DNA-directed RNA polymerase subunit beta

Overview
NameDNA-directed RNA polymerase subunit beta
Smed IDSMED30002529
Length (bp)3626
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase subunit beta (SMED30002529) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit beta (SMED30002529) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase subunit beta (SMED30002529) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit beta (SMED30002529) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002529

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002529h1SMcG0019312 SmedASXL_019327SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002529h1SMcG0019312 SmedASXL_019327SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002529h1SMcG0019312 dd_Smed_v4_2182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002529h1SMcG0019312 Contig49130uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002529h1SMcG0019312 Contig49130newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1707.19 bits (4420), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:    6 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1165          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1706.81 bits (4419), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1706.81 bits (4419), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1618.21 bits (4189), Expect = 0.000e+0
Identity = 757/1097 (69.01%), Postives = 906/1097 (82.59%), Query Frame = 3
Query:  267 CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            C+ P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:    4 CNQP-RYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1097          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1587.39 bits (4109), Expect = 0.000e+0
Identity = 740/1067 (69.35%), Postives = 887/1067 (83.13%), Query Frame = 3
Query:  357 MMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            MMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:    1 MMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1065          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Match: rpb-2 (DNA-directed RNA polymerase II subunit RPB2 [Source:UniProtKB/Swiss-Prot;Acc:Q10578])

HSP 1 Score: 1661.35 bits (4301), Expect = 0.000e+0
Identity = 769/1164 (66.07%), Postives = 952/1164 (81.79%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQY-GSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHA--RYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESR-NNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            D +EI++E WQE+ W VIS++F+EKGLVRQQLDSFDEF+  ++QRIVE+ P +E+Q E Q+ G+  + P K    F QIYLSK THWE DG   PMMPN+ARLRNLTY +P++VD+T+   R D       D+  +GK+P+MLRS+YC+LS M+D DL +LNECPLDPGGYF+INGSEKV+IAQE+MA NTV+VF  KD KY++K   +S +E S R  S + VN+LA+ G G  K  +G +I+  +P++KQEIPI+I+FRA+GFVSDRDI+ H IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IG+RG KPG+   QRIK+A++++ KE LPH+G +E   T+KA+F+GYMVHRLL  AL RR  DDRDH+G+KRLDLAGPLLAFLF+  F+NL KE++    K I+K  +    + +K++ IT GL YSLATGNWGDQKKA ++R GVSQVLNRLT+ +TLSHLRR NSP GR+GK+ KPRQLHNTQWGMVCPAETPEG AVGLVKNLALMAYISVGS  +PI+EFLEEWSME+LEE++PSAIA+ATKIF+NG+WVGIHR+PDQLM TLKKLRR MD++VSEVS+VRD   +EI+IYTD+GR+CRPL+IV + K A+KK HI +LKE A    +Y W +LV  GVVE ID++EEETSMIAM+P D+ ++  YC THTHCEIHP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVY +NFH RMDTLAHVLYY QKPL TTR+MEYLRF ELPAGINA+VAI SY+GYNQEDSVI+N SAI+RG+FRS FYR+  ++E+  +N+ E  E IEKP +E+  GMR   Y KLD DGI+SPG+RVSG DV++GKTV LP  DD ++  G  K+ KRD S F+R +E GIVD+VML+ N++G+KF KIR+R+ ++PQIGDKFASRHGQKGT GI YRQEDMPFT+EG+TPDIIINPHA+PSRMT+GHLIECLQGK+SAN+GEIGDATPFND VNV+KIS +L +YGY   GNE+MYNG+TG+K+TT +FFGPTYYQRLKHMVDDKIHSRARGP+ MM RQP+EGR+++GGLRFGEMERDCQI+HGA QFL+ERL +VSD Y +YVC  CG +V AN++  +F+C +C   T+VS +R+PYA KLL QEL SM I  RL V
Sbjct:   21 DSDEISAEAWQEACWVVISAYFDEKGLVRQQLDSFDEFVQMNVQRIVEDSPPVELQSENQHLGTDMENPAKFSLKFNQIYLSKPTHWEKDGAPMPMMPNEARLRNLTYASPLYVDITKVVTRDDSATEKVYDKVFVGKVPVMLRSSYCMLSNMTDRDLTELNECPLDPGGYFVINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTECRSCLENSSRPTSTMWVNMLARGGGGGKKTAMGQRIIGILPYIKQEIPIMIVFRALGFVSDRDILGHIIYDFNDPEMMEMVKPSLDEAFVIQEQNVALNFIGARGAKPGVTREQRIKYAREILQKELLPHVGVSEHCETKKAFFIGYMVHRLLLAALGRRELDDRDHIGNKRLDLAGPLLAFLFRSLFRNLLKEMRMTAQKYINKNDDFALDVCVKTSTITRGLTYSLATGNWGDQKKAHQSRAGVSQVLNRLTYTATLSHLRRANSPIGREGKLAKPRQLHNTQWGMVCPAETPEGQAVGLVKNLALMAYISVGSLPEPILEFLEEWSMENLEEVSPSAIADATKIFVNGAWVGIHREPDQLMTTLKKLRRQMDIIVSEVSMVRDIRDREIRIYTDAGRVCRPLLIVENQKLALKKRHIDQLKEAADEANKYTWSDLVGGGVVELIDSMEEETSMIAMMPEDL-RSGGYCDTHTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYTTNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFNELPAGINAIVAILSYSGYNQEDSVIMNNSAIDRGLFRSVFYRSYRDNEANLDNANE--ELIEKPTREKCSGMRHSLYDKLDEDGIISPGMRVSGDDVIIGKTVALPDIDDDLDASG-KKYPKRDASTFLRSSETGIVDQVMLSLNSDGNKFVKIRMRSVRLPQIGDKFASRHGQKGTMGIMYRQEDMPFTAEGLTPDIIINPHAVPSRMTIGHLIECLQGKLSANKGEIGDATPFNDTVNVQKISGLLCEYGYHLRGNEVMYNGHTGKKLTTQIFFGPTYYQRLKHMVDDKIHSRARGPIQMMNRQPMEGRARDGGLRFGEMERDCQISHGATQFLRERLFEVSDPYHVYVCNNCGLIVVANLRTNSFECKACRNKTQVSAVRIPYACKLLFQELMSMSIAPRLMV 1180          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Match: rpc-2 (DNA-directed RNA polymerase subunit beta [Source:UniProtKB/TrEMBL;Acc:Q27492])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 427/1175 (36.34%), Postives = 652/1175 (55.49%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWES-DGTGSPMMPNDARLRNLTYCAPVFVDV--TQKNMR--SDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTD-MHEMLKPSIDEAFVIQDEHHALNYIGSR---------GVKPGIPVA----QRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANA--TKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTL------PATDDFIETVG--NSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + +GLV+Q L SFD F+   I+ I+    K+       +             +  I + K +  E  + T   + P + RLR++TY AP+ VD+  T+ N R    D I        IG++PIMLRS+ C+L ++++ +LA++ ECP DPGGYF++ GSEKVI+ QE+++ N + V     K   +C V S       S S            GK  V          L  ++P+ I+F+AMG  SD DI+    ++        + L+ SI+     Q +  AL Y+ S+         G  PG  V+     +   A D ++   + HI   +     KA +LG M  RL+ T L     DDRD  G+KRL+LAG LL+ LF+  FK    ELK      + KT      +   ++ ++IT+ +  +++TGNW  ++   E R GV+QVL+RL++ S L  + R+NS   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLAL+++I+  S   P++  L    +E L  +  S +     T IF+NG  +G   DP++++  ++ LRRS  ++   VS+ R  + + + I +D GR+CRP IIV +G   + + H++ LKE    +  +++ V DG+VEY+D  E   ++IA+   +I   +      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+D++ ++L Y Q+PL  ++ +E   F +LPAG N ++A+ SY+GY+ ED+++LN+++++RG  R   Y+ V  +  +  +  F + +  P  +        ++  LD +GIV  G R+     ++ K + +      P       T+G    +   +D S+  +       ++V+LT N + +   K+ +R T+ P++GDKF+SRHGQKG CG+  +QEDMPF   G+ PD+I+NPH  PSRMTVG L+E L GK     G     T F     V+ +   L+  GY   G +++ +G TG+ ++  ++FGP YYQ+LKHMV DK+H+RARGP   +TRQP EGRS+EGGLR GEMERDC IA+GA+  L ERL+  SD + + VC  CG + +         C  C  S  ++ I++PYA KLL QELQSM+I  RL
Sbjct:   26 EDKWLLVPAFLKVRGLVKQHLVSFDHFVQEEIRSIMLSNQKITSDANPNF----------YLKYLDIRIGKPSSEEGLNMTHDKITPQECRLRDMTYSAPISVDIEYTRGNQRVFKKDLI--------IGRMPIMLRSSKCILRDLAEEELARVQECPYDPGGYFVVKGSEKVILIQEQLSKNRIMVGRNSSK-ELQCEVLS-------STSERKSKTYVTMKKGKYSVRHNQ------LTDDVPVSIIFKAMGVESDFDIVSTIGHEEKYVSAFAQTLEESINAGVYTQQQ--ALAYVTSKVKARKFTPFGSLPGTSVSVLTPPKEHEAVDFLSNSMITHIACPDGNFKMKAIYLGLMTRRLIQTELGENGLDDRDFYGNKRLELAGSLLSLLFEDVFKRFNSELKRIADNALMKTMAAPLDIVKHMRQDMITNTIVNAMSTGNWIIKRFRME-RLGVTQVLSRLSYISALGMMTRINSTFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALISHITTDSDEKPVLRLLLNSGVEDLHNVHFSHVNKPENTLIFLNGVLIGTAVDPERVVKAVRDLRRS-GLLSEFVSVSRSLTNRSVFISSDGGRLCRPYIIVKNGTPMLTQAHVQELKE---GKMIFEDFVDDGIVEYLDVNEMNDALIAVYGREIGPET------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIAYNQQKRIDSIMYLLCYPQRPLVKSKTIELTNFEKLPAGANGIIAVMSYSGYDIEDALVLNKASLDRGYGRCLVYKHVKGTAKKYPNQTF-DRLLGPALDPNTRKPIFKHKNLDQEGIVFAGARIMPKQTIINKHMPVVSGESGPGASASANTIGIAGRQVDYKDVSITYKTPTPSYAERVLLTYNEDEAHLFKVLLRQTRRPELGDKFSSRHGQKGVCGLIAQQEDMPFNDLGMVPDMIMNPHGYPSRMTVGKLMELLSGKAGVVNGTYHYGTAFG-GDQVKDVCEELAACGYNYMGKDMLTSGITGQPLSAYIYFGPIYYQKLKHMVLDKMHARARGPRAALTRQPTEGRSREGGLRLGEMERDCLIAYGASMLLIERLMVSSDEFKVDVCTGCGVIGSKGW------CQKCRSSKSMANIKIPYACKLLFQELQSMNIVPRL 1147          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Match: rpc-2 (DNA-directed RNA polymerase subunit beta [Source:UniProtKB/TrEMBL;Acc:Q27492])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 427/1175 (36.34%), Postives = 652/1175 (55.49%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWES-DGTGSPMMPNDARLRNLTYCAPVFVDV--TQKNMR--SDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTD-MHEMLKPSIDEAFVIQDEHHALNYIGSR---------GVKPGIPVA----QRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANA--TKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTL------PATDDFIETVG--NSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + +GLV+Q L SFD F+   I+ I+    K+       +             +  I + K +  E  + T   + P + RLR++TY AP+ VD+  T+ N R    D I        IG++PIMLRS+ C+L ++++ +LA++ ECP DPGGYF++ GSEKVI+ QE+++ N + V     K   +C V S       S S            GK  V          L  ++P+ I+F+AMG  SD DI+    ++        + L+ SI+     Q +  AL Y+ S+         G  PG  V+     +   A D ++   + HI   +     KA +LG M  RL+ T L     DDRD  G+KRL+LAG LL+ LF+  FK    ELK      + KT      +   ++ ++IT+ +  +++TGNW  ++   E R GV+QVL+RL++ S L  + R+NS   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLAL+++I+  S   P++  L    +E L  +  S +     T IF+NG  +G   DP++++  ++ LRRS  ++   VS+ R  + + + I +D GR+CRP IIV +G   + + H++ LKE    +  +++ V DG+VEY+D  E   ++IA+   +I   +      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+D++ ++L Y Q+PL  ++ +E   F +LPAG N ++A+ SY+GY+ ED+++LN+++++RG  R   Y+ V  +  +  +  F + +  P  +        ++  LD +GIV  G R+     ++ K + +      P       T+G    +   +D S+  +       ++V+LT N + +   K+ +R T+ P++GDKF+SRHGQKG CG+  +QEDMPF   G+ PD+I+NPH  PSRMTVG L+E L GK     G     T F     V+ +   L+  GY   G +++ +G TG+ ++  ++FGP YYQ+LKHMV DK+H+RARGP   +TRQP EGRS+EGGLR GEMERDC IA+GA+  L ERL+  SD + + VC  CG + +         C  C  S  ++ I++PYA KLL QELQSM+I  RL
Sbjct:   26 EDKWLLVPAFLKVRGLVKQHLVSFDHFVQEEIRSIMLSNQKITSDANPNF----------YLKYLDIRIGKPSSEEGLNMTHDKITPQECRLRDMTYSAPISVDIEYTRGNQRVFKKDLI--------IGRMPIMLRSSKCILRDLAEEELARVQECPYDPGGYFVVKGSEKVILIQEQLSKNRIMVGRNSSK-ELQCEVLS-------STSERKSKTYVTMKKGKYSVRHNQ------LTDDVPVSIIFKAMGVESDFDIVSTIGHEEKYVSAFAQTLEESINAGVYTQQQ--ALAYVTSKVKARKFTPFGSLPGTSVSVLTPPKEHEAVDFLSNSMITHIACPDGNFKMKAIYLGLMTRRLIQTELGENGLDDRDFYGNKRLELAGSLLSLLFEDVFKRFNSELKRIADNALMKTMAAPLDIVKHMRQDMITNTIVNAMSTGNWIIKRFRME-RLGVTQVLSRLSYISALGMMTRINSTFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALISHITTDSDEKPVLRLLLNSGVEDLHNVHFSHVNKPENTLIFLNGVLIGTAVDPERVVKAVRDLRRS-GLLSEFVSVSRSLTNRSVFISSDGGRLCRPYIIVKNGTPMLTQAHVQELKE---GKMIFEDFVDDGIVEYLDVNEMNDALIAVYGREIGPET------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIAYNQQKRIDSIMYLLCYPQRPLVKSKTIELTNFEKLPAGANGIIAVMSYSGYDIEDALVLNKASLDRGYGRCLVYKHVKGTAKKYPNQTF-DRLLGPALDPNTRKPIFKHKNLDQEGIVFAGARIMPKQTIINKHMPVVSGESGPGASASANTIGIAGRQVDYKDVSITYKTPTPSYAERVLLTYNEDEAHLFKVLLRQTRRPELGDKFSSRHGQKGVCGLIAQQEDMPFNDLGMVPDMIMNPHGYPSRMTVGKLMELLSGKAGVVNGTYHYGTAFG-GDQVKDVCEELAACGYNYMGKDMLTSGITGQPLSAYIYFGPIYYQKLKHMVLDKMHARARGPRAALTRQPTEGRSREGGLRLGEMERDCLIAYGASMLLIERLMVSSDEFKVDVCTGCGVIGSKGW------CQKCRSSKSMANIKIPYACKLLFQELQSMNIVPRL 1147          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Match: rpoa-2 (DNA-directed RNA polymerase subunit beta [Source:UniProtKB/TrEMBL;Acc:Q27493])

HSP 1 Score: 427.557 bits (1098), Expect = 3.431e-130
Identity = 339/1143 (29.66%), Postives = 524/1143 (45.84%), Query Frame = 3
Query:  354 PMMPNDARLRNLTYCA--PVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQ--EIPIIILFRAM----------GFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKD-------VITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFK-------GFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKK-ASETRKGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVG-SKSDPIIEFLEEWSMESLEEIAPSAIANAT-KIFINGSWVGIHRDPDQLMATLKKLRRSMDVV-------VSEVSIVR----------DYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRT--VNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPA-TDDFIETVGNSKFKKRD---CSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPF---NDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKN--------------------QTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            P++P + R R LTY     V +DV     R D           +GK+PIMLRS  C L  MS  +L    E P++ GGYFI+NGSEKVI  +  +AN   F   A  + ++K   K   E+     S +  N  A   +   +    +   + F ++   +P++ + +A+          GF   R+  +   Y    + +  ML    +E  + Q+   A+  IGSR     + V+ R+   +D       +I +  L H+ + E     K + L YM  +L++       P+  D+   +   ++G +L  + +       G  +   + + +    I+     LKA        IT G+ Y LATGN   +   A +   G S +  R+     +SH R ++  +   + +    R+L    WG +CP  TP+G   GL+ ++     I    S +  +   L E  M + + +A +        + +NG ++G    P    A++++  R   V         SE+++VR           Y G  I I +D+GR+ RP+                            + L  D  VE+I T E+    + + P +            H E+HPS +     ++IPFPDHNQSPRN YQ  MGKQ MG  +  +H+R D   + L + Q+P+    A E     E P G NA VA+ SYTGY+ ED++ +N+++ +RG       +   +N    R   T F  N              EE   +  DG+  PG R    +V     VT    T DF       KF   +   C L +R  EQG          + G+K   I+ R  + P IGDKFASRHGQKG     +  E +PF+  G+ PDII NPH  PSRMT+G +IE + GK +A  GE  DA+PF    D   +     +L+  GY   GNE  Y+G  GR+M   +FFG  YYQRL+HM+ DK   RA GP+  +T QP++GR K GG+RFGEMERD  IAHG +  L++RLL+ SD    Y CR CG +++  + +                    +T +C +C+K  +V  +++P   + L+ EL +M++ ++L ++
Sbjct:   67 PLLPAECRQRGLTYAGNLKVGIDVHVNGSRLD------IIEIILGKVPIMLRSEGCHLRGMSRKELVVAGEEPIEKGGYFIVNGSEKVI--RLLIANRRNFPI-AIIRKTFKEKGKLFSEFGVMMRS-VKENHTAVMMTLHYLDTGTMQLALQFRREIFYVPLMYIVKALTDKNDAVISAGFKRGRN--QDQFYS---SCILNMLAQCQEEEILNQEA--AIRAIGSRF---RVAVSDRVAPWEDDLEAGRFIIRECVLIHLDSDE----EKFHTLAYMTQKLIALVKGECAPETPDNPQFQEASVSGHILLLILRERMENIIGMVRRKLEYMSSRKDFILTSAAILKALGNHTGGEITRGMAYFLATGNLVTRVGLALQQESGFSVIAERINQLRFVSHFRAIHRGAFFMEMRTTDVRKLRPEAWGFICPVHTPDGAPCGLLNHVTASCRIVTDLSDNSNVPSLLAELGMYTHKTVALAPPGEELYPVLMNGRFLGY--VPITKAASIERYLRCAKVAKDARIPYTSEIALVRRSTDIKNIQTQYPG--IYILSDAGRLIRPV----------------------------RNLAMDA-VEHIGTFEQVYLSVVLDPEEAEPG-----VTMHQELHPSCLFSFAGNLIPFPDHNQSPRNVYQCQMGKQTMGTAVHAWHSRADNKMYRLQFPQQPMLKLEAYEKYEMDEYPLGTNACVAVISYTGYDMEDAMTINKASYQRGFAHGTVIKVERINLVTERERKTIFYRN------------PREEIKTVGPDGLPIPGRRYFLDEVYY---VTFNMETGDF----RTHKFHYAEPAYCGL-VRIVEQG--------EGDSGAKHALIQWRIERNPIIGDKFASRHGQKGINSFLWPVESLPFSETGMVPDIIFNPHGFPSRMTIGMMIESMAGKAAATHGENYDASPFVFNEDNTAINHFGELLTKAGYNYYGNETFYSGVDGRQMEMQIFFGIVYYQRLRHMIADKFQVRATGPIDPITHQPVKGRKKGGGIRFGEMERDAIIAHGTSFVLQDRLLNCSDRDVAYACRRCGSLLSVLMSSRAGSHLLKKKRKDDEPLDYTETQRCRTCDKDDQVFLLQVPRVFRYLTAELAAMNVKIKLGIE 1119          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Match: RpII140 (gene:FBgn0262955 transcript:FBtr0082892)

