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+     + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:    5 LRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDEDRVD---EVALRQLTEMGFPESRAVKALRLNHMSVT---------QAMEWLIEHADDPAADAPLPCENSSEAAGGL--ATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 238          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Mouse
Match: Ubac1 (ubiquitin associated domain containing 1 [Source:MGI Symbol;Acc:MGI:1920995])

HSP 1 Score: 62.3882 bits (150), Expect = 1.374e-9
Identity = 86/365 (23.56%), Postives = 152/365 (41.64%), Query Frame = 2
Query:  152 LFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISS---------TENNEIIDNKITEKD-IEEATKNLEGKNLKNINEKSKGSN-ERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFV-KPMP------------------------------------TKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            L +    ++L + K +     +D D +L  I  R+ S          E  +  + K  +KD I  AT NL   +      ++   + +  LR +LV+LIE++Q +L LN  A +LF+     +    D+ +    +  +  L EMG    +AS                    ++L  N+ S        V ++++W+ + + +  +  P+P                                    T++  K+ R   +K FR        L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:   63 LIHAASERVLSDSKTILEENIQDQD-VLLLIKKRVPSPLPKMADVSAEEKKKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVD---ETALRQLTEMGFPESRAS--------------------KALRLNHMS--------VPQAMEWLIEHSEDPAIDTPLPGHAAQAGASAAATTSSTSSEAAVGTSVEDEESRDELTEIFKKIRR---KKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDR---KPSPEELD-QGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 388          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q28DG7|UBAC1_XENTR (Ubiquitin-associated domain-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=ubac1 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.511e-12
Identity = 80/292 (27.40%), Postives = 138/292 (47.26%), Query Frame = 2
Query:  284 DNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLE------SNYNSGSQLQEENVSESIKWVKDVNNELFVKPM-------PTKVILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            D K  +KD I +AT  L  ++  + + + +    +  LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +AL +++ S+          Q++E       +  + + L  EN SE+   +     E   KP        P   + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+     + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  115 DQKAPDKDAILKATAGLPARSTDRTVAQHNMRDFQTELRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDEDRVD---EVALRQLTEMGFPESRAVKALRLNHMSVT---------QAMEWLIEHADDPAADAPLPCENSSEAAGGL--ATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 385          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5ZJI9|UBAC1_CHICK (Ubiquitin-associated domain-containing protein 1 OS=Gallus gallus OX=9031 GN=UBAC1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.047e-11
Identity = 77/319 (24.14%), Postives = 138/319 (43.26%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV-------------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S E     + K  +KD I +AT NL  +N+ + + + +    +  LR +LV+LIE++Q +L LN  A +LF+     +    +  +    +  +  L EMG    +A +A                    L  N+ S        V+++++W ++  ++     P+P +                                + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL    PS        E+  +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SAEEKRKQEQKAPDKDAILKATANLPSRNVDRTVAQHNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEEDRVD---EIALRQLTEMGFPESRAVKA--------------------LRLNHMS--------VTQAMEWLIEHADDPAVDAPLPGQTPSEAAAEAGASSAEATAGPSSEAGGEEAKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVVDALRVNNNQQNAACEWLLGDRKPSP-------EDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 387          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9BSL1|UBAC1_HUMAN (Ubiquitin-associated domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBAC1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 9.486e-11