HSP 1 Score: 1695.25 bits (4389), Expect = 0.000e+0
Identity = 784/1160 (67.59%), Postives = 957/1160 (82.50%), Query Frame = 3
Query:   87 ITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQ-KNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT--KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            I+ E WQE+ W VI+++F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +E+Q E Q+ SG  +TP +    F QIYLSK THWE DG+ SPMMPN+ARLRNLTY AP++VD+T+ KN+   D +     +T IGKIPIMLRSTYCLLS+++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY++K  ++S +E+S R  S L VN++A+      K  +G +I+  +P++KQEIPI+I+FRA+GFV+DRDI+EH IYD DD +M EM+KPS+DEAFV+Q+++ ALN+IG+RG +PG+   +RIK+AK+++ KE LPH+G ++F  T+KAYFLGYMVHRLL  +L RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++  T K ID+ ++    LA+K+N+ITDGL+YSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGM+CPAETPEG AVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAIA+ATKIF+NG WVGIHRDP+QLMATL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV +G   +KK H++ LKE+ +  Y WQ LV+ GVVEYIDTLEEET MIAM P D+   K+  YC T+THCEIHP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY  KPL TTR+MEYLRFRELPAGIN++VAI  YTGYNQEDSVILN SA+ERG FRS FYR+  +SE++    +  EN EKP++    GMR   Y KLD DGI++PG+RVSG DV++GKT+TLP  DD +++    +F KRD S F+R +E GIVD+VMLT N+EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDM FT EG+ PDIIINPHAIPSRMT+GHLIECLQGK+ +N+GEIGDATPFNDAVNV+KIS  L +YGY   GNE+MYNG+TGRK+   VF GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGR+++GGLRFGEMERDCQI+HGAAQFL+ERL +VSD Y +++C  CG +  AN++N TF+C  C   T++S++RLPYAAKLL QEL SM+I  RL V
Sbjct:   18 ISHELWQEACWIVINAYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPAIELQAEAQHTSGEVETPPRFSLKFEQIYLSKPTHWEKDGSPSPMMPNEARLRNLTYSAPLYVDITKTKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLLSQLTDRDLTELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTEIRSCLEHSSRPTSTLWVNMMARGSQNIKKSAIGQRIIAILPYIKQEIPIMIVFRALGFVADRDILEHIIYDFDDPEMMEMVKPSLDEAFVVQEQNVALNFIGARGARPGVTKDKRIKYAKEILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLASLGRRELDDRDHYGNKRLDLAGPLLAFLFRGLFKNLMKEVRMYTQKFIDRGKDFNLELAIKTNIITDGLRYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMLCPAETPEGAAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIADATKIFVNGCWVGIHRDPEQLMATLRKLRRQMDIIVSEVSMIRDIRDREIRIYTDAGRICRPLLIVENGSLLLKKTHVEMLKERDYNNYSWQVLVASGVVEYIDTLEEETVMIAMSPYDLKQDKDYAYCTTYTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPMKPLVTTRSMEYLRFRELPAGINSIVAILCYTGYNQEDSVILNASAVERGFFRSVFYRSYKDSENKRVGDQ-EENFEKPHRGTCQGMRNAHYDKLDDDGIIAPGIRVSGDDVVIGKTITLPENDDELDS-NTKRFSKRDASTFLRNSETGIVDQVMLTLNSEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMAFTCEGLAPDIIINPHAIPSRMTIGHLIECLQGKLGSNKGEIGDATPFNDAVNVQKISTFLQEYGYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQISHGAAQFLRERLFEVSDPYRVHICNFCGLIAIANLRNNTFECKGCKNKTQISQVRLPYAAKLLFQELMSMNIAPRLMV 1175          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Match: RpII140 (gene:FBgn0262955 transcript:FBtr0344600)

HSP 1 Score: 1695.25 bits (4389), Expect = 0.000e+0
Identity = 784/1160 (67.59%), Postives = 957/1160 (82.50%), Query Frame = 3
Query:   87 ITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQ-KNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT--KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            I+ E WQE+ W VI+++F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +E+Q E Q+ SG  +TP +    F QIYLSK THWE DG+ SPMMPN+ARLRNLTY AP++VD+T+ KN+   D +     +T IGKIPIMLRSTYCLLS+++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY++K  ++S +E+S R  S L VN++A+      K  +G +I+  +P++KQEIPI+I+FRA+GFV+DRDI+EH IYD DD +M EM+KPS+DEAFV+Q+++ ALN+IG+RG +PG+   +RIK+AK+++ KE LPH+G ++F  T+KAYFLGYMVHRLL  +L RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++  T K ID+ ++    LA+K+N+ITDGL+YSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGM+CPAETPEG AVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAIA+ATKIF+NG WVGIHRDP+QLMATL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV +G   +KK H++ LKE+ +  Y WQ LV+ GVVEYIDTLEEET MIAM P D+   K+  YC T+THCEIHP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY  KPL TTR+MEYLRFRELPAGIN++VAI  YTGYNQEDSVILN SA+ERG FRS FYR+  +SE++    +  EN EKP++    GMR   Y KLD DGI++PG+RVSG DV++GKT+TLP  DD +++    +F KRD S F+R +E GIVD+VMLT N+EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDM FT EG+ PDIIINPHAIPSRMT+GHLIECLQGK+ +N+GEIGDATPFNDAVNV+KIS  L +YGY   GNE+MYNG+TGRK+   VF GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGR+++GGLRFGEMERDCQI+HGAAQFL+ERL +VSD Y +++C  CG +  AN++N TF+C  C   T++S++RLPYAAKLL QEL SM+I  RL V
Sbjct:   18 ISHELWQEACWIVINAYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPAIELQAEAQHTSGEVETPPRFSLKFEQIYLSKPTHWEKDGSPSPMMPNEARLRNLTYSAPLYVDITKTKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLLSQLTDRDLTELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTEIRSCLEHSSRPTSTLWVNMMARGSQNIKKSAIGQRIIAILPYIKQEIPIMIVFRALGFVADRDILEHIIYDFDDPEMMEMVKPSLDEAFVVQEQNVALNFIGARGARPGVTKDKRIKYAKEILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLASLGRRELDDRDHYGNKRLDLAGPLLAFLFRGLFKNLMKEVRMYTQKFIDRGKDFNLELAIKTNIITDGLRYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMLCPAETPEGAAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIADATKIFVNGCWVGIHRDPEQLMATLRKLRRQMDIIVSEVSMIRDIRDREIRIYTDAGRICRPLLIVENGSLLLKKTHVEMLKERDYNNYSWQVLVASGVVEYIDTLEEETVMIAMSPYDLKQDKDYAYCTTYTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPMKPLVTTRSMEYLRFRELPAGINSIVAILCYTGYNQEDSVILNASAVERGFFRSVFYRSYKDSENKRVGDQ-EENFEKPHRGTCQGMRNAHYDKLDDDGIIAPGIRVSGDDVVIGKTITLPENDDELDS-NTKRFSKRDASTFLRNSETGIVDQVMLTLNSEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMAFTCEGLAPDIIINPHAIPSRMTIGHLIECLQGKLGSNKGEIGDATPFNDAVNVQKISTFLQEYGYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQISHGAAQFLRERLFEVSDPYRVHICNFCGLIAIANLRNNTFECKGCKNKTQISQVRLPYAAKLLFQELMSMNIAPRLMV 1175          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Match: RpIII128 (gene:FBgn0004463 transcript:FBtr0087977)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 421/1158 (36.36%), Postives = 644/1158 (55.61%), Query Frame = 3
Query:  117 WTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRT-----CIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDE-AFVIQDEHHALNYIGSRGVKPGIPVAQR---IKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNS-KFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            W ++ +F + KGLV+Q +DSF+ F+   I++IV        +      SG D     +Y    + + K    +         P++ RLR+ TY AP+ VD+         E T  T R       IG++P+MLR + C L+  S+ +L++LNECPLDPGGYF++ G EKVI+ QE+++ N +          +   V+  V  S     +  + +L+K G        K       +  +IPI+++F+A+G VSD++I   ++   D    +      ID     +  +  AL Y+GS+ V      A      + A++++    L H+    F    KA ++  MV R+++  L +   DDRD+ G+KRL+LAG LL+ +F+  FK +  ELK    K I K +  +  +   +++  IT GL+ ++++GNW  ++   E R GV+QVL+RL++ S L  + R+NS   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  P++       +E + E++ + I N     +FING+ +G+  +   L+  L+ +RR    + S VS+   Y+ + I I+TD GR+CRP +IV + +  +K+ H+  L         + + + DG++EY+D  EE  S IA     I   +      TH EI P  +LGVCA ++P+P HNQSPRNTYQ AMGKQAMG+   N   R+D+L + L Y   P+  ++ +E   F +LPAG NA VA+ SY+GY+ ED++ILN+++I+RG  R   Y+    +  R  +  F + I  P K+        ++  LD DGIV+PG +V    +++ K   +PA        G S +       +  +  E   +++VM++ N E     KI +R T+IP+IGDKF+SRHGQKG  G+   QEDMPF   GI PD+I+NPH  PSRMTVG  +E L GK     G+    T F  +  V  I   L  +G+   G +  Y+G TG  +   ++ GP YYQ+LKHMV DK+H+RARGP  ++TRQP +GRS+EGGLR GEMERDC I++GA+  + ERL+  SD++ + VCR CG+M   +       C  C  S  VSKI +PYA KLL QEL SM++  ++ ++
Sbjct:   35 WKLVPAFLQVKGLVKQHIDSFNHFINVDIKKIV--------KANELVTSGADPLFYLKYL--DVRVGKPDIDDGFNITKATTPHECRLRDTTYSAPITVDI---------EYTRGTQRIKRNNLLIGRMPLMLRCSNCALTGKSEFELSKLNECPLDPGGYFVVRGQEKVILIQEQLSWNKMLT------EDFNGVVQCQVTSSTHEKKSRTL-VLSKHG--------KYYLKHNSMTDDIPIVVIFKALGVVSDQEI--QSLIGIDSKSQNRFGASLIDAYNLKVFTQQRALEYMGSKLVVKRFQSATTKTPSEEARELLLTTILAHVPVDNFNLQMKAIYVSMMVRRVMAAELDKTLFDDRDYYGNKRLELAGSLLSMMFEDLFKRMNWELKTIADKNIPKVKAAQFDVVKHMRAAQITAGLESAISSGNWTIKRFKME-RAGVTQVLSRLSYISALGMMTRVNSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTEVEERPVMIVAFNAGVEDIREVSGNPINNPNVFLVFINGNVLGLTLNHKHLVRNLRYMRRK-GRMGSYVSVHTSYTQRCIYIHTDGGRLCRPYVIVENRRPLVKQHHLDELNRGIRK---FDDFLLDGLIEYLDVNEENDSFIAWNEDQIEDRT------THLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGMIGYNQKNRIDSLMYNLVYPHAPMVKSKTIELTNFDKLPAGQNATVAVMSYSGYDIEDALILNKASIDRGYGRCLVYKNSKCTVKRYANQTF-DRIMGPMKDALTNKVIFKHDVLDTDGIVAPGEQVQNKQIMINKE--MPAVTSMNPLQGQSAQVPYTAVPISYKGPEPSYIERVMVSANAEEDFLIKILLRQTRIPEIGDKFSSRHGQKGVTGLIVEQEDMPFNDFGICPDMIMNPHGFPSRMTVGKTLELLGGKAGLLEGKFHYGTAFGGS-KVEDIQAELERHGFNYVGKDFFYSGITGTPLEAYIYSGPVYYQKLKHMVQDKMHARARGPKAVLTRQPTQGRSREGGLRLGEMERDCLISYGASMLIMERLMISSDAFEVDVCRTCGRMAYCSW------CHFCQSSANVSKISMPYACKLLFQELTSMNVVPKMILE 1135          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Match: RpI135 (gene:FBgn0003278 transcript:FBtr0078054)

HSP 1 Score: 358.221 bits (918), Expect = 6.768e-105
Identity = 324/1123 (28.85%), Postives = 515/1123 (45.86%), Query Frame = 3
Query:  363 PNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVI---IAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTI--YDPDD---TDMHEMLKPSIDEAFVIQDEHHALNYIGS--RGVKPGIPVAQRIKFAKDVITKE-TLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYS----------LATGNWGDQKKASETRKGVSQV---------LNRLTFASTLSHLRRLNSPS-GRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDP-----IIEFLEEWSMESLEEIAPSAIANATKIFINGSWVG-IHR-DPDQLMATLK--KLRRSMDVVVSEVSIVRDYSGKEIKIYTDSG--RICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTT-RAMEY--LRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVK-LDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKV--MLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPF-----NDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMV-----------TANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            P D+R  +++Y     V +      S + +  T     +G++PIMLRS  C L + +  ++ +  E   + GG F+I G+EK++   I   R     V     KD+     ++  +V+      S+L  N++    +G        V  + +    +P+ ++ + +   +D +I    +  Y+ D    + +  ML+   +E   +       ++IG+  R   P +P  Q      D I +E  + H+ T E     K   + +M+ +L   A  +   ++ D    + + L G     L++ +     +   +   + + K       L + S V+T  ++ +          LATGN      AS T  G+ Q          +NR+ +   +SH R ++  S     +  + RQL    WG +CP  TP+G   GL+ +L L   IS+  + DP     I + L +  M  L             +F++G  +G IH+ + ++++  L+  K+  ++  ++    I    +G+   +Y  +G  R+ RP               +  LK        W+       VEYI TLE+    IA     I     Y    TH E+  +  +   A++IP PD+NQSPRN YQ  MGKQ MG    N+  +    A+ LY  Q P T   R + Y  ++  +   G NA+VA+ SYTGY+ ED++I+N++A ERG      Y+T   +  +  S+ F  +   P           E +K LD DG+  PG ++S G          P    F   V   K  K D      + E  IV+ +  + + +    K   I +R  +   IGDKFASR GQKG C  +Y  ED+PFT  G+ PDI+ NPH  PSRMT+  +IE + GK +A  G + DATPF     N A++     ++L   GY   G E +Y+G  GR+MT  +FFG  +YQRL+HMV DK   R+ G V   T QP++GR + GG+RFGEMERD  I+HGAA  L++RL   SD     VC  CG ++           T  + +Q   C  C  ++ VS I +P++ K L  EL S++I  R 
Sbjct:   99 PTDSRQLHVSYSGMCSVRLGW----SVNGVQKTPINMDLGEVPIMLRSKACNLGQATPEEMVKHGEHDSEWGGIFVIRGNEKIVRMLIMTRRNHPICVKRSSWKDRGQNFSDLGMLVQTVREDESSLS-NVVHYLNNGTAKFMFSHVKRLSY----VPVCLILKCLMDYTDEEIYNRLVQGYESDQYYVSCVQAMLREVQNEN--VYTHAQCKSFIGNLFRARFPEVPEWQPDDDVTDFILRERVMIHLDTYE----DKFQLIVFMIQKLFQCAQGKYKVENVDSAMMQEVLLPG----HLYQKYLSERVESWVSQVRRCLQKKLTSPDAL-VTSAVMTQCMRQAGGVGRAIESFLATGN-----IASRTGLGLMQNSGLVIMAENINRMRY---MSHFRAIHRGSYFTTMRTTEARQLLPDAWGFICPVHTPDGTPCGLLNHLTLTCEISM--RPDPKLVKAIPKHLIDMGMMPLSNRRYLG-EKLYVVFLDGKHLGHIHQSEAEKIVDELRYGKIFGTLPQMMEIGFIPFKKNGQFPGLYIATGPARMMRP---------------VWNLK--------WKR------VEYIGTLEQLYMEIA-----IDAKEMYPDFTTHLELAKTHFMSNLANLIPMPDYNQSPRNMYQCQMGKQTMGTPCLNWPKQA---ANKLYRLQTPGTPLFRPVHYDNIQLDDFAMGTNAIVAVISYTGYDMEDAMIINKAAYERGFAYGSIYKTKFLTLDKK-SSYFARHPHMP-----------ELIKHLDTDGLPHPGSKLSYGS---------PLYCYFDGEVATYKVVKMD------EKEDCIVESIRQLGSFDLSPKKMVAITLRVPRPATIGDKFASRAGQKGICSQKYPAEDLPFTESGLIPDIVFNPHGFPSRMTIAMMIETMAGKGAAIHGNVYDATPFRFSEENTAIDY--FGKMLEAGGYNYYGTERLYSGVDGREMTADIFFGVVHYQRLRHMVFDKWQVRSTGAVEARTHQPIKGRKRGGGVRFGEMERDALISHGAAFLLQDRLFHNSDKTHTLVCHKCGSILAPLQRIVKRNETGGLSSQPDTCRLCGDNSSVSMIEIPFSFKYLVTELSSVNINARF 1124          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Match: polr2b (polymerase (RNA) II (DNA directed) polypeptide B [Source:ZFIN;Acc:ZDB-GENE-041008-1])

HSP 1 Score: 1702.95 bits (4409), Expect = 0.000e+0
Identity = 795/1162 (68.42%), Postives = 957/1162 (82.36%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V+++A+ G G  K  +G +IV T+P+++QE+PIII+FRA+GFVSDRDI+EH IYD DD +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGD KKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  DD +++  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+K+S +LS+YGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFLKERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTSGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTIIKDGEEQQQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVSDRDILEHIIYDFDDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKERRIKYAKEVLQKEVLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEIRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDVKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEIFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGEDVIIGKTVTLPENDDELDST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKVSNLLSEYGYHLRGNEVLYNGFTGRKLTSQIFVGPTYYQRLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLKERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Match: polr3b (polymerase (RNA) III (DNA directed) polypeptide B [Source:ZFIN;Acc:ZDB-GENE-030131-2887])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 439/1155 (38.01%), Postives = 665/1155 (57.58%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+   K  V + V  S     +   N++ K G        +       L ++ PI I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL+F S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  T   +F+NG+ +G+ RD  +L+ T + +RR+   +   VSI  + + + + I +D GR+CRP IIV +GK A+K +HI+ L +       +++ + + +VEY+D  EE    IA+    I+K++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI SPG +V    VL+ K++          +    + + R+  +  +      ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   22 EEKWKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKITSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--DQDR---KGTVGASVTSSTHEKKSR-TNMIVKQG--------RFYLKHNTLSEDAPIAIIFKAMGVESDQEIVQMI-----GTEEHVMAAFAPSLEECQKAQIFTQTQALRYIGNKVRRQRMWGGPKKTKMEEARELLASTILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLLCGEELSYPTVFLVFLNGNILGVIRDHQKLVYTFRLMRRA-GFINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKNGKPAVKNKHIEELSQGYRT---FEDFLHESLVEYLDVNEENDCNIALYEHMISKDT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTF-DKVMGPMLDAETRKPIWRHSILDADGICSPGEKVENKQVLVNKSMPTVTQTPLEGSAQPGQPQYREVPVSYKGATDSYIEKVMISSNAEDAFLVKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1123          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Match: polr3b (polymerase (RNA) III (DNA directed) polypeptide B [Source:ZFIN;Acc:ZDB-GENE-030131-2887])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 439/1155 (38.01%), Postives = 665/1155 (57.58%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+   K  V + V  S     +   N++ K G        +       L ++ PI I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL+F S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  T   +F+NG+ +G+ RD  +L+ T + +RR+   +   VSI  + + + + I +D GR+CRP IIV +GK A+K +HI+ L +       +++ + + +VEY+D  EE    IA+    I+K++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI SPG +V    VL+ K++          +    + + R+  +  +      ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   22 EEKWKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKITSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--DQDR---KGTVGASVTSSTHEKKSR-TNMIVKQG--------RFYLKHNTLSEDAPIAIIFKAMGVESDQEIVQMI-----GTEEHVMAAFAPSLEECQKAQIFTQTQALRYIGNKVRRQRMWGGPKKTKMEEARELLASTILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLLCGEELSYPTVFLVFLNGNILGVIRDHQKLVYTFRLMRRA-GFINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKNGKPAVKNKHIEELSQGYRT---FEDFLHESLVEYLDVNEENDCNIALYEHMISKDT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTF-DKVMGPMLDAETRKPIWRHSILDADGICSPGEKVENKQVLVNKSMPTVTQTPLEGSAQPGQPQYREVPVSYKGATDSYIEKVMISSNAEDAFLVKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1123          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Match: polr2b (polymerase (RNA) II (DNA directed) polypeptide B [Source:ZFIN;Acc:ZDB-GENE-041008-1])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 364/550 (66.18%), Postives = 446/550 (81.09%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIA 1709
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V+++A+ G G  K  +G +IV T+P+++QE+PIII+FRA+GFVSDRDI+EH IYD DD +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGD KKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTSGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTIIKDGEEQQQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVSDRDILEHIIYDFDDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKERRIKYAKEVLQKEVLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEIRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDVKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIA 562          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Match: polr2b (polymerase (RNA) II (DNA directed) polypeptide B [Source:ZFIN;Acc:ZDB-GENE-041008-1])