Identity = 78/313 (24.92%), Postives = 135/313 (43.13%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNLKNINEKSKGSN-ERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV----------------------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S E  +  D K  +K+ I  AT NL   N+     ++   + +  LR +LV+LIE++Q +L LN  A +LF+     +    D+ +    +  +  L EMG    +A++AL                            QL   +V ++++W ++   +     P+P +                             + ++++   RK  FR        L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  D  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SAEEKKKQDQKAPDKEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVD---EAALRQLTEMGFPENRATKAL----------------------------QLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAEGATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDR---KPSPEELD-KGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 384          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q8VDI7|UBAC1_MOUSE (Ubiquitin-associated domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ubac1 PE=1 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 9.611e-9
Identity = 86/365 (23.56%), Postives = 152/365 (41.64%), Query Frame = 2
Query:  152 LFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISS---------TENNEIIDNKITEKD-IEEATKNLEGKNLKNINEKSKGSN-ERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFV-KPMP------------------------------------TKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            L +    ++L + K +     +D D +L  I  R+ S          E  +  + K  +KD I  AT NL   +      ++   + +  LR +LV+LIE++Q +L LN  A +LF+     +    D+ +    +  +  L EMG    +AS                    ++L  N+ S        V ++++W+ + + +  +  P+P                                    T++  K+ R   +K FR        L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:   63 LIHAASERVLSDSKTILEENIQDQD-VLLLIKKRVPSPLPKMADVSAEEKKKQEQKAPDKDAILRATANLPACSTDRTAVQTTMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVD---ETALRQLTEMGFPESRAS--------------------KALRLNHMS--------VPQAMEWLIEHSEDPAIDTPLPGHAAQAGASAAATTSSTSSEAAVGTSVEDEESRDELTEIFKKIRR---KKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDR---KPSPEELD-QGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 388          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5XIR9|UBAC1_RAT (Ubiquitin-associated domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ubac1 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.439e-8
Identity = 68/275 (24.73%), Postives = 118/275 (42.91%), Query Frame = 2