HSP 1 Score: 451.44 bits (1160), Expect = 2.700e-148
Identity = 215/354 (60.73%), Postives = 278/354 (78.53%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLG 1121
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V+++A+ G G  K  +G +IV T+P+++QE+PIII+FRA+GFVSDRDI+EH IYD DD +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLG
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTSGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTIIKDGEEQQQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVSDRDILEHIIYDFDDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKERRIKYAKEVLQKEVLPHVGVSDFCETKKAYFLG 366          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Match: nfkbia (NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-491079])

HSP 1 Score: 1707.19 bits (4420), Expect = 0.000e+0
Identity = 796/1162 (68.50%), Postives = 959/1162 (82.53%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ +G  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S++ V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTTGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVVKEGEEQIQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSSIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Match: nfkbia (NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-491079])

HSP 1 Score: 1619.75 bits (4193), Expect = 0.000e+0
Identity = 756/1097 (68.92%), Postives = 906/1097 (82.59%), Query Frame = 3
Query:  267 CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            C+   +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S++ V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   18 CNYTPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVVKEGEEQIQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSSIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1112          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Match: nfkbia (NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-491079])

HSP 1 Score: 1583.93 bits (4100), Expect = 0.000e+0
Identity = 753/1165 (64.64%), Postives = 924/1165 (79.31%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCG---IRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ +G  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S++ V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELP   NA        G  +E+  +   +A       S FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+ + ++ Q+  + +  +    +CG   ++++Q DMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTTGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVVKEGEEQIQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSSIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPVHFNAYAG----PGIQKEEETL--TAATPGWSSWSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRV-SFQVMQVFKQQSYLNIICSSCGEKALKHKQGDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1168          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Match: nfkbia (NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-491079])

HSP 1 Score: 1565.82 bits (4053), Expect = 0.000e+0
Identity = 729/1055 (69.10%), Postives = 876/1055 (83.03%), Query Frame = 3
Query:  393 YCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            Y AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S++ V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:    2 YSAPLYVDITKTVVKEGEEQIQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSSIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1054          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Match: polr3b (polymerase (RNA) III (DNA directed) polypeptide B [Source:NCBI gene;Acc:100158643])

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 434/1162 (37.35%), Postives = 664/1162 (57.14%), Query Frame = 3
Query:  102 WQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLG---VNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKPGI-----PVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAI--ANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            W   S T +  FF+ KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  +  + A+LNECPLDPGGYFI+ G EKVI+ QE+++ N + V         + + K  V  S  S+++      NL+ K G        +       L ++IPI I+F+AMG  SD++I++        T+ H +    PS++E    Q   +  AL +IG++  +  +     P   +I  A++++    L H+   EF    K  ++  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    E+K    ++I K R  +  +   ++ + IT+G+  ++++GNW   K+    R+GV+QVL+RL++ + L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    +  AN   +F+NG+ +G+ RD  +L+ T + +RR+   +   VSI  + S + + I +D GR+CRP IIV + + A+  +HI+ L +   +   +++ + + +VEY+D  EE    +A+    ITK++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R ++  F + +  P  +     +   +  LDADGI SPG +V    VL+ K +          +    + + +D  +  +      ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   26 WFLKSMTCLLFFFQVKGLVKQHIDSFNYFINDEIKKIMKANEKVTSDADPMW----------YLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIV---------EADRKGTVGASVTSSTHEKKSRTNLVVKQG--------RFYLKHNTLTEDIPIAIIFKAMGVESDQEIVQMI-----GTEEHVIAAFAPSLEECQKAQIFTQMQALKFIGNKVRRQRMWGSSGPKKSKIDEARELLASTILTHVPVKEFHFRTKCIYIAVMVRRVI-LAQGANKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISSGNW-SLKRFKMDRQGVTQVLSRLSYIAALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAANLGVEDVNLLCGEELSYANVFLVFLNGNILGVIRDHQKLVNTFRLMRRA-GYINEFVSISTNISDRCVYISSDGGRLCRPYIIVKNQRSAVTNKHIQELSQGYRS---FEDFLHESLVEYLDVNEENDCNVALYEHTITKHT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYSNQTF-DKVMGPMLDANTRKQIWRHEILDADGICSPGEKVENKQVLVNKYMPTVTQTPLEGSSVPQQPQYKDVPITYKGPTDSYIEKVMISSNAEDAFLIKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCETGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGKCGLLGYSGW------CHFCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1131          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Match: Polr2b (polymerase (RNA) II (DNA directed) polypeptide B [Source:MGI Symbol;Acc:MGI:2388280])

HSP 1 Score: 1707.96 bits (4422), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYEKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Match: Polr3b (polymerase (RNA) III (DNA directed) polypeptide B [Source:MGI Symbol;Acc:MGI:1917678])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 436/1156 (37.72%), Postives = 663/1156 (57.35%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP----GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIA--NATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  +  + A+LNECPLDPGGYFI+ G EKVI+ QE+++ N + V  A  K +   +V S   +  +S +N+ V    K G        +       L ++IPI+I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +     G P   +I+ A++++    L H+   EF    K  +   MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    E+K    ++I K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL++ S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  N   +F+NG+ +G+ RD  +L++T + +RR+   +   VSI  + + + + I +D GR+CRP IIV   K A+  +H++ L   A     +++ + + +VEY+D  EE    IA+    I K++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y QKP+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI SPG +V    VL+ K++          +    + + +D  +  +      ++KVM+++N E +   K+ +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  +GY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +        +  C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   24 EEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMW----------YLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILIQEQLSKNRIIV-EADRKGAVGASVTSST-HEKKSRTNMAV----KQG--------RFYLRHNTLSEDIPIVIIFKAMGVESDQEIVQMI-----GTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVI-LAQGDNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVFLNGNILGVIRDHKKLVSTFRLMRRA-GYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKKQKPAVTNKHMEEL---AQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTF-DKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLL------GYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1126          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Match: Polr1b (polymerase (RNA) I polypeptide B [Source:MGI Symbol;Acc:MGI:108014])

HSP 1 Score: 377.096 bits (967), Expect = 1.829e-111
Identity = 311/1120 (27.77%), Postives = 505/1120 (45.09%), Query Frame = 3
Query:  363 PNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFP---AKDKYSYKCNVKSMVEYSFR------SASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDD-----TDMHEMLKPSIDEAFVIQDEHHALNYIGS-RGVKPGIP-VAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKS----------NVITDGLKYSLATGNWGDQKKASETR-KGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNL-ALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFING---SWVGIHRDPD--QLMATLKKLRRSMDVVVSEVSIVRDYSGKE-----IKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEE---TLGMREEE---YVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGS---KFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPF---NDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVT----------ANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            P + R R  TY   +  D++     + + +     +  +G +PIM++S  C L  +    L + +E   + GGYFIING EKVI    RM       FP    + K+  +    +    S R      SA N+ ++ +         +  K    + FL    P+    +A+   SD  I +  I   ++       + +ML+  I+E      +   LNY+G    VK  +P     ++ A+ ++ +    H+ +    +T K Y L  M  +L + A      D+ D + ++ +   G L     K   +N        ++KI+   R  KA +++ +            +T   +Y LATGN   +      +  G+  V ++L F   LSH R ++  +     +    R+L    WG +CP  TP+G   GL+ +L A+   ++    +  I   L    +  ++       ++   + ++G    WV     P+    +   K LR        EV+++   +GK      + ++T   R+ RP+                      +   G +EL        I T+E+    +A     I ++  +    TH E+ P  +L V A+ IPF DHNQSPRN YQ  MGKQ MG  +  +  R D   + L   Q PL      ++      P G NA+VA+ SYTGY+ ED++I+N+++ ERG      Y+           +EF++  EK  + E     G++  +     KLD DG+   G ++  GD      + L   + F+              ++ +  E  +VD + + +N+ GS   K   I +R  + P IGDKFASRHGQKG     +  EDMPFT  G+ PDI+ NPH  PSRMT+G LIE + GK +A  G   DATPF    +   +     +L   GY   G E +Y+G +G ++   +F G  YYQRL+HMV DK   R  G    +T QPL GR+ +GG+RFGEMERD  +AHG +  L +RL + SD    ++C  CG +++          + ++N+ + C  C +S  +  + +PY  +    EL +M+I ++L
Sbjct:  100 PAECRGRKSTYRGRLTADISW----AVNGVPKGIIKQFLGYVPIMVKSKLCNLYNLPPRVLIEHHEEAEEMGGYFIINGIEKVI----RMLIVPRRNFPIAMVRPKWKSRGLGYTQFGVSMRCVREEHSAVNMNLHYVENGTVMLNFIYRK---ELFFL----PLGFALKALVSFSDYQIFQELIKGKEEDSFFRNSVSQMLRIVIEEG--CHSQKQVLNYLGECFRVKLSLPDWYPNVEAAEFLLNQCICIHLQS----NTDKFYLLCLMTRKLFALARGECMDDNPDSLVNQEVLSPGQLFLMFLKEKMENWLV-----SIKIVLDKRAQKANVSINNENLMKIFSMGTELTRPFEYLLATGNLRSKTGLGFLQDSGLCVVADKLNFLRYLSHFRCVHRGAAFAKMRTTTVRRLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVVTKFVYTASIPALLCGLGVTPVDTAPCRPYSDCYPVLLDGVMVGWVDKDLAPEVADTLRRFKVLREKRIPPWMEVALI-PMTGKPSLYPGLFLFTTPCRLVRPV---------------------QNLELGREEL--------IGTMEQLFMNVA-----IFEDEVFGGISTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQNRSDNKLYRLQTPQSPLVRPCMYDFYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYK-----------SEFIDLSEKFKQGEDNLVFGVKPGDPRVMQKLDDDGLPFIGAKLEYGDPYY-SYLNLNTGEGFV--------------VYYKSKENCVVDNIKVCSNDMGSGKFKCICITVRIPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMMPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALEYFGEMLKAAGYNFYGTERLYSGISGMELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPLGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHMCVECGSLLSPLLEKPPPSWSAMRNRKYNCTVCGRSDTIDTVSVPYVFRYFVAELAAMNIKVKL 1132          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Match: Polr1b (polymerase (RNA) I polypeptide B [Source:MGI Symbol;Acc:MGI:108014])

HSP 1 Score: 107.842 bits (268), Expect = 3.465e-23
Identity = 155/664 (23.34%), Postives = 270/664 (40.66%), Query Frame = 3
Query:  363 PNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFP---AKDKYSYKCNVKSMVEYSFR------SASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDD-----TDMHEMLKPSIDEAFVIQDEHHALNYIG-SRGVKPGIP-VAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKS----------NVITDGLKYSLATGNWGDQKKASETR-KGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNL-ALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFING---SWVGIHRDPD--QLMATLKKLRRSMDVVVSEVSIVRDYSGKE-----IKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISN 2237
            P + R R  TY   +  D++     + + +     +  +G +PIM++S  C L  +    L + +E   + GGYFIING EKVI    RM       FP    + K+  +    +    S R      SA N+ ++ +         +  K    + FL    P+    +A+   SD  I +  I   ++       + +ML+  I+E      +   LNY+G    VK  +P     ++ A+ ++ +    H+ +    +T K Y L  M  +L + A      D+ D + ++ +   G L     K   +N        ++KI+   R  KA +++ +            +T   +Y LATGN   +      +  G+  V ++L F   LSH R ++  +     +    R+L    WG +CP  TP+G   GL+ +L A+   ++    +  I   L    +  ++       ++   + ++G    WV     P+    +   K LR        EV+++   +GK      + ++T   R+ RP+  +  G+                              E I T+E+    +A     I ++  +    TH E+ P  +L V A+ IPF DHNQSPRN YQ  MG Q   VY+S+
Sbjct:  100 PAECRGRKSTYRGRLTADISW----AVNGVPKGIIKQFLGYVPIMVKSKLCNLYNLPPRVLIEHHEEAEEMGGYFIINGIEKVI----RMLIVPRRNFPIAMVRPKWKSRGLGYTQFGVSMRCVREEHSAVNMNLHYVENGTVMLNFIYRK---ELFFL----PLGFALKALVSFSDYQIFQELIKGKEEDSFFRNSVSQMLRIVIEEG--CHSQKQVLNYLGECFRVKLSLPDWYPNVEAAEFLLNQCICIHLQS----NTDKFYLLCLMTRKLFALARGECMDDNPDSLVNQEVLSPGQLFLMFLKEKMENWLV-----SIKIVLDKRAQKANVSINNENLMKIFSMGTELTRPFEYLLATGNLRSKTGLGFLQDSGLCVVADKLNFLRYLSHFRCVHRGAAFAKMRTTTVRRLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVVTKFVYTASIPALLCGLGVTPVDTAPCRPYSDCYPVLLDGVMVGWVDKDLAPEVADTLRRFKVLREKRIPPWMEVALI-PMTGKPSLYPGLFLFTTPCRLVRPVQNLELGR-----------------------------EELIGTMEQLFMNVA-----IFEDEVFGGISTHQELFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGLQ---VYMSH 699          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Match: Polr3b (polymerase (RNA) III (DNA directed) polypeptide B [Source:MGI Symbol;Acc:MGI:1917678])

HSP 1 Score: 70.0922 bits (170), Expect = 3.792e-13
Identity = 48/143 (33.57%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  810 LKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP----GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAG 1214
            L ++IPI+I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +     G P   +I+ A++++    L H+   EF    K  +   MV R++  A      DDRD+ G+KRL+LAG
Sbjct:   39 LSEDIPIVIIFKAMGVESDQEIVQMI-----GTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVI-LAQGDNKVDDRDYYGNKRLELAG 175          
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Match: sp|Q8CFI7|RPB2_MOUSE (DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus OX=10090 GN=Polr2b PE=1 SV=2)

HSP 1 Score: 1707.96 bits (4422), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYEKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Match: sp|P30876|RPB2_HUMAN (DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1)

HSP 1 Score: 1706.81 bits (4419), Expect = 0.000e+0
Identity = 797/1162 (68.59%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLL+ ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V++LA+ G G  K  +G +IV T+P++KQE+PIII+FRA+GFVSDRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  +D +E+  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS +LSDYGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGP+ ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Match: sp|P08266|RPB2_DROME (DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster OX=7227 GN=RpII140 PE=2 SV=2)

HSP 1 Score: 1695.25 bits (4389), Expect = 0.000e+0
Identity = 784/1160 (67.59%), Postives = 957/1160 (82.50%), Query Frame = 3
Query:   87 ITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQ-KNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT--KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            I+ E WQE+ W VI+++F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +E+Q E Q+ SG  +TP +    F QIYLSK THWE DG+ SPMMPN+ARLRNLTY AP++VD+T+ KN+   D +     +T IGKIPIMLRSTYCLLS+++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY++K  ++S +E+S R  S L VN++A+      K  +G +I+  +P++KQEIPI+I+FRA+GFV+DRDI+EH IYD DD +M EM+KPS+DEAFV+Q+++ ALN+IG+RG +PG+   +RIK+AK+++ KE LPH+G ++F  T+KAYFLGYMVHRLL  +L RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++  T K ID+ ++    LA+K+N+ITDGL+YSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGM+CPAETPEG AVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAIA+ATKIF+NG WVGIHRDP+QLMATL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV +G   +KK H++ LKE+ +  Y WQ LV+ GVVEYIDTLEEET MIAM P D+   K+  YC T+THCEIHP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY  KPL TTR+MEYLRFRELPAGIN++VAI  YTGYNQEDSVILN SA+ERG FRS FYR+  +SE++    +  EN EKP++    GMR   Y KLD DGI++PG+RVSG DV++GKT+TLP  DD +++    +F KRD S F+R +E GIVD+VMLT N+EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDM FT EG+ PDIIINPHAIPSRMT+GHLIECLQGK+ +N+GEIGDATPFNDAVNV+KIS  L +YGY   GNE+MYNG+TGRK+   VF GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGR+++GGLRFGEMERDCQI+HGAAQFL+ERL +VSD Y +++C  CG +  AN++N TF+C  C   T++S++RLPYAAKLL QEL SM+I  RL V
Sbjct:   18 ISHELWQEACWIVINAYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPAIELQAEAQHTSGEVETPPRFSLKFEQIYLSKPTHWEKDGSPSPMMPNEARLRNLTYSAPLYVDITKTKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLLSQLTDRDLTELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTEIRSCLEHSSRPTSTLWVNMMARGSQNIKKSAIGQRIIAILPYIKQEIPIMIVFRALGFVADRDILEHIIYDFDDPEMMEMVKPSLDEAFVVQEQNVALNFIGARGARPGVTKDKRIKYAKEILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLASLGRRELDDRDHYGNKRLDLAGPLLAFLFRGLFKNLMKEVRMYTQKFIDRGKDFNLELAIKTNIITDGLRYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMLCPAETPEGAAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIADATKIFVNGCWVGIHRDPEQLMATLRKLRRQMDIIVSEVSMIRDIRDREIRIYTDAGRICRPLLIVENGSLLLKKTHVEMLKERDYNNYSWQVLVASGVVEYIDTLEEETVMIAMSPYDLKQDKDYAYCTTYTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPMKPLVTTRSMEYLRFRELPAGINSIVAILCYTGYNQEDSVILNASAVERGFFRSVFYRSYKDSENKRVGDQ-EENFEKPHRGTCQGMRNAHYDKLDDDGIIAPGIRVSGDDVVIGKTITLPENDDELDS-NTKRFSKRDASTFLRNSETGIVDQVMLTLNSEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMAFTCEGLAPDIIINPHAIPSRMTIGHLIECLQGKLGSNKGEIGDATPFNDAVNVQKISTFLQEYGYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRARDGGLRFGEMERDCQISHGAAQFLRERLFEVSDPYRVHICNFCGLIAIANLRNNTFECKGCKNKTQISQVRLPYAAKLLFQELMSMNIAPRLMV 1175          
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Match: sp|Q10578|RPB2_CAEEL (DNA-directed RNA polymerase II subunit RPB2 OS=Caenorhabditis elegans OX=6239 GN=rpb-2 PE=2 SV=2)

HSP 1 Score: 1661.35 bits (4301), Expect = 0.000e+0
Identity = 769/1164 (66.07%), Postives = 952/1164 (81.79%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQY-GSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHA--RYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESR-NNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            D +EI++E WQE+ W VIS++F+EKGLVRQQLDSFDEF+  ++QRIVE+ P +E+Q E Q+ G+  + P K    F QIYLSK THWE DG   PMMPN+ARLRNLTY +P++VD+T+   R D       D+  +GK+P+MLRS+YC+LS M+D DL +LNECPLDPGGYF+INGSEKV+IAQE+MA NTV+VF  KD KY++K   +S +E S R  S + VN+LA+ G G  K  +G +I+  +P++KQEIPI+I+FRA+GFVSDRDI+ H IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IG+RG KPG+   QRIK+A++++ KE LPH+G +E   T+KA+F+GYMVHRLL  AL RR  DDRDH+G+KRLDLAGPLLAFLF+  F+NL KE++    K I+K  +    + +K++ IT GL YSLATGNWGDQKKA ++R GVSQVLNRLT+ +TLSHLRR NSP GR+GK+ KPRQLHNTQWGMVCPAETPEG AVGLVKNLALMAYISVGS  +PI+EFLEEWSME+LEE++PSAIA+ATKIF+NG+WVGIHR+PDQLM TLKKLRR MD++VSEVS+VRD   +EI+IYTD+GR+CRPL+IV + K A+KK HI +LKE A    +Y W +LV  GVVE ID++EEETSMIAM+P D+ ++  YC THTHCEIHP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVY +NFH RMDTLAHVLYY QKPL TTR+MEYLRF ELPAGINA+VAI SY+GYNQEDSVI+N SAI+RG+FRS FYR+  ++E+  +N+ E  E IEKP +E+  GMR   Y KLD DGI+SPG+RVSG DV++GKTV LP  DD ++  G  K+ KRD S F+R +E GIVD+VML+ N++G+KF KIR+R+ ++PQIGDKFASRHGQKGT GI YRQEDMPFT+EG+TPDIIINPHA+PSRMT+GHLIECLQGK+SAN+GEIGDATPFND VNV+KIS +L +YGY   GNE+MYNG+TG+K+TT +FFGPTYYQRLKHMVDDKIHSRARGP+ MM RQP+EGR+++GGLRFGEMERDCQI+HGA QFL+ERL +VSD Y +YVC  CG +V AN++  +F+C +C   T+VS +R+PYA KLL QEL SM I  RL V
Sbjct:   20 DSDEISAEAWQEACWVVISAYFDEKGLVRQQLDSFDEFVQMNVQRIVEDSPPVELQSENQHLGTDMENPAKFSLKFNQIYLSKPTHWEKDGAPMPMMPNEARLRNLTYASPLYVDITKVVTRDDSATEKVYDKVFVGKVPVMLRSSYCMLSNMTDRDLTELNECPLDPGGYFVINGSEKVLIAQEKMATNTVYVFSMKDGKYAFKTECRSCLENSSRPTSTMWVNMLARGGGGGKKTAMGQRIIGILPYIKQEIPIMIVFRALGFVSDRDILGHIIYDFNDPEMMEMVKPSLDEAFVIQEQNVALNFIGARGAKPGVTREQRIKYAREILQKELLPHVGVSEHCETKKAFFIGYMVHRLLLAALGRRELDDRDHIGNKRLDLAGPLLAFLFRSLFRNLLKEMRMTAQKYINKNDDFALDVCVKTSTITRGLTYSLATGNWGDQKKAHQSRAGVSQVLNRLTYTATLSHLRRANSPIGREGKLAKPRQLHNTQWGMVCPAETPEGQAVGLVKNLALMAYISVGSLPEPILEFLEEWSMENLEEVSPSAIADATKIFVNGAWVGIHREPDQLMTTLKKLRRQMDIIVSEVSMVRDIRDREIRIYTDAGRVCRPLLIVENQKLALKKRHIDQLKEAADEANKYTWSDLVGGGVVELIDSMEEETSMIAMMPEDL-RSGGYCDTHTHCEIHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYTTNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFNELPAGINAIVAILSYSGYNQEDSVIMNNSAIDRGLFRSVFYRSYRDNEANLDNANE--ELIEKPTREKCSGMRHSLYDKLDEDGIISPGMRVSGDDVIIGKTVALPDIDDDLDASG-KKYPKRDASTFLRSSETGIVDQVMLSLNSDGNKFVKIRMRSVRLPQIGDKFASRHGQKGTMGIMYRQEDMPFTAEGLTPDIIINPHAVPSRMTIGHLIECLQGKLSANKGEIGDATPFNDTVNVQKISGLLCEYGYHLRGNEVMYNGHTGKKLTTQIFFGPTYYQRLKHMVDDKIHSRARGPIQMMNRQPMEGRARDGGLRFGEMERDCQISHGATQFLRERLFEVSDPYHVYVCNNCGLIVVANLRTNSFECKACRNKTQVSAVRIPYACKLLFQELMSMSIAPRLMV 1179          
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Match: sp|Q54J75|RPB2_DICDI (DNA-directed RNA polymerase II subunit rpb2 OS=Dictyostelium discoideum OX=44689 GN=polr2b PE=3 SV=1)

HSP 1 Score: 1400.19 bits (3623), Expect = 0.000e+0
Identity = 687/1165 (58.97%), Postives = 868/1165 (74.51%), Query Frame = 3
Query:   93 SEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQY--GSGCDTPNKCEYS--FGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNM-----RSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAK--DKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAP-SAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITK--NSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            ++  QE  WTVIS++F+EKGLVRQQLDSFDEF+  ++Q I++E P + ++ E+Q+  G    + N   +S  FGQIYLSK T  E DG    + PN AR+RNLTY AP+FVD+T+  M     + D+  TD    R  IGK+PIMLRS YC+L+E  D DL  + EC  D GGYFIINGSEKV+IAQE+M NN V+VF      KYSY   ++S  E   R  S + + +L  +  G   VG  I  T+P++KQ++P+II+FRA+GFV+D+DI+EH  YD  D  M ++++PS++E+FVIQ +  AL+Y+G RG   G    QRIKFA++V+ KE LPH+   EF  T+KA++ GY+ HRLL  +L+RR  DDRDH  +KRLDLAGPLL  LF+  FK L K+++    + IDK +E  A  A+KS  IT GLKYSLATGNWG  K    T+ GV+QVLNRLTFASTLSHLRRLN+P GR+GK+ KPRQLHNT WG+VCP+ETPEG A GLVKNLA+M+YISVGS S PI+EFLEEW+ E+LEEI+  S+I +ATKIF+NG WVGIH  PD+L++TL+ LRR  DV V EVS+VRD   KE+++YTD GR CRPL +V D K  IKK+HI +L    +  Y WQ+L+S+G+VEYID  EEET +IAM P D+    N Q   T+THCEIHPSMILG+C SIIPFPDHNQSPRNTYQ+AMGKQAMGVYI+N+  RMDT+AHVL+Y QKPL TTR+MEYL FRELPAG N  VAIA Y+GYNQEDSVILN+SAI+RG+FRS FYR   + E +  ++   E  EKP ++   GMR   Y K+D DG+V+PGVRV+G D+++GKT  LP +DD +      +  KRD S  +R +E GIVD+V+LTT+ EG KFCK+R+R+ ++PQIGDKF+SRHGQKGTCG+ YRQED+PFT EGI PDII+NPHAIPSRMT+G LIECL GKVSA+ G+ GDATPF D V V  IS+ L   GY+  G+E+MYNG+TGR+M   +F GPTYYQRLKHMVDDKIHSR+RGPV ++TRQP+EGRS++GGLRFGEMERDC I+HGAAQFLKERL D SDSY +++C ICG +  AN+K  +F+C  C   T++S+IR+PYAAKLL QEL SM I  R+F
Sbjct:   16 ADISQEDVWTVISAYFQEKGLVRQQLDSFDEFIQNTMQEIIDESPPITLRPESQHHPGQAVVSNNVSTFSVKFGQIYLSKPT-AEIDGVSQQVTPNQARIRNLTYSAPLFVDITKTVMTGSKSKGDERRTDEVLKRIFIGKVPIMLRSQYCMLNEADDRDLTTMGECSFDQGGYFIINGSEKVLIAQEKMNNNHVYVFKKSPPSKYSYVAEIRSCQETGSRPTSTMYLKMLHNTNKGP--VG--IKATVPYIKQDVPVIIVFRALGFVADKDILEHICYDFKDAQMMDLMRPSLEESFVIQSQEVALDYLGKRGSTMGTR-EQRIKFAREVLQKEMLPHVSVAEFYETKKAFYFGYITHRLLLASLERRPLDDRDHFANKRLDLAGPLLGTLFRQLFKKLTKDVRLYLQRCIDKDKEFIASSAVKSKTITSGLKYSLATGNWGSSKSGG-TKSGVAQVLNRLTFASTLSHLRRLNTPIGREGKLAKPRQLHNTHWGIVCPSETPEGQACGLVKNLAMMSYISVGSASQPILEFLEEWTTENLEEISDLSSIFSATKIFVNGMWVGIHHQPDKLLSTLRLLRRCGDVSV-EVSVVRDIREKELRLYTDPGRCCRPLFVVQDNKVQIKKQHINKLIN--NDEYKWQDLLSEGIVEYIDAEEEETVLIAMTPEDLVPMPNEQIVHTYTHCEIHPSMILGICCSIIPFPDHNQSPRNTYQAAMGKQAMGVYITNYQLRMDTMAHVLFYPQKPLVTTRSMEYLHFRELPAGQNVCVAIACYSGYNQEDSVILNQSAIDRGLFRSMFYRAYKD-EQKKQTSLMEEVFEKPERDTCAGMRHGSYEKIDDDGLVAPGVRVAGDDIIIGKTTPLPPSDDDLGP-KTRRHTKRDSSTALRSSETGIVDQVILTTSGEGFKFCKVRVRSMRVPQIGDKFSSRHGQKGTCGMAYRQEDLPFTVEGIVPDIIVNPHAIPSRMTIGQLIECLLGKVSASTGDEGDATPFTD-VTVEAISQALHKIGYQMTGHEVMYNGHTGRRMDAQIFIGPTYYQRLKHMVDDKIHSRSRGPVQILTRQPVEGRSRDGGLRFGEMERDCMISHGAAQFLKERLFDQSDSYRVHICDICGLIAIANLKKNSFECRRCKNKTQISQIRMPYAAKLLFQELMSMSIAPRMF 1167          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A1S8X7D9 (DNA-directed RNA polymerase subunit beta OS=Opisthorchis viverrini OX=6198 GN=X801_01472 PE=3 SV=1)

HSP 1 Score: 1743.78 bits (4515), Expect = 0.000e+0
Identity = 814/1162 (70.05%), Postives = 972/1162 (83.65%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGC-DTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLA---KSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            +D+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+ TSIQ+IVE+ P +E+Q E Q+ SG  +TP +    F QIYLSKATHWE DG+  PM PNDARLRNLTY AP++VDV +K +R D E     ++  IGKIPIMLRSTYCLLS MSD DLA+LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+YK  ++S++E+S R AS L +N++A   K GS +  +G +IV  +P++KQEIP++I+FRA+GFV+DRDI+EH IYD DDT+M EM+KPS+D+AFVIQ++  ALN+IGSRG +PG+   +RIK+AK+++ KETLPH+G ++F  TRKAYFLGYMVHRLL  ALKRR+ DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K IDK ++    LA++S +ITDGLKYSLATGNWGDQKKA++ R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ +PRQLHNT WGM+CPAETPEG AVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAI    KIF+NG WVGIH  PD LM TL+KLRR +DV+VSEVS+VRDY  +EI+IYTD+GRICRPL+IV  GK  +K+ HI+ LK+KA+ RY WQ+LV  GVVEYIDTLEEET MIAM PA++     YCKTHTHCEIHPSMILG+CASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLA+VLYY QKPL  TR+MEYLRFRELPAGINA+VAIA+YTGYNQEDSVILNESAI+RG FRSEFYRT  + E+R+   +  E  EKPN ++  GMR   Y KLD DG+++PG RVSG DVL+GKT+TLP  +D +E  G  ++ KRD S+FMR++E GIVD+VM+T NNEG+KFCK+R+RTTK PQ+GDKFASRHGQKGTCGIRYRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNVRKIS +L +YGY+  GNEIMYNG+TGRK+ + +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL   SD Y +YVC +CG +  A+ +N+T++C SC  +T++S ++LPYA KLL QEL SM I  R+ V
Sbjct:   86 EDDEITPDMWQEACWIVISSYFDEKGLVRQQLDSFDEFIQTSIQKIVEDSPIIELQAEAQHTSGVLETPVQYRLKFEQIYLSKATHWEKDGSSVPMTPNDARLRNLTYAAPLYVDVMKKIIRDDGEEEKPLEKKFIGKIPIMLRSTYCLLSIMSDRDLAELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFRQKDSKYAYKTEIRSVLEHSSRPASTLWINMMARGGKDGSKRATIGQRIVAILPYIKQEIPVLIVFRALGFVADRDILEHIIYDFDDTEMREMIKPSLDDAFVIQEQKVALNFIGSRGARPGVTKEKRIKYAKEILQKETLPHVGVSDFCETRKAYFLGYMVHRLLLAALKRRDVDDRDHYGNKRLDLAGPLLAFLFRGLFRNLTKEIRLYAQKFIDKGKDFNLELAIRSQIITDGLKYSLATGNWGDQKKANQARPGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLARPRQLHNTLWGMICPAETPEGSAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIGKTCKIFVNGCWVGIHNSPDHLMVTLRKLRRQVDVIVSEVSMVRDYRDQEIRIYTDAGRICRPLVIVEKGKLLLKRSHIEFLKDKAYNRYSWQDLVLSGVVEYIDTLEEETVMIAMGPAEMQAAVHYCKTHTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLANVLYYPQKPLVATRSMEYLRFRELPAGINAIVAIATYTGYNQEDSVILNESAIQRGFFRSEFYRTYKDQEARHGMDQ-EEVFEKPNPQQCQGMRHAIYDKLDDDGLIAPGTRVSGDDVLIGKTITLPENEDEMEG-GQRRYTKRDASVFMRRSEYGIVDQVMITWNNEGNKFCKVRVRTTKTPQVGDKFASRHGQKGTCGIRYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVRKISLLLQEYGYQHTGNEIMYNGFTGRKLNSQIFLGPTYYQRLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFFASDPYQVYVCNLCGLIAIAHQRNKTYECRSCKNTTQISLVKLPYACKLLFQELMSMSIAPRMMV 1245          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A3Q0KLS8 (DNA-directed RNA polymerase subunit beta OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1741.86 bits (4510), Expect = 0.000e+0
Identity = 809/1163 (69.56%), Postives = 971/1163 (83.49%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLA---KSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            +D+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+ TSIQ+IVE+ P +E+Q E Q+  G  +TP +    F QIYLSKATHWE DG+  PM PNDARLRNLTY AP++VDV +K +R + E     ++  IGKIPIMLRSTYCLLS MSD DLA+LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+YK  ++S +E+S R AS L +N++A   K GS +  +G +IV  +P++KQEIP++I+FRA+GFV+DRDI+EH IYD DDT+M EM+KPS+D+AFVIQ++  ALN+IGSRG +PG+   +RIK+AK+++ KETLPH+G ++F  TRKAYFLGYMVHRLL  ALKRR+ DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K IDK ++    LA++S +ITDGLKYSLATGNWGDQKKA++ R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ +PRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAI    KIF+NG WVGIH  PD LM TL+KLRR +DV+VSEVS++RDY  +EI+IYTD+GRICRPL+IV  GK  +K+ HI+ LK+KA+ RY WQ+LV  GVVEYIDTLEEET MIAM PA++     YCKTHTHCEIHPSMILG+CASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLA+VLYY QKPL  TR+MEYLRFRELPAGINA+VAIA+YTGYNQEDSVI+NESAI+RG FRSEFYRT  + E+R +  +  E  EKPN +   GMR   Y KLD DG+++PG RVSG DVL+GKT+TLP  +D +E  G  ++ KRD S+FMR++E GIVD+VM+T NNEG+KFCK+R+RTTK PQ+GDKFASRHGQKGTCGIRYRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNVRKIS +L +YGY+  GNEIMYNG+TGRK+ + +F GPTYYQRLKHMVDDKIHSR+RGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL   SD Y +YVC +CG +  A+ +N+T++C SC  +T++S ++LPYA KLL QEL SM I  R+ ++
Sbjct:   31 EDDEITPDMWQEACWIVISSYFDEKGLVRQQLDSFDEFIQTSIQKIVEDSPIIELQAEAQHSGGILETPVQYRLKFEQIYLSKATHWEKDGSSVPMTPNDARLRNLTYAAPLYVDVMKKIIRDEIEEEKPLEKKFIGKIPIMLRSTYCLLSVMSDRDLAELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFKQKDSKYAYKTEIRSCLEHSSRPASTLWINMMARGGKDGSKRATIGQRIVAILPYIKQEIPVLIVFRALGFVADRDILEHIIYDFDDTEMREMIKPSLDDAFVIQEQKVALNFIGSRGARPGVTKEKRIKYAKEILQKETLPHVGVSDFCETRKAYFLGYMVHRLLLAALKRRDVDDRDHYGNKRLDLAGPLLAFLFRGLFRNLTKEIRLYAQKFIDKGKDFNLELAIRSQIITDGLKYSLATGNWGDQKKANQARPGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLARPRQLHNTLWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIGKTCKIFVNGCWVGIHSSPDHLMGTLRKLRRQVDVIVSEVSMIRDYRDQEIRIYTDAGRICRPLVIVEKGKLLLKRSHIELLKDKAYNRYSWQDLVLSGVVEYIDTLEEETVMIAMGPAEMQAAVNYCKTHTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLANVLYYPQKPLVATRSMEYLRFRELPAGINAIVAIATYTGYNQEDSVIINESAIQRGFFRSEFYRTYKDQETR-HGMDLEEVFEKPNPQNCQGMRHAIYDKLDDDGLIAPGTRVSGDDVLIGKTITLPENEDEMEG-GQRRYTKRDASVFMRRSEYGIVDQVMVTWNNEGNKFCKVRVRTTKAPQVGDKFASRHGQKGTCGIRYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVRKISLLLQEYGYQHTGNEIMYNGFTGRKLNSQIFLGPTYYQRLKHMVDDKIHSRSRGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFFASDPYQVYVCNLCGLIAIAHQRNKTYECRSCKNTTQISLVKLPYACKLLFQELMSMSIAPRMMIN 1191          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: A0A4Z2DPU4 (DNA-directed RNA polymerase subunit beta OS=Schistosoma japonicum OX=6182 GN=EWB00_010224 PE=3 SV=1)