Query:  389 LRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFV-KPMP------------------------------------TKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            LR +LV+LIE++Q +L LN  A +LF+     +    D+ +    +  +  L EMG    +AS                    ++L  N+ S        V ++++W+ + + +  +  P+P                                    T++  K+ R   +K FR        L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  152 LRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVD---ETALRQLTEMGFPESRAS--------------------KALRLNHMS--------VPQAMEWLIEHSEDPAIDTPLPGHAAQAEASAAAATSSSSSEAAVGTSVEDEESRDELTEIFKKIRR---KKEFRADARAVISLMEMGFDEKEVIDALRVNNNQQNAACEWLLGDR---KPSPEELD-QGIDPNSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 388          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Match: A0A267GKG4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016131g1 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.440e-19
Identity = 89/285 (31.23%), Postives = 142/285 (49.82%), Query Frame = 2
Query:  302 KDIEEATKNLEGKNLKNI--------------NEKSKGSNE-------RVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN--PSSLINDS-----EDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQD 1072
            +DIE AT++LE ++                  ++ S G          R L   LVTLI+  Q +LC +  A  L Q V R  SS        PD  L+  L EMG   E+A  AL +++NSL +A + + + +S  +   +  Q   +  SES     D     FV+P+    +L+L+R Y+R  FRP  A R RL+DMGF+E  V +ALR++NN+E  A+++LL+   S  + +S     + ++ + GL  +  + + ++ NP + L +    +LL F  I D
Sbjct:  159 EDIEAATRHLEPRSPPPPPPATPPATQSPSRNSQDSSGPQRITGQAFSRALAPTLVTLIDTCQRLLCTHPDAEKLMQLV-RSGSSAPAAPRPAPDLQLVRQLAEMGFPEEQAKRALALAHNSLADATDCLLAGESALAAAEA-PQPAAQAESESASQAADRG---FVEPLSVPGMLELFRQYSRAQFRPSQATRLRLLDMGFDEPGVTDALRLHNNDEAQALETLLSGQASQHLQESAELRQQGDDALTGLDPESPLYKALMENPSVQLAMCQPVTLLAFLSILD 438          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Match: A0A1I8GUW8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.561e-19
Identity = 89/285 (31.23%), Postives = 142/285 (49.82%), Query Frame = 2
Query:  302 KDIEEATKNLEGKNLKNI--------------NEKSKGSNE-------RVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN--PSSLINDS-----EDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQD 1072
            +DIE AT++LE ++                  ++ S G          R L   LVTLI+  Q +LC +  A  L Q V R  SS        PD  L+  L EMG   E+A  AL +++NSL +A + + + +S  +   +  Q   +  SES     D     FV+P+    +L+L+R Y+R  FRP  A R RL+DMGF+E  V +ALR++NN+E  A+++LL+   S  + +S     + ++ + GL  +  + + ++ NP + L +    +LL F  I D
Sbjct:  159 EDIEAATRHLEPRSPPPPPPATPPATQSPSRNSQDSSGPQRITGQAFSRALAPTLVTLIDTCQRLLCTHPDAEKLMQLV-RSGSSAPAAPRPAPDLQLVRQLAEMGFPEEQAKRALALAHNSLADATDCLLAGESALAAAEA-PQPAAQAESESASQAADRG---FVEPLSVPGMLELFRQYSRAQFRPSQATRLRLLDMGFDEPGVTDALRLHNNDEAQALETLLSGQASQHLQESAELRQQGDDALTGLDPESPLYKALMENPSVQLAMCQPVTLLAFLSILD 438          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Match: A0A1I8FV23 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.416e-19
Identity = 89/281 (31.67%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  302 KDIEEATKNLEGKNLKNI---------------NEKSKGSNE-------RVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHE--MIQTILANPDIHLGLLNIYSLLVFREIQD 1072
            +DIE AT++LE ++                   ++ S G          R L   LVTLI+  Q +LC +  A  L Q V R  SS        PD  L+  L EMG   E+A  AL +++NSL +A + + + +S  +   +  Q   +  SES     D     FV+P+    +L+L+R Y+R  FRP  A R RL+DMGF+E  V +ALR++NN+E  A+++LL+  +    +    D     LD E  + + ++ NP + L +    +LL F  I D
Sbjct:   27 EDIEAATRHLEPRSPPPPPPPATPPATQSPSRNSQDSSGPQRITGQAFSRALAPTLVTLIDTCQRLLCTHPDAEKLMQLV-RSGSSAPAAPRPAPDLQLVRQLAEMGFPEEQAKRALALAHNSLADATDCLLAGESALAAAEA-PQPAAQAESESASQAADRG---FVEPLSVPGMLELFRQYSRAQFRPSQATRLRLLDMGFDEPGVTDALRLHNNDEAQALETLLSGQARERGAAAAGDDALTGLDPESPLYKALMENPSVQLAMCQPVTLLAFLSILD 302          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Match: A0A267DWK2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020415g1 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 6.134e-19