HSP 1 Score: 1740.32 bits (4506), Expect = 0.000e+0
Identity = 808/1163 (69.48%), Postives = 970/1163 (83.40%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLA---KSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            +D+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+ TSIQ+IVE+ P +E+Q E Q+  G  + P +    F QIYLSKATHWE DG+  PM PNDARLRNLTY AP++VDV +K +R + E     ++  IGKIPIMLRSTYCLLS MSD DLA+LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+YK  ++S +E+S R AS L +N++A   K GS +  +G +IV  +P++KQEIP++I+FRA+GFV+DRDI+EH IYD DDT+M EM+KPS+D+AFVIQ++  ALN+IGSRG +PG+   +RIK+AK+++ KETLPH+G ++F  TRKAYFLGYMVHRLL  ALKRR+ DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K IDK ++    LA++S +ITDGLKYSLATGNWGDQKKA++ R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ +PRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAI    KIF+NG WVGIH  PD LM TL+KLRR +DV+VSEVS++RDY  +EI+IYTD+GRICRPL+IV  GK  +K+ HI+ LK+KA+ RY WQ+LV  GVVEYIDTLEEET MIAM PA++     YCKTHTHCEIHPSMILG+CASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLA+VLYY QKPL  TR+MEYLRFRELPAGINA+VAIA+YTGYNQEDSVI+NESAI+RG FRSEFYRT  + E+R +  +  E  EKPN +   GMR   Y KLD DG+++PG RVSG DVL+GKT+TLP  +D +E  G  ++ KRD S+FMR++E GIVD+VM+T NNEG+KFCK+R+RTTK PQ+GDKFASRHGQKGTCGIRYRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNVRKIS +L +YGY+  GNEIMYNG+TGRK+ + +F GPTYYQRLKHMVDDKIHSR+RGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL   SD Y +YVC +CG +  A+ +N+T++C SC  +T++S ++LPYA KLL QEL SM I  R+ ++
Sbjct:   31 EDDEITPDMWQEACWIVISSYFDEKGLVRQQLDSFDEFIQTSIQKIVEDSPIIELQAEAQHSGGILENPVQYRLKFEQIYLSKATHWEKDGSSVPMTPNDARLRNLTYAAPLYVDVMKKIIRDETEEEKPLEKKFIGKIPIMLRSTYCLLSVMSDRDLAELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFKQKDSKYAYKTEIRSCLEHSSRPASTLWINMMARGGKDGSKRATIGQRIVAILPYIKQEIPVLIVFRALGFVADRDILEHIIYDFDDTEMREMIKPSLDDAFVIQEQKVALNFIGSRGARPGVTKEKRIKYAKEILQKETLPHVGVSDFCETRKAYFLGYMVHRLLLAALKRRDVDDRDHYGNKRLDLAGPLLAFLFRGLFRNLTKEIRLYAQKFIDKGKDFNLELAIRSQIITDGLKYSLATGNWGDQKKANQARPGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLARPRQLHNTLWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIGKTCKIFVNGCWVGIHSSPDHLMGTLRKLRRQVDVIVSEVSMIRDYRDQEIRIYTDAGRICRPLVIVEKGKLLLKRSHIELLKDKAYNRYSWQDLVLSGVVEYIDTLEEETVMIAMGPAEMQAAVNYCKTHTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLANVLYYPQKPLVATRSMEYLRFRELPAGINAIVAIATYTGYNQEDSVIINESAIQRGFFRSEFYRTYKDQETR-HGMDLEEVFEKPNPQNCQGMRHAIYDKLDDDGLIAPGTRVSGDDVLIGKTITLPENEDEMEG-GQRRYTKRDASVFMRRSEYGIVDQVMVTWNNEGNKFCKVRVRTTKAPQVGDKFASRHGQKGTCGIRYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVRKISLLLQEYGYQHTGNEIMYNGFTGRKLNSQIFLGPTYYQRLKHMVDDKIHSRSRGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFFASDPYQVYVCNLCGLIAIAHQRNKTYECRSCKNTTQISLVKLPYACKLLFQELMSMSIAPRMMIN 1191          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: C1LF25 (DNA-directed RNA polymerase subunit beta OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 1738.39 bits (4501), Expect = 0.000e+0
Identity = 807/1163 (69.39%), Postives = 970/1163 (83.40%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLA---KSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            +D+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+ TSIQ+IVE+ P +E+Q E Q+  G  + P +    F QIYLSKATHWE DG+  PM PNDARLRNLTY AP++VDV +K +R + E     ++  IGKIPIMLRSTYCLLS MSD DLA+LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+YK  ++S +E+S R AS L +N++A   K GS +  +G +IV  +P++KQEIP++I+FRA+GFV+DRDI+EH IYD DDT+M EM+KPS+D+AFVIQ++  ALN+IGSRG +PG+   +RIK+AK+++ KETLPH+G ++F  TRKAYFLGYMVHRLL  ALKRR+ DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K IDK ++    LA++S +ITDGLKYSLATGNWGDQKKA++ R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ +PRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAI    KIF+NG WVGIH  PD LM TL+KLRR +DV+VSEVS++RDY  +EI+IYTD+GRICRPL+IV  GK  +K+ HI+ LK+KA+ RY WQ+LV  GVVEYIDTLEEET MIAM PA++     YCKTHTHCEIHPSMILG+CASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLA+VLYY QKPL  TR+MEYLRFRELPAGINA+VAIA+YTGYNQEDSVI+NESAI+RG FRSEFYRT  + E+R +  +  E  EKPN +   GMR   Y KLD DG+++PG RVSG DVL+GKT+TLP  +D +E  G  ++ KRD S+FMR++E GIVD+VM+T NNEG+KFCK+R+RTTK PQ+GDKFASRHGQKGTCGIRYRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNVRKIS +L +YGY+  GNEIMYNG+TGRK+ + +F GPTYYQRLKHMVDDKIHS++RGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL   SD Y +YVC +CG +  A+ +N+T++C SC  +T++S ++LPYA KLL QEL SM I  R+ ++
Sbjct:   31 EDDEITPDMWQEACWIVISSYFDEKGLVRQQLDSFDEFIQTSIQKIVEDSPIIELQAEAQHSGGILENPVQYRLKFEQIYLSKATHWEKDGSSVPMTPNDARLRNLTYAAPLYVDVMKKIIRDETEEEKPLEKKFIGKIPIMLRSTYCLLSVMSDRDLAELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFKQKDSKYAYKTEIRSCLEHSSRPASTLWINMMARGGKDGSKRATIGQRIVAILPYIKQEIPVLIVFRALGFVADRDILEHIIYDFDDTEMREMIKPSLDDAFVIQEQKVALNFIGSRGARPGVTKEKRIKYAKEILQKETLPHVGVSDFCETRKAYFLGYMVHRLLLAALKRRDVDDRDHYGNKRLDLAGPLLAFLFRGLFRNLTKEIRLYAQKFIDKGKDFNLELAIRSQIITDGLKYSLATGNWGDQKKANQARPGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLARPRQLHNTLWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIGKTCKIFVNGCWVGIHSSPDHLMGTLRKLRRQVDVIVSEVSMIRDYRDQEIRIYTDAGRICRPLVIVEKGKLLLKRSHIELLKDKAYNRYSWQDLVLSGVVEYIDTLEEETVMIAMGPAEMQAAVNYCKTHTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLANVLYYPQKPLVATRSMEYLRFRELPAGINAIVAIATYTGYNQEDSVIINESAIQRGFFRSEFYRTYKDQETR-HGMDLEEVFEKPNPQNCQGMRHAIYDKLDDDGLIAPGTRVSGDDVLIGKTITLPENEDEMEG-GQRRYTKRDASVFMRRSEYGIVDQVMVTWNNEGNKFCKVRVRTTKAPQVGDKFASRHGQKGTCGIRYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVRKISLLLQEYGYQHTGNEIMYNGFTGRKLNSQIFLGPTYYQRLKHMVDDKIHSQSRGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFFASDPYQVYVCNLCGLIAIAHQRNKTYECRSCKNTTQISLVKLPYACKLLFQELMSMSIAPRMMIN 1191          
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Match: G4VSK5 (DNA-directed RNA polymerase subunit beta OS=Schistosoma mansoni OX=6183 GN=Smp_130680 PE=3 SV=1)

HSP 1 Score: 1734.15 bits (4490), Expect = 0.000e+0
Identity = 805/1155 (69.70%), Postives = 964/1155 (83.46%), Query Frame = 3
Query:   99 FWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLA---KSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
             WQE+ W VISS+F+EKGLVRQQLDSFDEF+ TSIQ+IVE+ P +E+Q E Q+  G  +TP +    F QIYLSKATHWE DG+  PM PNDARLRNLTY AP++VDV +K +R + E     ++  IGKIPIMLRSTYCLLS MSD DLA+LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+YK  ++S +E+S R AS L +N++A   K GS +  +G +IV  +P++KQEIP++I+FRA+GFV+DRDI+EH IYD DDT+M EM+KPS+D+AFVIQ++  ALN+IGSRG +PG+   +RIK+AK+++ KETLPH+G ++F  TRKAYFLGYMVHRLL  ALKRR+ DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K IDK ++    LA++S +ITDGLKYSLATGNWGDQKKA++ R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ +PRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEIAPSAI    KIF+NG WVGIH  PD LM TL+KLRR +DV+VSEVS++RDY  +EI+IYTD+GRICRPL+IV  GK  +K+ HI+ LK+KA+ RY WQ+LV  GVVEYIDTLEEET MIAM PA++     YCKTHTHCEIHPSMILG+CASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLA+VLYY QKPL  TR+MEYLRFRELPAGINA+VAIA+YTGYNQEDSVI+NESAI+RG FRSEFYRT  + E+R +  +  E  EKPN +   GMR   Y KLD DG+++PG RVSG DVL+GKT+TLP  +D +E  G  ++ KRD S+FMR++E GIVD+VM+T NNEG+KFCK+R+RTTK PQ+GDKFASRHGQKGTCGIRYRQEDMPFT EGITPDIIINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNVRKIS +L +YGY+  GNEIMYNG+TGRK+ + +F GPTYYQRLKHMVDDKIHSR+RGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL   SD Y +YVC +CG +  A+ +N+T++C SC  +T++S ++LPYA KLL QEL SM I  R+ ++
Sbjct:    1 MWQEACWIVISSYFDEKGLVRQQLDSFDEFIQTSIQKIVEDSPIIELQAEAQHSGGILETPVQYRLKFEQIYLSKATHWEKDGSSVPMTPNDARLRNLTYAAPLYVDVMKKIIRDEIEEEKPLEKKFIGKIPIMLRSTYCLLSVMSDRDLAELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFKQKDSKYAYKTEIRSCLEHSSRPASTLWINMMARGGKDGSKRATIGQRIVAILPYIKQEIPVLIVFRALGFVADRDILEHIIYDFDDTEMREMIKPSLDDAFVIQEQKVALNFIGSRGARPGVTKEKRIKYAKEILQKETLPHVGVSDFCETRKAYFLGYMVHRLLLAALKRRDVDDRDHYGNKRLDLAGPLLAFLFRGLFRNLTKEIRLYAQKFIDKGKDFNLELAIRSQIITDGLKYSLATGNWGDQKKANQARPGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLARPRQLHNTLWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEIAPSAIGKTCKIFVNGCWVGIHSSPDHLMGTLRKLRRQVDVIVSEVSMIRDYRDQEIRIYTDAGRICRPLVIVEKGKLLLKRSHIELLKDKAYNRYSWQDLVLSGVVEYIDTLEEETVMIAMGPAEMQAAVNYCKTHTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLANVLYYPQKPLVATRSMEYLRFRELPAGINAIVAIATYTGYNQEDSVIINESAIQRGFFRSEFYRTYKDQETR-HGMDLEEVFEKPNPQNCQGMRHAIYDKLDDDGLIAPGTRVSGDDVLIGKTITLPENEDEMEG-GQRRYTKRDASVFMRRSEYGIVDQVMVTWNNEGNKFCKVRVRTTKAPQVGDKFASRHGQKGTCGIRYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVRKISLLLQEYGYQHTGNEIMYNGFTGRKLNSQIFLGPTYYQRLKHMVDDKIHSRSRGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFFASDPYQVYVCNLCGLIAIAHQRNKTYECRSCKNTTQISLVKLPYACKLLFQELMSMSIAPRMMIN 1153          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Match: POLR2B (RNA polymerase II subunit B [Source:HGNC Symbol;Acc:HGNC:9188])

HSP 1 Score: 1572.76 bits (4071), Expect = 0.000e+0
Identity = 736/1067 (68.98%), Postives = 882/1067 (82.66%), Query Frame = 3
Query:  357 MMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            MMPN+ARLRNLTY AP++VD+T+  ++  +E   T   +T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S++ V+++A+ G G  K  +G +IV T+P+++QE+PIII+FRA+GFVSDRDI+EH IYD DD +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++                LA+K+ +I+DGLKYSLATGNWGD KKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +EE  GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  DD +++  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+K+S +LS+YGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL + SD Y ++VC +CG M  AN +  T++C  C   T++S +RLPYA KLL QEL SM I  R+ 
Sbjct:    1 MMPNEARLRNLTYSAPLYVDITKTIIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSSIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVSDRDILEHIIYDFDDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKERRIKYAKEVLQKEVLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEIR--------------IYLAIKTRIISDGLKYSLATGNWGDVKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEIFEKPKREECQGMRHAIYDKLDDDGLIAPGVRVSGEDVIIGKTVTLPENDDELDST-NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKVSNLLSEYGYHLRGNEVLYNGFTGRKLTSQIFVGPTYYQRLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRLPYACKLLFQELMSMSIAPRMM 1051          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Match: polr3b (RNA polymerase III subunit B [Source:NCBI gene;Acc:103044942])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 440/1158 (38.00%), Postives = 668/1158 (57.69%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLG---VNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            E  W ++ +F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+       K  V  S  S+++      N++ K G        +       L ++ PI I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL+F S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  T   +F+NG+ +G+ R+  +L++T + +RR+   +   VSI  + + + + I +D GR+CRP IIV +G+ A+K +HI+ L   +     +++ + + +VEY+D  EE    IA+    ITK++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI SPG RV    VL+ K++          +    + + RD  +  + +    ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   24 EEKWKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--EQDR-------KGAVGASVTSSTHEKKSRTNMIVKQG--------RFYLKHNTLSEDAPIAIIFKAMGVESDQEIVQMI-----GTEEHVMAAFAPSLEECQKAQIFTQTQALKYIGNKVRRQRMWGGPKKTKMEEARELLASTILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGNNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLLCGEELSYPTVFLVFLNGNILGVIRNHQKLVSTFRLMRRA-GFINEFVSISTNVTDRCVYISSDGGRLCRPYIIVKNGQPAVKNKHIEEL---SQGYRNFEDFLHESLVEYLDVNEENDCSIALYEHMITKDT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTF-DKVMGPMLDAETRKPIWRHSILDADGICSPGERVENKQVLVNKSMPTVTQTPLEGSTQPGQPQYRDVPITYKGSTDSYIEKVMISSNAEDAFLVKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1125          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Match: polr3b (RNA polymerase III subunit B [Source:NCBI gene;Acc:103044942])

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 438/1149 (38.12%), Postives = 663/1149 (57.70%), Query Frame = 3
Query:  135 FFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLG---VNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+       K  V  S  S+++      N++ K G        +       L ++ PI I+F+AMG  SD++I++        T+ H M    PS++E    Q   +  AL YIG++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL+F S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  T   +F+NG+ +G+ R+  +L++T + +RR+   +   VSI  + + + + I +D GR+CRP IIV +G+ A+K +HI+ L   +     +++ + + +VEY+D  EE    IA+    ITK++      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI SPG RV    VL+ K++          +    + + RD  +  + +    ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   GI PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +R+PYA KLL QELQSM+I  RL
Sbjct:   39 FLQVKGLVKQHIDSFNYFINVEIKKIMKANEKVTSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--EQDR-------KGAVGASVTSSTHEKKSRTNMIVKQG--------RFYLKHNTLSEDAPIAIIFKAMGVESDQEIVQMI-----GTEEHVMAAFAPSLEECQKAQIFTQTQALKYIGNKVRRQRMWGGPKKTKMEEARELLASTILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGNNKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSFISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLAFNLGVEDVNLLCGEELSYPTVFLVFLNGNILGVIRNHQKLVSTFRLMRRA-GFINEFVSISTNVTDRCVYISSDGGRLCRPYIIVKNGQPAVKNKHIEEL---SQGYRNFEDFLHESLVEYLDVNEENDCSIALYEHMITKDT------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLRRYTNQTF-DKVMGPMLDAETRKPIWRHSILDADGICSPGERVENKQVLVNKSMPTVTQTPLEGSTQPGQPQYRDVPITYKGSTDSYIEKVMISSNAEDAFLVKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRL 1131          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Match: polr1b (RNA polymerase I subunit B [Source:NCBI gene;Acc:103036003])

HSP 1 Score: 397.897 bits (1021), Expect = 3.710e-119
Identity = 327/1193 (27.41%), Postives = 528/1193 (44.26%), Query Frame = 3
Query:  153 LVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGS-----PMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFP-AKDKYSYKCNVKSMVEYSF--------RSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQE--IPIIILFRAMGFVSDRDIIEHTIYDPDDTDMH-----EMLKPSIDEAFVIQDEHHALNYIGSR-GVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRS-TRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFK----GFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETR-KGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPII-EFLEEWSMESLEEIAPSAIANATKIFINGSWVG-IHRD-PDQLMATLKKLRRSMD---------VVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETL--GMREEEY---VKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGS---KFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFN---DAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVT----------ANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            LV+  +DSFD+ L   + ++V+  P +E   +                    ++    H  +   G       + P + R R  TY   +  DV+     S + +     +  +G++PIM++S  C L  +S  +L + +E   + GGYFI+NG EKVI    RM       FP A  +  +K   +   +Y           +A N+ ++ L             I+    + K+   +P+    +A+   SD  I +  I   ++   +     EML+  ++E    + +   LNY+G R  VK  +P      +  +   K  L        +S + K Y L  M  +L + A +    ++ D +  + +   G L     K    G+  ++   L   + ++   T E    +      IT   +Y LATGN   +      +  G+  V ++L F   LSH R ++  +     +    R+L    WG +CP  TP+G   GL+ ++     I   + S   +   L    +  +E       +    + ++G+ +G + +D    L+ +L++ +   +         V+V +      Y G  + ++T   R+ RP+        A+ K+ +    E+ +   G  E          D +EE  +                   TH E+ P  +L V AS IPF DHNQSPRN YQ  MGKQ MG  + ++  R D   + L   Q PL      ++      P G NAVVA+ SYTGY+ ED++I+N+S+ ERG      Y+           TE ++  EK   E+++  G +  +     KLD DG+ + G  ++ GD         P         G S         F +  E  +VD + + +N+ G+   K   I +R  + P IGDKFASRHGQKG     +  EDMPFT  G+TPDI+ NPH  PSRMT+G LIE + GK +A  G   DATPF    +   +     +L   GY   G E +Y+G +G ++   +F G  YYQRL+HMV DK   R  G    +T QP+ GR+ +GG+RFGEMERD  +AHG++  L +RL + SD     VC  CG +++          +  +++   C+ C KS  +  + +PY  +    EL +M+I ++L V
Sbjct:   38 LVKAHIDSFDQALSDGLAQVVQAIPPMEFMHKGD-------------RISLAFVEATVHNPTVAKGGICKDLRVFPAECRGRRCTYRGKLVADVSW----SVNGVPKGIIKQSLGQVPIMVKSKLCNLHGLSPKELIEHHEEAEEMGGYFIVNGIEKVI----RMLIMPRRNFPIALSRPKFKSRGQGYTQYGIAVHCVKDEHTAINMNLHYLDNG---------TIMLNFIYHKELFFLPLGFALKALVDFSDYQIYQELIKGKEENSFYKSCVSEMLRLVMEEGCTTRAK--VLNYLGERFRVKLHLPEW----YTNEQCAKFLLDECLCIHLKSDSEKFYNLCLMTRKLFAFAKQECQEENPDSLMCQEVLTPGQLFLMFLKEKMTGWLVSVKLALDKRSQRVAGITAENLTRIFNLGTDITRAFEYMLATGNIISKTGLGMLQDSGLCVVADKLNFIRYLSHFRCVHRGAAFAKMRTTTVRKLLPESWGFLCPVHTPDGTPCGLMNHMTTHCEIVAPTSSTSTLPALLCSLGVTPVESTPSQPYSCCYPVVLDGAMIGWVEKDLAPSLVESLRRFKVLKEKRMPPWTEIVLVPQTGKASLYPG--LFLFTTPCRMMRPV-----RNLALGKQELIGTFEQLYLNVGIFE----------DEIEEGVT-------------------THQELFPHSMLSVVASFIPFSDHNQSPRNMYQCQMGKQTMGFPLHSYQDRSDNKLYRLQTPQSPLVRPVMYDHYNIDNYPIGTNAVVAVISYTGYDMEDAMIVNKSSWERGFAHGSVYK-----------TEVIDLSEKAKGEDSVVFGTKPGDPKVGTKLDVDGLPAIGTVLNYGD---------PYYSYVNLNTGQSHVS------FYKSQETCVVDNIKVCSNDTGTGRFKRVCITMRIPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMTPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFTFSEENSALEHFGDMLKAAGYNYYGTERLYSGLSGMELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPVGGRNVQGGIRFGEMERDALLAHGSSFLLHDRLFNCSDRSVAQVCMDCGSLLSPLLEKPPPHWSTTRHRNTICMLCKKSDSIENVSVPYVFRYFVAELAAMNIKIKLDV 1132          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008572.1 (pep scaffold:Pmarinus_7.0:GL476831:175452:211422:1 gene:ENSPMAG00000007718.1 transcript:ENSPMAT00000008572.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1523.45 bits (3943), Expect = 0.000e+0
Identity = 746/1173 (63.60%), Postives = 918/1173 (78.26%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQK------NMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETL-GMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEV--SKIRLPYAAKLLSQELQSMHITMRLFV 3545
            +DEEIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +E+Q E Q+ SG  +TP +    F QIYLSK THWE DG  +PMMPN+ARLRNLTY AP++VD+T+             +   T ++T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYF+INGSEKV+IAQE+MA N+V+VF  K+ ++++    +S +E S R  S + V +LA+ G G  K  +G +IV T+P+++QE+PI+++FR +GFVSDRDI+EH IYD DD +M EM  LKPS+DEAFVIQ++  ALN+IGSRG KPG+   +RIK+A+D++ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF G FK L KE++    K ID+ ++    LA+K+ +ITDGLKYSLATGNWGDQKKA + R GVSQVLNRLT+ASTLSHLRRLNSP  R  K+ KPRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+PSAIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS+VRD   +EI+I+TD+GRICRPL+IV   +  +K+ HI++LKE+ +  Y WQELV+ GVVEYIDTLEEE++MIAM P D+  +   YC T+THCE+HP+MILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+N+H RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDS+I+N SA+ERG FRS FYR+  + ES+  S +  E  EKP +E    GMR   Y KLD DG+VSPGVRVSG DV++GKT +LP TDD +++V  ++F KRD S F+R +E GIVD+VM+T N +G KF KIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EG++PDIIINPHAIPSRMT+GH+IEC+QGKVSAN+GEIGDATPFND VNV+K+S +L +YGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS+   L    +E       G +   ++   +V  S  + V R       A  +      L    S  V  S +RLPYA KLL QEL SM I  R+ V
Sbjct:   10 EDEEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPPIELQAEAQHASGQIETPPRYSVRFEQIYLSKPTHWERDGAPAPMMPNEARLRNLTYSAPLYVDITKSVTTAGGGEEQQQQRLQTHEKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFVINGSEKVLIAQEKMATNSVYVFAKKESRFAFSAECRSCLENSSRPVSTIWV-MLARGGQGVRKSTIGQRIVGTLPYIRQEVPIMVVFRGLGFVSDRDILEHIIYDFDDPEMMEMQKLKPSLDEAFVIQEQSVALNFIGSRGAKPGVTKEKRIKYARDILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFLGLFKTLGKEVRIYAQKFIDRGKDFNLELAIKTRIITDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTYASTLSHLRRLNSPCDRGSKLAKPRQLHNTLWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPSAIADATKIFVNGCWVGIHKDPEQLMTTLRKLRRQMDIIVSEVSMVRDIREREIRIHTDAGRICRPLLIVEKQRLLLKRRHIEQLKEREYNGYSWQELVASGVVEYIDTLEEESAMIAMSPDDLQERGVAYCCTYTHCEVHPAMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNYHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSIIMNRSAVERGYFRSVFYRSYTDQESK-RSYDQEEVFEKPTRETCQEGMRHAIYDKLDDDGLVSPGVRVSGDDVIIGKTASLPVTDDELDSVA-TRFVKRDTSTFLRSSETGIVDQVMVTLNQDGYKFTKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGLSPDIIINPHAIPSRMTIGHMIECIQGKVSANKGEIGDATPFNDTVNVQKVSNLLQEYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPVQILVRQPMEGRSRCVPLGATSIELAPVPTAGPSTLRRDIAQNVIPSN-VSVTRQSSPRARAR-RVSPLIPLPPRGSPHVQMSLVRLPYACKLLFQELLSMSIAPRMMV 1177          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001310.1 (pep scaffold:Pmarinus_7.0:GL477974:3852:23589:-1 gene:ENSPMAG00000001164.1 transcript:ENSPMAT00000001310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1343.56 bits (3476), Expect = 0.000e+0
Identity = 621/876 (70.89%), Postives = 736/876 (84.02%), Query Frame = 3
Query:  924 LKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSK-FKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            +KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+++ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ ++TDGLKYSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS+VRD   +EI+IYTD+GRICRPL+IV   K  +KK HI +LK++ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  E+P ++   GMR   Y KLD DG++SPG+RVSG DV++GKTVTLP  +D +E  G +K F KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EG++PDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFND VNV+KIS +L +YGY   GNE++YNG+TGRKMT+ +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFL+ERL +VSD Y ++VC +CG M  AN +  T++C  C   T++S +R+PYA KLL QEL SM I  R+ +
Sbjct:    2 VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEILQKEVLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRREVDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRMYAQKFIDRGKDFNLELAIKTRIVTDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMVRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKDREYNNYTWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESK-KGFDMEEVFERPTRDTCQGMRHAIYEKLDDDGLISPGIRVSGDDVIIGKTVTLPDNEDELE--GQTKRFTKRDCSTFLRTSETGIVDQVMVTINQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGLSPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDTVNVQKISNLLHEYGYHLRGNEVLYNGFTGRKMTSQIFMGPTYYQRLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEVSDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLVRVPYACKLLFQELMSMSIAPRMMI 874          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009064.1 (pep scaffold:Pmarinus_7.0:GL481227:16752:24008:-1 gene:ENSPMAG00000008197.1 transcript:ENSPMAT00000009064.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 427.943 bits (1099), Expect = 2.445e-138
Identity = 215/483 (44.51%), Postives = 300/483 (62.11%), Query Frame = 3
Query: 2091 KTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            +  TH EI P  +LGVCA ++P+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  TR +E ++F +LPAG NA +A+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LD+DGI SPG RV    VL+ K++              ++ + +D  +  + +    V+KVM+++NNE +   K+ +R T+ P+IGDKF+SRHGQKG CG+   QED+PF   GI PDII+NPH  PSRMTVG L+E L GK     G     T F  +  VR +   L  +GY   G + + +G TG  +   ++ GP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SDS+ + VC  CG M  +      + C  C  S +VS +R+PYA KLL QELQSM+I  RL
Sbjct:    1 RNTTHLEIEPFTLLGVCAGLVPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVQTRTIELIQFDKLPAGQNATLAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLKRYTNQTF-DRVMGPMLDAATRKPIWRHKVLDSDGICSPGERVENKQVLVNKSMPSMTQTPIQGASAPTQVQYKDVPITYKGSTDSYVEKVMISSNNEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIASQEDVPFCDSGICPDIIMNPHGFPSRMTVGKLMELLAGKAGVLDGRFHYGTAFGGS-RVRDVCEDLIRHGYNYQGKDFVTSGITGEPLEAYIYIGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDSFQVDVCGTCGLMAYSG-----WWCHYCRSSRQVSSLRIPYACKLLFQELQSMNIIPRL 476          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002293.1 (pep scaffold:Pmarinus_7.0:GL487410:805:8051:1 gene:ENSPMAG00000002089.1 transcript:ENSPMAT00000002293.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 7.655e-32
Identity = 66/198 (33.33%), Postives = 112/198 (56.57%), Query Frame = 3
Query:   69 RMDDEEITSEFWQ-ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDV--TQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFV 653
            ++  E++T+     E  W ++ +F + KGLV+Q +DSF+ F+   I++I+    K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  T+ N R         +   IG++PIMLRS+ C+L+  +  ++A+LNECPLDPGGYF++ G EKV + QE+++ N + V
Sbjct:   10 KLTSEQLTAPIRTIEDKWKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMMANEKITSDADPMW----------YLKYLNIYVGTPDVEESFNVTRPVAPHECRLRDMTYSAPITVDIEYTRGNQRI------IRNALPIGRMPIMLRSSNCVLTGKTPAEMAKLNECPLDPGGYFVVRGVEKVCLIQEQLSKNRIIV 191          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Yeast
Match: RPB2 (RNA polymerase II second largest subunit B150; part of central core; similar to bacterial beta subunit [Source:SGD;Acc:S000005677])

HSP 1 Score: 1309.28 bits (3387), Expect = 0.000e+0
Identity = 651/1210 (53.80%), Postives = 847/1210 (70.00%), Query Frame = 3
Query:   81 EEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDT-PNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDD---------------EITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVF--PAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDG------KFAIKKEHIKRLKEKAHA----------RYGWQELVSDGVVEYIDTLEEETSMIAMVPADI------------------TKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKF-KKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQM-VTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            E+ ++    E SW VIS+FF EKGLV QQLDSF++F+  ++Q I+ E   L ++   Q+ +  D    K E SFG+IY++K    ESDG    + P +ARLRNLTY + +FVDV ++   + D               E    + +  IG++PIMLRS  C LSE ++ DL +L ECP D GGYFIINGSEKV+IAQER A N V VF   A    S+   ++S +E   R  S L V L  + GS  R     I  T+P++KQ+IPI+I+FRA+G + D +I+EH  YD +D  M EMLKP +++ FVIQD   AL++IG RG   GI   +RI++AKD++ KE LPHI   E   +RKA+FLGYM++RLL  AL R++ DDRDH G KRLDLAGPLLA LFK  FK L K++     + +++  +    LA+ +  IT GLKY+LATGNWG+QKKA  +R GVSQVLNR T++STLSHLRR N+P GRDGK+ KPRQLHNT WG+VCPAETPEG A GLVKNL+LM+ ISVG+   PII FL EW ME LE+  P    +AT++F+NG W G+HR+P +LM TL+ LRR  D +  EVS++RD   KE+KI+TD+GR+ RPL IV D       +  ++K HI +L    +            Y W  L+++G+VEYID  EEE+ +IAM P D+                   + S +  T THCEIHPSMILGV ASIIPFPDHNQSPRNTYQSAMGKQAMGV+++N++ RMDT+A++LYY QKPL TTRAMEYL+FRELPAG NA+VAIA Y+GYNQEDS+I+N+S+I+RG+FRS F+R+  + E +   +   E  EKP +  TL M+   Y KLD DG+++PGVRVSG DV++GKT   P + D  E    + +  KRD S  +R TE GIVD+V++TTN +G KF K+R+RTTKIPQIGDKFASRHGQKGT GI YR+EDMPFT+EGI PD+IINPHAIPSRMTV HLIECL  KV+A  G  GDA+PF D + V  IS++L ++GY++ G E+MYNG+TG+K+   +FFGPTYYQRL+HMVDDKIH+RARGP+ ++TRQP+EGRS++GGLRFGEMERDC IAHGAA FLKERL++ SD++ +++C ICG M V A + +  F+C  C+   ++ +I +PYAAKLL QEL +M+IT RL+ D
Sbjct:   19 EDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSART----IKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGD-INPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMS-ITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTT--PISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTD-ITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQELMAMNITPRLYTD 1219          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Yeast
Match: RET1 (Second-largest subunit of RNA polymerase III; RNA polymerase III is responsible for the transcription of tRNA and 5S RNA genes, and other low molecular weight RNAs [Source:SGD;Acc:S000005733])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 437/1193 (36.63%), Postives = 681/1193 (57.08%), Query Frame = 3
Query:   48 YNLLFKTRMDDEEITSEF-WQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASN---LGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEA--FVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTT----------EFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELK---NNTLKIIDKTRELKAGLALK--SNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSE-VSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEE-------YVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            ++ L K     +++T E    +  W ++ +F + KGLV+Q LDSF+ F+ T +++I        I+      S  D     +Y    I + K +   +    +P  P++ RLR++TY AP++VD+     R+     D      IG++PIMLRS  C+L +  +  +A+LNECPLDPGGYFI+NG+EKVI+ QE+++ N + V  A +K       K +V+ S  S+++       ++ K+G        KI      + +EIPI I+ +A G +SD +I++  +   +D+   ++   +++E+    I  +  AL YIG++         + ++  K  I +E +  I TT          +FR   KA ++  M  R++      +  DDRD++G+KRL+LAG L++ LF+  FK    + K   +  LK  ++  E  A L++   SN IT GL  +++TGNW  ++   E R GV+ VL+RL++ S L  + R++S   +  K+  PR L  +Q+GM+C A+TPEG A GLVKNLALM +I+   + +PI +      +E +  I  +++     +++NG+ +G  R P + +   + LRR+  V  SE +SI  +     + I TD GRICRPLIIV+DG+  +K  H+++L +       + + +  G+VEY+D  EE  S IA+   DI        + TH EI P  ILG  A +IP+P HNQSPRNTYQ AMGKQA+G    N   R+DTL +++ Y Q+P+  T+ +E + + +LPAG NA VA+ SY+GY+ ED+++LN+S+I+RG  R E         +R  +T  ++      ++   GMR +E       +  L  DG+   G++V  G + + K+V   + D       N + + R+  +  R  E   +D+VM++ ++      K+ +R  + P++GDKF+SRHGQKG CGI  +QEDMPF  +GI PDII+NPH  PSRMTVG +IE + GK     G +   T F  +  +  +S++L D G+  +G +++Y+G TG  +   +FFGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC IA+GA+Q L ERL+  SD++ + VC  CG M        +  C +C  +  + K+ +PYAAKLL QEL SM+I  RL
Sbjct:   21 FDDLLKPVYKGKKLTDEINTAQDKWHLLPAFLKVKGLVKQHLDSFNYFVDTDLKKI--------IKANQLILSDVDPEFYLKYV--DIRVGKKSSSSTKDYLTP--PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVE----IGRMPIMLRSNKCILYDADESKMAKLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIV-EADEK-------KGIVQASVTSSTHERKSKTYVITKNG--------KIYLKHNSIAEEIPIAIVLKACGILSDLEIMQ--LVCGNDSSYQDIFAVNLEESSKLDIYTQQQALEYIGAK--------VKTMRRQKLTILQEGIEAIATTVIAHLTVEALDFR--EKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSIDKVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKME-RAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEEEPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGTLIGSIRFPTKFVTQFRHLRRTGKV--SEFISIYSNSHQMAVHIATDGGRICRPLIIVSDGQSRVKDIHLRKLLD---GELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVP------SMTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCE---------TRRKTTTVLKRYANHTQDIIGGMRVDENGDPIWQHQSLGPDGLGEVGMKVQSGQIYINKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCFGGS-KLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCGLM------GYSGWCTTCKSAENIIKMTIPYAAKLLFQELLSMNIAPRL 1141          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Yeast
Match: RPA135 (RNA polymerase I second largest subunit A135 [Source:SGD;Acc:S000006214])

HSP 1 Score: 407.142 bits (1045), Expect = 9.324e-123
Identity = 328/1094 (29.98%), Postives = 507/1094 (46.34%), Query Frame = 3
Query:  279 NKCEYSFGQIYLSKATHWESDGTGSPM----MPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVI--IAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQE--IPIIILFRAMGFVSDRDI----IEHTIYDPDDTDMHEMLKPSIDEAFV-IQDEHHALNYIGS--RGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKG----FFKNLAKELK---NNTLKIIDKTRELKAGLALKSNV-ITDGLKYSLATGNWGDQKKAS-ETRKGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK-----IFINGSWVGI--HRDPDQLMATLKKLR-------RSMDVVVSEV--SIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRT--VNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKF-----CKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATP--FN-DAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVT 3407
            NK   S  Q+ ++K     +DG  S +     P+++R R  +Y   + + +       ++ + +  D    G +P+ML+S  C L++MS  +L Q  E   + GGYFI+NG EK+I  +  +R  +    + P+        +   +   S R       N+L     G+      +     + K E  +P++++ +A+   SDR+I    I + + D   TD  E+L     + +  +Q+    L Y+G   R V    P    ++  ++V+ +  L H+G     S  K   L +M+ +L S      +PD+ D   H+ + L G L   + K     + +N+  +++   N  + I  K +   + + ++ N  I   ++Y L+TGN   Q     +   G + V  ++ F   +SH R ++  S     K    R+L    WG +CP  TP+G   GL+ + A    IS        I  +    + SL  +AP++   A       + I+G  +G   H     +  TL+  +         +D+ +  V  S    Y G  + ++    R+ RP+  +      + KE I                        +   E+    IA+ P +I  N      HTH E  P+ IL + A++ PF D NQSPRN YQ  MGKQ MG        R D   + L   Q P+      +       P G NAVVA+ SYTGY+ +D++I+N+SA ERG      Y+T  V+ + +RN      ++    N E      +E   KLD DG+   G  V  GD         P    F +T+  +K K    S      E   +++V L   +E +KF       I+ R  + PQIGDKF+SRHGQKG C  ++   DMPF+  GI PDIIINPHA PSRMT+G  +E L GK  A  G   D+TP  FN D          L+  GY  +GNE MY+G TG ++   ++ G  YYQRL+HMV+DK   R+ GPV  +T QP++GR + GG+R GEMERD  I HG +  L++RLL+ SD     VCR CG ++T
Sbjct:   93 NKLSVSVEQVSIAKPM--SNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRD---CGGLPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVRPDQTSQTNVLHYLNDGQ------VTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDG--SQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSRIPSI----LYSLG-VAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPG--LYLFGGHSRMLRPVRYL-----PLDKEDI------------------------VGPFEQVYMNIAVTPQEIQNN-----VHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDE----WPKEWLEKLDEDGLPYIGTYVEEGD---------PICAYFDDTLNKTKIKTYHSS------EPAYIEEVNLI-GDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILT 1112          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Match: EDO36897 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SHD8])

HSP 1 Score: 1686 bits (4365), Expect = 0.000e+0
Identity = 781/1161 (67.27%), Postives = 957/1161 (82.43%), Query Frame = 3
Query:   81 EEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQY-GSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTT-DRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKR--VVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQ-YCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            E+IT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P++++Q E+Q+  S  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP +VD+T+  ++ ++E   TT  +  IGKIPIMLRSTYCLL+ + D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KYSY   ++S +E+S R  S + V++LAK  SG R   +G +IV ++P++KQEIPI+I+FRA+GFV+DRDI+EH IYD +D +M EM+KPS+DEAFVIQ+++ ALN+IGSRG +PG+   +RIK+AK+++ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G F+NL KE++    K ID+ ++    LALK  VITDGL+YSLATGNWGDQKKA + R GVSQVLNRLTFASTLSHLRRLNSP GR+GK+ KPRQLHNT WGM+CPAETPEGHAVGLVKNLALMAYISVGS+  PI+EF+EEW+ME+LEEI PSAI  +TKIF+NG WVGIHRDPDQLM+TL+KLRR MD++VSEVS+VRD+  +EI+IY+D+GRICRPL+IV + K  +KK HI +LKE+ +  Y WQELV++G+VEYID  EEET M+AM P ++ +  Q YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+N+H RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGINA+VAIASYTGYNQEDSVI+N SAI+RG++RS FYR+  + ES+    +  E  EKP ++   GMR   Y KLD DG+++PG+RVSG DV++GKTVTLP  DD +E     K+ K+D S F+R +E GIVD+VM+T N EG KF KI++R+ ++PQIGDKFASRHGQKGTCGI YRQEDMPFT EG++PD+IINPHAIPSRMT+GHLIECLQGKVSAN+GEIGDATPFNDAVNV+KIS++L+DYGY   GNE++Y+G+TGRK+ T VF GPTYYQRLKHMVDDKIHSRARGP+ ++TRQP+EGRS++GGLRFGEMERDC IAHG+AQFL ERL +VSD Y  +VC +CG +  AN++N TF+C  C   T+VS+IR+PYAAKLL QEL SM I  R+ V
Sbjct:   19 EDITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPEIDLQAESQHMTSDTEIPARFVLKFEQIYLSKPTHWEKDGAPSPMMPNEARLRNLTYSAPFYVDITKTRIKDNEEPQVTTHSKMFIGKIPIMLRSTYCLLNGLLDRDLTELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFSKKDSKYSYTAEIRSCLEHSSRPTSTMWVSMLAKGSSGGRRSAIGQRIVGSLPYIKQEIPIMIVFRALGFVADRDILEHIIYDFEDQEMMEMVKPSLDEAFVIQEQNVALNFIGSRGARPGVTKERRIKYAKEILQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGLFRNLMKEVRMYAQKFIDRGKDFNIELALKPKVITDGLRYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGREGKLAKPRQLHNTHWGMICPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFMEEWTMENLEEITPSAINTSTKIFVNGCWVGIHRDPDQLMSTLRKLRRRMDIIVSEVSMVRDFREREIRIYSDAGRICRPLLIVENQKLLLKKNHIDQLKEREYNEYSWQELVANGIVEYIDVNEEETVMVAMTPDELVEKGQAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNYHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINAIVAIASYTGYNQEDSVIMNASAIDRGLYRSVFYRSYRDQESKKGLDQ-EETFEKPTRDAVQGMRNASYDKLDEDGLIAPGIRVSGDDVIVGKTVTLPDNDDELEGTAR-KYSKKDASTFLRPSETGIVDQVMVTINQEGFKFTKIKVRSVRVPQIGDKFASRHGQKGTCGITYRQEDMPFTCEGLSPDVIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISQLLNDYGYHLRGNEVLYSGFTGRKLNTQVFLGPTYYQRLKHMVDDKIHSRARGPLQILTRQPMEGRSRDGGLRFGEMERDCMIAHGSAQFLNERLFEVSDPYSCHVCNLCGLIAIANLRNNTFECRGCKNKTQVSRIRMPYAAKLLFQELMSMSIAPRMMV 1177          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Match: EDO33368 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SSE2])