Identity = 89/286 (31.12%), Postives = 142/286 (49.65%), Query Frame = 2
Query:  302 KDIEEATKNLEGKNLKNI---------------NEKSKGSNE-------RVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN--PSSLINDS-----EDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQD 1072
            +DIE AT++LE ++                   ++ S G          R L   LVTLI+  Q +LC +  A  L Q V R  SS        PD  L+  L EMG   E+A  AL +++NSL +A + + + +S  +   +  Q   +  SES     D     FV+P+    +L+L+R Y+R  FRP  A R RL+DMGF+E  V +ALR++NN+E  A+++LL+   S  + +S     + ++ + GL  +  + + ++ NP + L +    +LL F  I D
Sbjct:  159 EDIEAATRHLEPRSPPPPPPPATPPATQSPSRNSQDSSGPQRITGQAFSRALAPTLVTLIDTCQRLLCTHPDAEKLMQLV-RSGSSAPAAPRPAPDLQLVRQLAEMGFPEEQAKRALALAHNSLADATDCLLAGESALAAAEA-PQPAAQAESESASQAADRG---FVEPLSVPGMLELFRQYSRAQFRPSQATRLRLLDMGFDEPGVTDALRLHNNDEAQALETLLSGQASQHLQESAELRQQGDDALTGLDPESPLYKALMENPSVQLAMCQPVTLLAFLSILD 439          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Match: A0A067RRF0 (Ubiquitin-associated domain-containing protein 1 OS=Zootermopsis nevadensis OX=136037 GN=L798_07095 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.035e-14
Identity = 90/333 (27.03%), Postives = 154/333 (46.25%), Query Frame = 2
Query:  140 SKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEE---ATKNLEGKNLKNINE--KSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLE-----SNYNSGSQLQEENVSESIKWVKDVNNELFVK-PMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNP-SSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            SK     + + + L+ND  +      + DE+L     +  S E      + +    IEE   AT+ +EGKN   +N   +S    +  +R +LV+L++ S  IL  +  A +  +  Q  + +   K    P +  +  L++MG S   AS AL  +  + + AL  +  N + E     ++ N  +   E  +    + V  V+ E  +K       +L+ +R Y R+ F+P++   + L+DMGF E    +ALRI  NN  AA + LL    + + D++   D EG      + + I++NP I L L +   LL F  + +V SSA+   N
Sbjct:   95 SKYKFVLVSEKRPLDNDHSVSQEGLRNNDELLLVECRQPPSKE--PFTADSVRAPTIEEIRAATQTVEGKNTLTLNPPLESTADFQSEIRKILVSLVQASARILTPSPNADEALRVTQERLDA---KANAHPSRRAVQQLVDMGFSERVASRALCHNRMNPSEALEWLLENGAGEQSDVATDLNVKAAASEGRLRRQQEAVPGVSAESKIKRAQSVAALLESFRAYVRQDFKPNMKALQNLMDMGFSEEDARDALRITGNNHSAACEWLLGERRASLEDTDTGLDPEG-----PIYKAIMSNPAIQLSLTSPKMLLAFLSMLEVPSSANMWIN 417          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Cavefish
Match: ubac1 (UBA domain containing 1 [Source:NCBI gene;Acc:103037047])

HSP 1 Score: 74.3294 bits (181), Expect = 1.708e-13
Identity = 78/301 (25.91%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  260 STENNEIIDNKITEKD-IEEATKNLEGKNL-KNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKW-VKDVNNELFVKPMPTKV----------------ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            S E  +  + K  +KD I +AT NL  ++  + + + +    +  LR +LV+LIE++Q IL LN  A +LF+     +    ++ +    + ++  L EMG    +A +A                    L  N+ S        V+++++W ++ V++     P+P +                 + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  107 SAEEKKKQEAKAPDKDAILKATANLTTRHSDRTVTQHNIRDFQTELRKILVSLIEVAQKILALNPDAVELFKKANAMLDEDEEERVD---ETVLQQLTEMGFPESRAIKA--------------------LRLNHMS--------VTQAMEWLIEHVDDPTVDMPLPGQEAQGGGAGAAAEAKQDELTEIFKRIRRKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDR---KPSPEELD-KGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 372          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Cavefish