HSP 1 Score: 266.159 bits (679), Expect = 2.067e-74
Identity = 255/966 (26.40%), Postives = 415/966 (42.96%), Query Frame = 3
Query:  375 RLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD------KYSYKCNVKSMVEYSFR--------SASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQ--EIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHE-----MLKPSIDEAFVIQDEHHALNYIGSR-GVKPGIP-VAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKK-ASETRKGVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLAL-MAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVG-IHRDPDQLMATLKKLRRSMDVVVSE-------------VSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERG-----IFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFN---DAVNVRKISRVLSDYGYEANGNEIMYNGYTG 3128
            R +  TYC+ + V +  K     D +   +    I  IP+M++S  C L+ +S  +L + NE   + GGYFI+NG EK+I    RM      + P ++      + S+K       EY  +        SA N+ ++ L          G  ++C + + K+   +P++ + +A+  V+D+ I    I   ++    +     ML+ + +E  V  ++   L YIG R  VK  +P        A+ +I +    H+ T    +  K   L  M  +L + AL++   +  D   ++ + L G L   + K                                      ++Y LATGN   +   A +   G + V +RL +   LSH R ++  +     +    R+L    WG +CP  TP+G   GL+ +LA     ++V      ++  L    M  ++   P    N   + ++G  +G + RD   L  TL    R M V+  E               +   Y G  + I++   R+ RP++       A+ K                        +E I + E+    IA+V  ++ +        TH E+ P+ +L   AS+ P+ D NQSPRN YQ  MGKQ MG  +  F  R D   + +   Q PL    + ++    E P G NA+VA+ SYTGY+ ED+++LN+++ ERG     I++++F     +S+ R +S+  ++    P+     G       +LDADG    G  +S GD              +I+T       K+  +L     E GI+D                     + P IGDKF+SRHGQKG C  ++  E+MPF+  G+TPDII NPH  PSRMT+G +IE + GK +A  G + DATPF    D   +    ++L  +    NG  +   G+ G
Sbjct:   60 REKGSTYCSKLQVTLQWK----IDNVPQGSVTKVIAAIPLMVKSNNCSLANLSPKELVRKNEESQEAGGYFIVNGIEKII----RM-----LILPRRNYPLAIIRPSWKGRGSFYTEYGVQMRSVKGDQSAVNMTLHYLND--------GNVMMC-IAYRKELYYVPVVFILKALMNVTDQHIYRELIKAEENNTFWKDCVAMMLRTAQEEGAV--NQKSVLEYIGLRFRVKMRLPDWFSDEAVAQYLIQQCICIHLDT----NADKFNLLILMTRKLYALALEKCCAESADSPMNQEVLLGGHLYLMVLK--------------------------------------MEYFLATGNLISKSGLALQQISGFTVVADRLNYFRFLSHFRCIHRGAFFSQMRTTSVRKLLPEAWGFLCPVHTPDGAPCGLLNHLAAGCQVVNVVPLVAHMLRLLCTMGMIPVDAPVPGDYKNYYPVVMDGRVLGSVDRD---LAPTLANRLRIMKVLGEERVPQFLEICLVPITKVASQYPG--LFIFSSPARMMRPVL-----NLAVNK------------------------IEMIGSFEQVYMDIAIVQEELHEG-----VTTHMELKPTAMLSAIASMTPYSDFNQSPRNMYQCQMGKQTMGTPVHAFQHRTDNKLYRIQTPQSPLVRPASHDFYIMDEYPLGTNAIVAVISYTGYDMEDAMVLNKASYERGFAHGSIYKAQFVNLEPKSQDRTSSSN-LQFGTLPDDPRIDG-------RLDADGFPPLGAHLSTGDPYY----------SYIDTNTGEAVVKKYSNL-----EAGIIDD--------------------RNPIIGDKFSSRHGQKGICSQKWPVENMPFSESGMTPDIIFNPHGFPSRMTIGMMIESMAGKSAALNGHVYDATPFTFSEDDSAIDYFGKLLVKWVEGINGLVLEVQGFRG 877          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Match: EDO30235 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7T1C9])

HSP 1 Score: 170.629 bits (431), Expect = 1.502e-48
Identity = 82/174 (47.13%), Postives = 112/174 (64.37%), Query Frame = 3
Query: 2772 SKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFN---DAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRF 3284
            SK C I++R  + P IGDKF+SRHGQKG C  ++  ++MPF+  G TPDII NPH  PSRMT+G +IE + GK +A  G + DATPF    D   +    ++L   GY+  G E +Y+G  GR+    +F G  YYQRL+HMV DK   R  GP+  +T QP++GR ++GG+RF
Sbjct:   14 SKAC-IKLRIQRNPIIGDKFSSRHGQKGICSQKWPVKNMPFSESG-TPDIIFNPHGFPSRMTIGMMIESMAGKSAALNGHVYDATPFTFSEDDSAIDYFGKLLVKSGYDYFGTERLYSGIDGREFEADIFMGVVYYQRLRHMVADKFQVRTTGPIDALTHQPVQGRKRQGGIRF 185          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Match: EDO30236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS3])

HSP 1 Score: 88.5817 bits (218), Expect = 2.035e-21
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3141 TTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERL 3347
            + +F G  YYQRL+HMV DK   R  GP+  +T QP++GR ++GG+RFGEMERD  +AHG +  L++RL
Sbjct:    1 SDIFMGVVYYQRLRHMVADKFQVRTTGPIDALTHQPVQGRKRQGGIRFGEMERDALLAHGTSFLLQDRL 69          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Match: EDO44798 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS3])

HSP 1 Score: 88.5817 bits (218), Expect = 2.035e-21
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 3141 TTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERL 3347
            + +F G  YYQRL+HMV DK   R  GP+  +T QP++GR ++GG+RFGEMERD  +AHG +  L++RL
Sbjct:    1 SDIFMGVVYYQRLRHMVADKFQVRTTGPIDALTHQPVQGRKRQGGIRFGEMERDALLAHGTSFLLQDRL 69          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Match: polr2b (RNA polymerase II subunit B [Source:NCBI gene;Acc:101166780])

HSP 1 Score: 1705.65 bits (4416), Expect = 0.000e+0
Identity = 795/1162 (68.42%), Postives = 958/1162 (82.44%), Query Frame = 3
Query:   75 DDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSG-CDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMR-SDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKD-KYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSG--KRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADIT-KNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLF 3542
            DD+EIT + WQE+ W VISS+F+EKGLVRQQLDSFDEF+  S+QRIVE+ P +++Q E Q+ SG  + P +    F QIYLSK THWE DG  SPMMPN+ARLRNLTY AP++VD+T+  ++  +D++     +T IGKIPIMLRSTYCLLS ++D DL +LNECPLDPGGYFIINGSEKV+IAQE+MA NTV+VF  KD KY+Y    +S +E S R  S + V+++A+ G G  K  +G +IV T+P+++QE+PIII+FRA+GFVSDRDI+EH IYD DD +M EM+KPS+DEAFVIQ+++ ALN+IGSRG KPG+   +RIK+AK+V+ KE LPH+G ++F  T+KAYFLGYMVHRLL  AL RR  DDRDH G+KRLDLAGPLLAFLF+G FKNL KE++    K ID+ ++    LA+K+ +I+DGLKYSLATGNWGD KKA + R GVSQVLNRLTFASTLSHLRR+NSP GRDGK+ KPRQLHNT WGMVCPAETPEGHAVGLVKNLALMAYISVGS+  PI+EFLEEWSME+LEEI+P+AIA+ATKIF+NG WVGIH+DP+QLM TL+KLRR MD++VSEVS++RD   +EI+IYTD+GRICRPL+IV   K  +K+ HI +LKE+ +  Y WQ+LV+ GVVEYIDTLEEET M+AM P D+  K   YC T+THCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYI+NFH RMDTLAHVLYY QKPL TTR+MEYLRFRELPAGIN++VAIASYTGYNQEDSVI+N SA++RG FRS FYR+  E ES+    +  E  EKP +E   GMR   Y KLD DG+++PGVRVSG DV++GKTVTLP  DD +++  N ++ KRDCS F+R +E GIVD+VM+T N EG KFCKIR+R+ +IPQIGDKFASRHGQKGTCGI+YRQEDMPFT EGITPDIIINPHAIPSRMTVGHLIECLQGKVSAN+GEIGDATPFNDAVNV+K+S +LS+YGY   GNE++YNG+TGRK+T+ +F GPTYYQRLKHMVDDKIHSRARGPV ++ RQP+EGRS++GGLRFGEMERDCQIAHGAAQFLKERL + SD Y ++VC +CG M  AN +  T++C  C   T++S IR+PYA KLL QEL SM I  R+ 
Sbjct:   13 DDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHTSGEVEEPPRFLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTIIKEGEDQLQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTAECRSCLENSSRPTSTIWVSMMARGGQGVKKSAIGQRIVSTLPYIRQEVPIIIVFRALGFVSDRDILEHIIYDFDDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKERRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEIRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDVKKAHQARAGVSQVLNRLTFASTLSHLRRVNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKRRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKGVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQ-EEIFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGEDVIIGKTVTLPENDDELDST-NKRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANKGEIGDATPFNDAVNVQKVSNLLSEYGYHLRGNEVLYNGFTGRKLTSQIFIGPTYYQRLKHMVDDKIHSRARGPVQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLKERLFEASDPYQVHVCNLCGLMAIANTRTHTYECRGCRNKTQISLIRMPYACKLLFQELMSMSIAPRMM 1172          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Match: polr3b (RNA polymerase III subunit B [Source:NCBI gene;Acc:101174911])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 426/1152 (36.98%), Postives = 661/1152 (57.38%), Query Frame = 3
Query:  117 WTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK--IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            W ++ +F + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+   K  V + V  S     +   N++ K G        +       L ++ PI I+F+ MG  SD++I++        T+ H M    PS++E    Q   +  AL ++G++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL++ S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  +   +F+NG+ +G+ R+  +L++T + +RR+   +   VSI  + + + + I +D GR+CRP IIV  G+  +K +HI+ L   +     +++ + +G+VEY+D  EE    IA+    I K +      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI  PG +V    +L+ K++          +    + + ++  +  + +    ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   G+ PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +++PYA KLL QELQSM+I  RL
Sbjct:   27 WKLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMKANEKITSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--DQDR---KGTVGASVTSSTHEKKSR-TNIIVKQG--------RFYLRHNTLSEDAPIAIIFKGMGVESDQEIVQMI-----GTEEHVMANFAPSLEECQKAQIFTQTQALRFLGNKVRRQRMWGGPKKTKMEEARELLASLILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGENKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLALNLGVEDVNLLCGEELSYPSVFLVFLNGNILGVIRNHHKLVSTFRLMRRA-GFINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKKGQPMVKSKHIEDL---SQGYRNFEDFLHEGLVEYLDVNEENDCQIALYEHMINKET------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNTKCTLRRYTNQTF-DKVMGPMLDAATRKPLWRHNILDADGICCPGEKVENKQILVNKSMPTVTQTPLEGSAQPGQPQYKEVPISYKGSTDSYIEKVMISSNAEDAFLIKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGVCPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLKIPYACKLLFQELQSMNIIPRL 1125          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Match: polr3b (RNA polymerase III subunit B [Source:NCBI gene;Acc:101174911])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 424/1145 (37.03%), Postives = 656/1145 (57.29%), Query Frame = 3
Query:  138 FEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEM--LKPSIDEAFVIQ--DEHHALNYIGSRGVKP---GIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLA--LKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIA--NATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
             + KGLV+Q +DSF+ F+   I++I++   K+    +  +             +  IY+      ES     P+ P++ RLR++TY AP+ VD+  +  R    I    +   IG++PIMLRS+ C+L+  + ++ ++LNECPLDPGGYFI+ G EKVI+ QE+++ N + V   +D+   K  V + V  S     +   N++ K G        +       L ++ PI I+F+ MG  SD++I++        T+ H M    PS++E    Q   +  AL ++G++  +    G P   +++ A++++    L H+   EF    K  +L  MV R++  A      DDRD+ G+KRL+LAG LL+ LF+  FK    ELK    +II K R  +  +   ++ + IT+G+  +++TGNW   K+    R+GV+QVL+RL++ S L  + R++S   +  K+  PR L  +QWGM+CP++TPEG A GLVKNLALM +I+   +  PII+      +E +  +    ++  +   +F+NG+ +G+ R+  +L++T + +RR+   +   VSI  + + + + I +D GR+CRP IIV  G+  +K +HI+ L   +     +++ + +G+VEY+D  EE    IA+    I K +      TH EI P  +LGVCA +IP+P HNQSPRNTYQ AMGKQAMG    N   R+DTL ++L Y Q+P+  T+ +E + F +LPAG NA VA+ SY+GY+ ED+++LN+++++RG  R   Y+    +  R  +  F + +  P  +         +  LDADGI  PG +V    +L+ K++          +    + + ++  +  + +    ++KVM+++N E +   KI +R T+ P+IGDKF+SRHGQKG CG+   QEDMPF   G+ PDII+NPH  PSRMTVG LIE L GK     G     T F  +  V+ +   L  YGY   G + + +G TG  +   ++FGP YYQ+LKHMV DK+H+RARGP  ++TRQP EGRS++GGLR GEMERDC I +GA+  L ERL+  SD++ + VC  CG +  +        C  C  S  VS +++PYA KLL QELQSM+I  RL
Sbjct:   40 LQVKGLVKQHIDSFNYFINVEIKKIMKANEKITSDADPMW----------YLKYLNIYVGMPDVEESFNVTRPVSPHECRLRDMTYSAPITVDI--EYTRGSQRII--RNALPIGRMPIMLRSSNCVLTGKTPMEFSKLNECPLDPGGYFIVKGQEKVILIQEQLSKNRIIV--DQDR---KGTVGASVTSSTHEKKSR-TNIIVKQG--------RFYLRHNTLSEDAPIAIIFKGMGVESDQEIVQMI-----GTEEHVMANFAPSLEECQKAQIFTQTQALRFLGNKVRRQRMWGGPKKTKMEEARELLASLILTHVPVKEFNFRAKCIYLAVMVRRVI-LAQGENKVDDRDYYGNKRLELAGQLLSLLFEDLFKKFNSELKKIADQIIPKQRAAQFDVVKHMRQDQITNGMVNAISTGNW-SLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGEACGLVKNLALMTHITTDMEDGPIIKLALNLGVEDVNLLCGEELSYPSVFLVFLNGNILGVIRNHHKLVSTFRLMRRA-GFINEFVSISTNLTDRCVYISSDGGRLCRPYIIVKKGQPMVKSKHIEDL---SQGYRNFEDFLHEGLVEYLDVNEENDCQIALYEHMINKET------THLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQRPMVKTKTIELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNTKCTLRRYTNQTF-DKVMGPMLDAATRKPLWRHNILDADGICCPGEKVENKQILVNKSMPTVTQTPLEGSAQPGQPQYKEVPISYKGSTDSYIEKVMISSNAEDAFLIKILLRQTRRPEIGDKFSSRHGQKGVCGLIVPQEDMPFCDSGVCPDIIMNPHGYPSRMTVGKLIELLAGKAGVLDGRFHYGTAFGGS-KVKDVCEDLIRYGYNYQGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVCGQCGLLGYSGW------CHYCKSSCHVSSLKIPYACKLLFQELQSMNIIPRL 1131          
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Match: polr1b (RNA polymerase I subunit B [Source:NCBI gene;Acc:101159846])

HSP 1 Score: 400.593 bits (1028), Expect = 4.104e-120
Identity = 335/1196 (28.01%), Postives = 541/1196 (45.23%), Query Frame = 3
Query:  153 LVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSF--GQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFP-AKDKYSYKCNVKSMVEYSF--------RSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQE----IPIIILFRAMGFVSDRDIIEHTIYDPDDTDMH-----EMLKPSIDEAFVIQDEHHALNYIGSR-GVKPGIPVAQRIKFAKDVITKETLP-HIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFK----GFFKNLAKELKNNTLKIIDK---TRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRK-GVSQVLNRLTFASTLSHLRRLNSPSG-RDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNL-ALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGS---WVGIHRDPDQL--MATLKKLRRSMDVVVSEVSIVRDYSGKE-----IKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETL--GMREEEYV---KLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGS-KFCKIRI--RTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPF-----NDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVT----------ANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFV 3545
            L +  ++SFD+ +   + R V+  P LE   +          ++   SF    IY S A    S    + + P + R R  +Y   +  D++     + + +     +  +G++PIM++S  C L  MS  +L + +E   + GGYFI+NG EKV+    RM       +P A  +  +K   +   +Y           +A NL ++ L                 + F+ Q+    +P+    +A+   +D  I +  I   +D   +     EML+  ++E    + +   L Y+G R  VK  +P     +   +++  E +  H+ +     T K Y L  M  +L S A +    ++ D +  + +   G L     K     +  ++         K+  +   T  +   L + S+V T   +Y LATGN   +      +  G+  V ++L F   LSH R ++  +     +    R+L    WG +CP  TP+G   GL+ ++ A    ++  S +  +   L    +  ++     A ++   + ++GS   WV     P  +  M   K LR       +E+ +V   +GK      + ++T   R+ RP+        A+ K+                        E+I T E+  + + ++  +I          TH E+ P  +L V A+ IPF DHNQSPRN YQ  MGKQ MG  + +F  R D   + L   Q  L      ++      P+G NA+VA+ SYTGY+ ED++I+N+S+ ERG      Y+           TE V+  +K   E+ +  G +  +     KLDADG+   G  +  GD         P         G S      C  F +  E  +VD + + +N+ GS +F +I I  R  + P IGDKFASRHGQKG     +  EDMPFT  G+TPDI+ NPH  PSRMT+G LIE + GK +A  G   DATPF     N A++      +L   GY   G E +Y+G +GR++   +F G  YYQRL+HMV DK   R  G    +T QP+ GR+ +GG+RFGEMERD  +AHG++  L +RL + SD     +C  CG +++          + ++++   C  C KS  ++ + +PY  +    EL +M+I ++L V
Sbjct:   38 LTKAHIESFDQAVTDGLIRAVQAIPPLEFMSKN---------DQISLSFVEAAIY-SPAVAKGSICRETKVFPAECRGRRCSYKGKLVADISW----AINGVPKGIIKQSLGQVPIMVKSRLCNLHGMSPKELVKHHEEAEEMGGYFIVNGIEKVV----RMLIMPRRNYPIAMSRPKWKSRGQGYTQYGVSMRCVKDDHTAINLNLHYLENG-----------TVMLNFIYQKELFFLPLGFALKALVDFTDFQIYQELIKGREDNSFYKTCVSEMLRVVMEEGCTTRSK--VLTYLGERFRVKLNLPEWYTNEQCANILLNECICIHLKS----DTEKFYLLCLMSRKLFSHAKQECMEENPDSIMCQEVLTPGQLYLMFLKERMTAWLVSVKLSFDKRGSKVFARGWSTENVIKMLNMGSDV-TKPFEYLLATGNLNSKTGLGMLQNSGLCVVADKLNFIRYLSHFRCVHRGAAFAKMRTTSVRKLLPESWGFLCPVHTPDGEPCGLMNHMTASCEVVAASSPTTSLPALLCSLGVTPVDGTPAQAFSDCYPVVLDGSVVGWVETDLAPAVVDAMRRFKVLRERKVPPWTEIVLVPK-TGKASLYPGLFLFTTPCRMMRPV-----QNLALGKQ------------------------EFIGTFEQLYTNVGILEEEIEAG-----VTTHQELFPHSMLSVVANFIPFSDHNQSPRNMYQCQMGKQTMGFPLHSFMDRSDNKLYRLQTPQSALVRPYMYDHYNLDNYPSGTNAIVAVISYTGYDMEDAMIVNKSSWERGFAHGSIYK-----------TELVDLADKVRGEDAVVFGTKPGDPKVNDKLDADGLPRVGSVLQYGD---------PFYSYINLNTGQS------CVHFYKSQEACVVDNIKICSNDSGSGQFKRICITTRVPRNPTIGDKFASRHGQKGILSRLWPAEDMPFTESGMTPDILFNPHGFPSRMTIGMLIESMAGKSAALHGRSHDATPFTFSEENSALD--HFGELLRAGGYNYYGTERLYSGVSGRELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDKVTNQPVGGRNIQGGIRFGEMERDALLAHGSSFLLHDRLFNCSDRSEAQMCVDCGSLLSPLLEKPPPCWSAMRHRKTLCTLCGKSDSINAVSVPYVFRYFVAELAAMNIKVKLEV 1134          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000067331.1 (SMESG000067331.1)