Match: ubac1 (UBA domain containing 1 [Source:NCBI gene;Acc:103037047])

HSP 1 Score: 58.5362 bits (140), Expect = 2.155e-8
Identity = 39/115 (33.91%), Postives = 64/115 (55.65%), Query Frame = 2
Query:  761 ILKLYRDYNRKF-FRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            + ++++   RK  FRP       L++MGF+E  V +ALR+NNN + AA + LL        S +E D +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  295 LTEIFKRIRRKREFRPDSRAVIALMEMGFDEKEVIDALRVNNNQQDAACEWLLGDR---KPSPEELD-KGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 405          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006798.1 (pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 gene:ENSPMAG00000006139.1 transcript:ENSPMAT00000006798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 7.023e-6
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query: 2428 KKLSSKALAVFLIIGNQLCEEAIQLDPDLERALIFQRRVNEALMPYKEIY 2577
            K ++SK L  FL   + L + A+ +DP LER+L F+R +N  + PYKE++
Sbjct:  413 KDMTSKKLTYFLSQADALAQTAMDMDPSLERSLQFKRALNSIIAPYKEVH 462          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Medaka
Match: ubac1 (UBA domain containing 1 [Source:NCBI gene;Acc:101174107])

HSP 1 Score: 56.6102 bits (135), Expect = 6.766e-8
Identity = 38/112 (33.93%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  776 RDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLN---PSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            R   ++ FRP       L++MGF E  V +ALR+NNN + AA + LL    PS        E+  +G+  +  + Q IL NP + LGL N  +LL F ++ +   +++Q  N
Sbjct:  301 RIRRKREFRPDSRAVVALMEMGFGEKEVIDALRVNNNQQDAACEWLLGDRKPSP-------EDLDKGIDTNSPLFQAILENPVVQLGLTNPKTLLAFEDMLENPLNSTQWMN 405          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000023203.1 (SMESG000023203.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 356/367 (97.00%), Postives = 356/367 (97.00%), Query Frame = 2
Query:    2 MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQDVSSSASQRFN 1102
            MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEALIVSNNSLNNALNIIFSNQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLL           ASQRFN
Sbjct:    1 MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEALIVSNNSLNNALNIIFSNQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLL-----------ASQRFN 356          
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000023203.1 (SMESG000023203.1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 353/357 (98.88%), Postives = 353/357 (98.88%), Query Frame = 2
Query:    2 MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEAXXXXXXXXXXXXXXXXXXQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLVFREIQD 1072
            MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEALIVSNNSLNNALNIIFSNQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLL F  I D
Sbjct:    1 MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCNLFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITEKDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKTASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEALIVSNNSLNNALNIIFSNQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMPTKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAAVDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLLAFLNIVD 357          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UBAC11.975e-1124.92UBA domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
isopeptidase-T-31.196e-625.63gene:FBgn0028372 transcript:FBtr0086474[more]
isopeptidase-T-34.121e-625.00gene:FBgn0028372 transcript:FBtr0330247[more]
isopeptidase-T-34.359e-625.00gene:FBgn0028372 transcript:FBtr0086473[more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ubac13.726e-1224.23UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ubac13.726e-1224.23UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ubac19.844e-1224.54UBA domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubac13.452e-1328.24UBA domain containing 1 [Source:NCBI gene;Acc:5495... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ubac11.374e-923.56ubiquitin associated domain containing 1 [Source:M... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DG7|UBAC1_XENTR1.511e-1227.40Ubiquitin-associated domain-containing protein 1 O... [more]
sp|Q5ZJI9|UBAC1_CHICK5.047e-1124.14Ubiquitin-associated domain-containing protein 1 O... [more]
sp|Q9BSL1|UBAC1_HUMAN9.486e-1124.92Ubiquitin-associated domain-containing protein 1 O... [more]
sp|Q8VDI7|UBAC1_MOUSE9.611e-923.56Ubiquitin-associated domain-containing protein 1 O... [more]
sp|Q5XIR9|UBAC1_RAT1.439e-824.73Ubiquitin-associated domain-containing protein 1 O... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GKG44.440e-1931.23Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GUW84.561e-1931.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FV235.416e-1931.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DWK26.134e-1931.12Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A067RRF02.035e-1427.03Ubiquitin-associated domain-containing protein 1 O... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ubac11.708e-1325.91UBA domain containing 1 [Source:NCBI gene;Acc:1030... [more]
ubac12.155e-833.91UBA domain containing 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006798.17.023e-642.00pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 g... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ubac16.766e-833.93UBA domain containing 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ubiquitin-associated domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023203.10.000e+097.00SMESG000023203.1[more]
SMESG000023203.10.000e+098.88SMESG000023203.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002530 ID=SMED30002530|Name=Ubiquitin-associated domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2761bp
CATGTCTTCTGTTAAGTTAAAAGTAGTTAATAATAATTTTACTACTTTGT
TACCAATTAGAAGCAATATTTTAGTATTAAGTTTGAAAGAAAAGATATGT
AACTTAGAAAATTTAACTTCAGTTAGCCATCTTGATTTATCAAAATGCAA
TCTTTTTTATATCAAGAAATACCAATTACTTGAGAATGATAAGCATTTGG
ATTATTATAAATTTGAAGATTATGATGAAATCCTCTTTACAATTCCAAAT
AGAATTTCAAGCACGGAAAATAATGAAATTATTGATAATAAAATTACAGA
AAAAGACATAGAAGAAGCTACAAAAAATTTAGAAGGTAAAAATTTAAAAA
ACATTAATGAAAAATCTAAGGGAAGCAATGAAAGGGTTTTACGATCAGTT
TTAGTTACTTTAATTGAAATATCCCAAAATATTCTTTGTTTGAATAAAAC
AGCATCAGATCTATTTCAATATGTACAAAGGGAGATTTCTAGCCACGTTG
ACAAAGTTATAGTGCCACCAGATCAAAATCTCATCCATACTCTTTTAGAA
ATGGGCATTTCTCGTGAAAAAGCATCCGAAGCGTTAATAGTATCCAACAA
TAGCTTAAATAACGCTTTAAATATCATTTTCTCAAATCAAAGCCTCGAAT
CAAACTATAATTCAGGATCTCAGTTGCAAGAAGAAAACGTTAGTGAATCG
ATAAAATGGGTTAAAGACGTGAATAACGAATTATTTGTCAAACCAATGCC
AACTAAAGTGATTTTAAAACTTTATCGAGATTACAATAGGAAATTCTTTC
GACCCCATGTTGCGATTCGTGAACGCTTAATTGACATGGGATTTGAAGAG
TCGACTGTAAATGAAGCTCTTAGAATTAACAACAATAATGAGATGGCAGC
TGTGGATTCTTTATTAAATCCATCAAGTTTGATTAACGATTCAGAGGATG
AAAATGATGTTGAAGGATTGGCATTGGATCATGAGATGATTCAGACCATT
TTAGCAAACCCCGATATCCATTTAGGGTTATTAAATATTTATTCATTATT
AGTTTTTCGTGAAATTCAAGATGTCTCTTCTTCAGCTTCCCAGAGGTTCA
ATTAGTCTAAATGGCTTCTTTTGTTAGAGGCTTGTTATTTACTAATGACA
CATGCTCAGTTTGGTATATAATTCCAGGTTGAATTCGAACTCCAGCAAAT
TAGTATTTTTCCAATGCTTAGTGATAAAAAAATCTATTTTGAATGCTATT
TATAAATTTTAAATAATTTTATATCAATGAATATTATTTTGATGACAAAT
TTAGATCAAGATCAAAAAGATTATTGATTTCAATGAAAACAATTTGATGA
CGATAAACAGAAAATATATTTAAATAAAAATTATTTTATTGTAAAAAAAT
CGATGATTAAAAATTAAAATGAATGCAAGTGATGAATAAATTTTAATGAA
TGTGTTGAAAATGGATGGAAAATATTTTAACAGAAAATACGTAATAATTT
TAGTTAAAGGGTTAAGGGAGGTTAAGAATGAAGATAAAAATGAATAAAAC
AATATTAAATTTAGAAACAGGATGACTATGATCAGAAGATAATAATGACA
ATATTATTTAAAACTTATTACTGATGTCTGTCTTAGAAACCTAAATGAAC
AGTGTCTCTCAGTGTATAATAAATGATAACAAAAGGATGCCATTTATTTT
GATAACGGTAAACAGATTATGAAATTGAATGAAAATTATTTTGCATACAG
AAAAAAAAGAATAAATTTAAATGAAAATGATGACAAAATTGAAGAAAATG
GATGTAAATAATAAAATGGTAATAGTAATATTATTTCTTTTTGTAATTAA
ATTCATAGATTTGAATGAAAATATTTTGCTTAACGGATACAAATGATTAT
ATATCGTTAATACTGACCTACAATTAGCTTCATTTAAAATAAATATTCAA
GATTGCGACCTCCATAAAATCACTTATTCTAATTCAAAAATTGATACTTA
CATATATACAGTAATCCCATGGACTGCGCGATTTTGTCTTTGACACCAAA
ATTTCGCACTGCGCAGAAATATTTCACTTTATTTTTTGATGTTATTTTTG
CGGAAAATATTCTTTTTCGTGGGAGATACACATAGAATTTAGGAAATCCC
CCTAATATGTTGTATATGACAACATTAAATGGTGTTTGGAAAAAAATATG
GCCTGAGGGTGGCATCAAAGAAGCTGTTGTGTATATGCCGACACTAGAAG
AAATTGCGGATATCTGTTAAAGTATTGGTGTGAAGGATTTGACGATATGG
ATTCAAAAAGACATCATGAAGTTATTGAATTCCGTCAACATCTTACATTT
GAATAATTGGTAACGTCTGTTTTCGAAGATAATAATGTCCTAAAAGGGAA
AATTAATGATGCGGAAGTAGTGAAGACAAAAAATTAAGTAGCAAAGCACT
GGCCGTATTTTTAATAATTGGAAATCAGCTTTGTGAAGAAGCGATTCAGT
TAGACCCTGATTTAGAGCGGGCCTTAATATTTCAGAGACGTGTGAACGAA
GCTTTAATGCCTTACAAGGAAATTTATGATTCAAGAGACAAGCATCAATC
ATTACTAACTAGTTTTTTTTCAAAAACCCGCAACAGAATTAACAAATTTA
TCGGGAACCAGCAGTGAAGATCAAATAATTTAAAGAGTTTTTGGTTTTGT
TTAAATTCAAATGAATTTTTTGTTGGAACGTAAATACCGCGCACAGTGAG
GAATTACTGTA
back to top

protein sequence of SMED30002530-orf-1

>SMED30002530-orf-1 ID=SMED30002530-orf-1|Name=SMED30002530-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MSSVKLKVVNNNFTTLLPIRSNILVLSLKEKICNLENLTSVSHLDLSKCN
LFYIKKYQLLENDKHLDYYKFEDYDEILFTIPNRISSTENNEIIDNKITE
KDIEEATKNLEGKNLKNINEKSKGSNERVLRSVLVTLIEISQNILCLNKT
ASDLFQYVQREISSHVDKVIVPPDQNLIHTLLEMGISREKASEALIVSNN
SLNNALNIIFSNQSLESNYNSGSQLQEENVSESIKWVKDVNNELFVKPMP
TKVILKLYRDYNRKFFRPHVAIRERLIDMGFEESTVNEALRINNNNEMAA
VDSLLNPSSLINDSEDENDVEGLALDHEMIQTILANPDIHLGLLNIYSLL
VFREIQDVSSSASQRFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR015940UBA
IPR009060UBA-like_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 96..116
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 148..223
e-value: 1.2E-9
score: 39.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 268..319
e-value: 4.9E-8
score: 34.6
NoneNo IPR availablePANTHERPTHR46738FAMILY NOT NAMEDcoord: 4..362
IPR015940Ubiquitin-associated domainSMARTSM00165uba_6coord: 174..211
e-value: 0.0039
score: 26.4
coord: 269..306
e-value: 0.041
score: 23.0
IPR015940Ubiquitin-associated domainPFAMPF00627UBAcoord: 274..304
e-value: 1.5E-7
score: 31.1
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 260..307
score: 11.029
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 172..212
score: 12.33
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 168..213
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 274..307
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 4..81