HSP 1 Score: 2424.05 bits (6281), Expect = 0.000e+0
Identity = 1158/1159 (99.91%), Postives = 1159/1159 (100.00%), Query Frame = 3
Query:   72 MDDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            MDDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINA+VAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD
Sbjct:    1 MDDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAIVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 1159          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000055060.1 (SMESG000055060.1)

HSP 1 Score: 1700.64 bits (4403), Expect = 0.000e+0
Identity = 804/1158 (69.43%), Postives = 953/1158 (82.30%), Query Frame = 3
Query:   78 DEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHHALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGN-EIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRLFVD 3548
            ++EIT EFWQ+SSW+VISSFF+ KGLV QQLDS+DEF+ +S+Q+IV EF  +EI+GET+Y  G D PN+CEY FGQI L +  H+E  G  + + PN+ARLRNLTY + + +D      +S+ E    T++  IG+IP+ML+STYC+L  M+D+DL QLNECPLDPGGYFI+NGSEKVIIAQERMA NTVFVFP+KDKY YKC++KSMVE SFRS+S  GV+LLAK GSGKR  G KIVC +PF+K++IP++I+FRAMGFVS+RD+IE  IYD  D DM +ML+PSIDEAFVIQDE  ALN+IGSRGVK G P+ QRIKFAKD++TKETLPHIG TE    +KAYFLGYMVH+LL T+L +R PDDRDHMG+KR+DLAGPLLA LFKGFFKNLAKELK NT ++ID+  +  +  A++SN+ITDG KYSLATGNWGDQKKASETRKGVSQVLNRLTF S LSHLRR NSP+GRD KI KPRQLHNTQWGMVCPAETPEGHAVGLVKNL+LM  ISVGSKS PIIEFLEEW ME+L +I+PSA++  +KI +NGSW+GIHRDP+QL+ TLKKL+RS DV+VSEVSI +D++ KEIKI +D GR+CRPLI+V DG  +IKK HI+RL    + +YGW+ELV  GV+EY+DT+EEE +MIAMVP+DI+K SQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRN YQSAMGKQA+G Y SNFH RMDTLAHVLYYSQKPLT +RAM YL++RELPAG+NA+VAI++YTGYNQEDS+ILNESAIERG+FRS+FYRTV  SE+ N+S   VE IEKPN +ETLGMRE EY KLD DGI+  G  V GGD L+GKTVT+P +D+F ET  +S   KRDCS+FMRKTE+G VDK + TT+N GS   K+ +RTTKIPQIGDKFASRHGQKGTCGI+YR EDMPFT+EGI+PDIIINPHAIPSRMT+GHLIE L GKV    G++ +       +  R +     DY      N  ++YNG+TGRK+ TTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGR+K+GGLRFGEMERDCQIAHGA+ FLKERL D SD Y +Y+CR CG++V AN K   F C  C K   V K+++PYAAKLL QEL+SMHI + L VD
Sbjct:    2 NDEITPEFWQDSSWSVISSFFDSKGLVSQQLDSYDEFITSSVQQIVNEFQTVEIEGETKYNLGNDIPNRCEYKFGQISLRQPCHYEPSGICTRLFPNEARLRNLTYSSELLIDYEMNVNKSNGETRKETEQVKIGEIPMMLKSTYCVLGNMTDIDLTQLNECPLDPGGYFIVNGSEKVIIAQERMATNTVFVFPSKDKYLYKCSIKSMVEDSFRSSSTFGVHLLAKGGSGKRTTGSKIVCQLPFIKEDIPLVIVFRAMGFVSERDVIERVIYDDKDMDMLDMLQPSIDEAFVIQDEQTALNFIGSRGVKEGTPIQQRIKFAKDILTKETLPHIGLTEASMNKKAYFLGYMVHKLLETSLGKRAPDDRDHMGNKRIDLAGPLLATLFKGFFKNLAKELKLNTTRMIDRNSDFHSSHAIRSNIITDGFKYSLATGNWGDQKKASETRKGVSQVLNRLTFVSALSHLRRTNSPTGRDSKIAKPRQLHNTQWGMVCPAETPEGHAVGLVKNLSLMTNISVGSKSRPIIEFLEEWGMENLNDISPSAVSEGSKIIVNGSWIGIHRDPNQLVKTLKKLKRSADVIVSEVSINQDFNNKEIKINSDGGRLCRPLIVVEDGSLSIKKSHIQRLGSLDNYQYGWKELVHGGVIEYLDTMEEENAMIAMVPSDISKGSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNCYQSAMGKQALGFYTSNFHARMDTLAHVLYYSQKPLTASRAMTYLKYRELPAGVNAIVAISTYTGYNQEDSIILNESAIERGLFRSDFYRTV--SETVNHSGHQVEAIEKPNSQETLGMREREYTKLDDDGIIRVGSCVYGGDPLIGKTVTIPPSDEFTETSKSSDLMKRDCSVFMRKTEKGFVDKALRTTDNNGSTMVKVTMRTTKIPQIGDKFASRHGQKGTCGIKYRHEDMPFTAEGISPDIIINPHAIPSRMTIGHLIETLLGKV----GQLEENWAMQHLLMTRLMLEKYVDYYQNVIMNPPVLYNGFTGRKINTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRAKDGGLRFGEMERDCQIAHGASLFLKERLFDCSDPYIVYICRHCGEIVIANPKTAVFTCKVCRKIPNVVKVKIPYAAKLLMQELKSMHIKLILNVD 1153          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000054853.1 (SMESG000054853.1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 346/450 (76.89%), Postives = 393/450 (87.33%), Query Frame = 3
Query: 2052 MVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQM 3401
            MVP+DI+K SQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRN YQSAMGKQA+G Y SNFH RMDTLAHVLYYSQKPLT +RAM YL++RELPAG+NA+VAI++YTGYNQEDS+ILNESAIERG+FRS+FYRTV  SE+ N+S   VE IEKPN +ETLGMRE EY KLD DGI+  G  V GGD L+GKTVT+P +D+F ET  +S   KRDCS+FMRKTE+G VDK + TT+N GS   K+ +RTTKIPQIGDKFASRHGQKGTCGI+YR EDMPFT+EGITPDIIINPHAIPSRMT+GHLIE L GKV A RGE+GDATPFND +NV KI R+LS+  YE+ GNE++YNG+TGRK+ TTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGR+K+GGLRFGEMERDCQIAHGA+ FLKERL D SD Y +Y+CR CG++
Sbjct:    1 MVPSDISKGSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNCYQSAMGKQALGFYTSNFHARMDTLAHVLYYSQKPLTASRAMTYLKYRELPAGVNAIVAISTYTGYNQEDSIILNESAIERGLFRSDFYRTV--SETVNHSGHQVEAIEKPNSQETLGMREREYTKLDDDGIIRVGSCVYGGDPLIGKTVTIPPSDEFTETSKSSDLMKRDCSVFMRKTEKGFVDKALRTTDNNGSTLVKVTMRTTKIPQIGDKFASRHGQKGTCGIKYRHEDMPFTAEGITPDIIINPHAIPSRMTIGHLIETLLGKVGAIRGELGDATPFNDEINVGKICRLLSECDYESTGNEVLYNGFTGRKINTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRAKDGGLRFGEMERDCQIAHGASLFLKERLFDCSDPYIVYICRHCGEI 448          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000032705.1 (SMESG000032705.1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 391/1186 (32.97%), Postives = 603/1186 (50.84%), Query Frame = 3
Query:  108 ESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEEFPKLEIQGETQY----GSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPNDARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLLSEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFV--FPAKDKYSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQEIPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEA--FVIQDEHHALNYIGSRGVKPGIPVA------------------QRIKFAKDVITKETLPHIGTTEFRSTRKAYFLGYMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIID--KTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISV---GSKSDPIIEFLEEWSMESLEEIAPSAIANATKIFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYTDSGRICRPLIIVNDGKF-----AIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNESESRNNSTEFVENIEKPNKEETLGMREEEYV-KLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKF--KKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDA---VNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYFIYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSMHITMRL 3539
            +S  +++  +     LVR  LDSF+ F+   + +IV+   +++I     +        D P   EY   QI +             P+ P   R+RN TY A V VD+ Q     +  I +  ++  IG+IPIMLRS  C L  +S+ +L + NEC  D GGYFI  G+E+V + QE+MA N + +  F    K   K  +   +             ++ K+ +                 + IP+ ++F A+   + +DI E    +   +++H  L  S++E+    I  +  AL ++      P I VA                  + +  A+  I +  L H+  +    + +A +LG M  R+L       + DDRD  G KRL++ G  LA +F+  F++L   L+    K I+  K  +L     ++ ++IT+G+   + TGNW    + S  R GV+QVLNRL++  TL HL R++S   +  KI   R +H +Q G VC A+TPEG A GLVKNLA +  I+V     + + +  F+     + L      +  N   I +NG  +G    P   MA   + RR   ++   VS+  +   + + + +D GR+ RP IIV +G       A+ +E +  L++       W +LV  G++EYID LE     +        +  Q  + HTH +I P+  LGV AS+IPFP HNQSPRNTYQ AMGKQA+GV  +N   R D   H L   Q+PLT +       ++ LPAG NA+VAI  + GY+ ED++++N++++ERG+F+S              +++   ++ K N+   + +R++     +D DG  + G  +  GD+++ K V  P  D  +     SK    K   + +       +V+K+  TT +   +  +++    + P++GDK +SRHGQKG        +DMP+T +G+ PDII+NPH  PSRMTVG LIE L  K +   G   D++ F++A   VN      V+  +G+  +G E+M +G  G  M   V+ GP +YQRLKHMV DK+H+R  G    +TRQP  GRS +GGLR GEMERDC I +GA+Q LKER++  SD +  +VC  CG + T+        C  C  S  VS + +PYA KLL QEL ++ IT RL
Sbjct:    2 DSKHSLVKLYNNSHSLVRHHLDSFNHFVEVEMGKIVKTHGRVDIPSSKFFVQISNIKVDKPAIFEY---QIKI-------------PLYPQQCRVRNFTYAADVTVDI-QYPGPGNKLIKN--EKFVIGRIPIMLRSKICNLYGLSNEELTRKNECIYDTGGYFITKGTERVFLMQEQMAKNRMIIEKFKITKKGGIKVPLSEKIPDEDIVCHVTSYTIVNKTKTTVFRNSGYFYVQNSLFHESIPLFVMFAALNMPAHKDIFESIGLE---SELHNELICSVEESIELGIFSQRQALMWL-----IPRIKVAMNKENKMTTSPTSMEEEERSLLMARQEICRRVLNHVPGSVGNLSYRAKYLGLMTRRILLAENGLISADDRDFYGIKRLEMVGTYLALMFEDKFQSLMSALQMELTKTINANKANQLDPTQYIRQSLITEGMFQCIFTGNW-HLMRFSMARSGVTQVLNRLSYLGTLGHLGRISSQFEKVRKISGARAIHLSQHGFVCVADTPEGEACGLVKNLAFLVEITVNLPAEEQEQLEMFIRRSYSDDLGTFRHQSGMNL--IMVNGVPIGWTYQP-VAMAAALRERRRAGLIHPHVSVYYETKMETLHVCSDGGRMVRPYIIVGNGGVSKLTRAVHQEILAGLRD-------WDDLVRSGIIEYIDALEGYAECLVAF-----EECQLTEQHTHLDIDPATALGVVASLIPFPHHNQSPRNTYQCAMGKQALGVIATNQSKRCDGTQHRLVAPQRPLTMSHVGTLTNYQFLPAGQNAIVAILCFGGYDIEDAIVINKASLERGLFKSV-------------TSKCFTDVIKDNEFLAIPVRKDRRQHAIDDDGTAAIGSVIRNGDIVISKIVN-PVKDPVVAATEASKVMDPKPAPTCYSGSEPTIVVEKI--TTFDGHYRMERVKTSQMRQPEVGDKLSSRHGQKGVISRVVAMDDMPYTEDGLVPDIIMNPHGFPSRMTVGKLIELLANKSAVMDGNYRDSSAFSEAGHKVNEGDYQSVMRAHGFSMSGKEVMMSGRNGAVMECDVYTGPVFYQRLKHMVQDKVHARDFGKNQQLTRQPNVGRSNDGGLRVGEMERDCLIGYGASQILKERMMLSSDPFRAWVCEKCGMLATSK-----EWCQMCRSSQHVSSVVMPYATKLLMQELMTIQITPRL 1123          
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Match: SMESG000009943.1 (SMESG000009943.1)

HSP 1 Score: 303.523 bits (776), Expect = 3.109e-86
Identity = 229/864 (26.50%), Postives = 391/864 (45.25%), Query Frame = 3
Query: 1125 MVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELKNNTLKIIDKT-----RELKAGLALKSNVITDGLKYSLATGNWGD-QKKASETRKGVSQVLNRLTFASTLSHLRRLNSPSGR-DGKIPKPRQLHNTQWGMVCPAETPEGHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAP-SAIANATK---IFINGSWVG------------------IHRDPDQLMATLKKLRRSMDVVVSEVSI-VRDYSGKEIKIYTDSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYIDTLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYLRFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYR--TVNESESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVLLGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEGSKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDIIINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVLSDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARGPVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDV-SDSYFIYVCRICGQMVTANIK---------NQT--------FKCLSCNKSTEVS-------KIRLPYAAKLLSQELQSMHITMRLFV 3545
            MV +L S    +   +  D +  + +   G L   +F+    N    +  N    + K      +E+       S  I + + Y L+TG+ G       +   G+  + + + F   +++ R  +  +   D K    R+L    WG VCP  TP+G   GL+ + ++   +   + S    + LE +  +S+ E+    + A+ ++   + +NG  +G                  +  DP+ L+       R+ +++   +SI    + G  I I+T+SGR+ RP+                           +  +  + V+EYI T E+    I+    +         + TH E+    +    A   P+ ++N SPRN YQ  M KQ+MG    +   R D   +     Q PLT ++  +    ++ P G N +VAIASYT Y+ ED++++N +++ERG+ R   Y+   ++ +  R    E V           +G   + +  LD DG+   G R     ++ GK+          E V  +K+K         +++ G V  +    ++ G+  C   I+  +   IGDKF+SRHGQKG   ++ +  D+P + +GI PD + NPH+IPSRMTVG +IE + GK++A   +  D+T F  +  V +    L  Y Y+  G E  Y+GY GR M + +  G  YYQRL+H+V+DK   R  G +  +TRQP++GR   GG+R GEMERD  ++HGA   L++R++D  SD   +  C  C   + +  +         NQT        ++C  C      S       ++R+P   +    EL +M++ ++L V
Sbjct:  232 MVLKLHSFVNDKCCQESTDTLNFQEILTPGSLFQQVFRLTLVNYLANVDRNVKIFMSKNSNKPIKEIVKSSFKDSKRILNPMHYLLSTGSLGQITVPGVKQNNGLRIMTDNINFYRFIANFRAFHRGAFFIDMKSSTIRRLLPESWGFVCPVHTPDGTPCGLLNHFSINTMVQASAASSDQDDSLERFLKKSVMELNQIKSFADKSQFICVMLNGKLLGYIYDRFAQEFANHIRYKKVFPDPELLVP------RTTEIICKNISITAAQFPG--IYIFTNSGRLLRPV---------------------------YNIMFGEPVIEYIGTFEQTYLDISCQGGNTMSGGDSDVSVTHQELSAESVYSFTAGFTPYQNYNPSPRNLYQCQMSKQSMGYTYYSTRYRSDNKLYCFLGPQIPLTRSKTYDEFNMKKRPLGYNPIVAIASYTAYDMEDAMVINLNSLERGMGRCAIYKHYVIDLTPDRGRLDESV-----------IGCGNKVFDDLDWDGLPPIGAR-----LIPGKSNMYAQYSSQTEQVKVTKYK---------ESQVGYVINISRNGSDYGATIC---IKLERNTDIGDKFSSRHGQKGVNSLKLQTVDLPVSEDGIVPDQLFNPHSIPSRMTVGMMIEFIAGKLAALSSKSIDSTAFQTSDIVEEYMAGLRSYKYDGFGYERFYDGYRGRLMDSEITMGVVYYQRLRHLVEDKYQVRTIGKIDNITRQPVKGRKVGGGIRLGEMERDGLLSHGATFCLQDRIIDCNSDKVIVRYCSNCKSFIHSYYRPVLEQVPWHNQTDNAKHGNSWRCKLCENDIRYSYSNENMLRVRVPAVTRHFIHELTTMNVKVQLSV 1032          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR2B0.000e+068.59RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
POLR2B0.000e+068.59RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
POLR2B0.000e+068.59RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
POLR2B0.000e+069.01RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
POLR2B0.000e+069.35RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpb-20.000e+066.07DNA-directed RNA polymerase II subunit RPB2 [Sour... [more]
rpc-20.000e+036.34DNA-directed RNA polymerase subunit beta [Source:... [more]
rpc-20.000e+036.34DNA-directed RNA polymerase subunit beta [Source:... [more]
rpoa-23.431e-13029.66DNA-directed RNA polymerase subunit beta [Source:... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RpII1400.000e+067.59gene:FBgn0262955 transcript:FBtr0082892[more]
RpII1400.000e+067.59gene:FBgn0262955 transcript:FBtr0344600[more]
RpIII1280.000e+036.36gene:FBgn0004463 transcript:FBtr0087977[more]
RpI1356.768e-10528.85gene:FBgn0003278 transcript:FBtr0078054[more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr2b0.000e+068.42polymerase (RNA) II (DNA directed) polypeptide B [... [more]
polr3b0.000e+038.01polymerase (RNA) III (DNA directed) polypeptide B ... [more]
polr3b0.000e+038.01polymerase (RNA) III (DNA directed) polypeptide B ... [more]
polr2b0.000e+066.18polymerase (RNA) II (DNA directed) polypeptide B [... [more]
polr2b2.700e-14860.73polymerase (RNA) II (DNA directed) polypeptide B [... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfkbia0.000e+068.50NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-4... [more]
nfkbia0.000e+068.92NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-4... [more]
nfkbia0.000e+064.64NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-4... [more]
nfkbia0.000e+069.10NFKB inhibitor alpha [Source:Xenbase;Acc:XB-GENE-4... [more]
polr3b0.000e+037.35polymerase (RNA) III (DNA directed) polypeptide B ... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Polr2b0.000e+068.59polymerase (RNA) II (DNA directed) polypeptide B [... [more]
Polr3b0.000e+037.72polymerase (RNA) III (DNA directed) polypeptide B ... [more]
Polr1b1.829e-11127.77polymerase (RNA) I polypeptide B [Source:MGI Symbo... [more]
Polr1b3.465e-2323.34polymerase (RNA) I polypeptide B [Source:MGI Symbo... [more]
Polr3b3.792e-1333.57polymerase (RNA) III (DNA directed) polypeptide B ... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CFI7|RPB2_MOUSE0.000e+068.59DNA-directed RNA polymerase II subunit RPB2 OS=Mus... [more]
sp|P30876|RPB2_HUMAN0.000e+068.59DNA-directed RNA polymerase II subunit RPB2 OS=Hom... [more]
sp|P08266|RPB2_DROME0.000e+067.59DNA-directed RNA polymerase II subunit RPB2 OS=Dro... [more]
sp|Q10578|RPB2_CAEEL0.000e+066.07DNA-directed RNA polymerase II subunit RPB2 OS=Cae... [more]
sp|Q54J75|RPB2_DICDI0.000e+058.97DNA-directed RNA polymerase II subunit rpb2 OS=Dic... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8X7D90.000e+070.05DNA-directed RNA polymerase subunit beta OS=Opisth... [more]
A0A3Q0KLS80.000e+069.56DNA-directed RNA polymerase subunit beta OS=Schist... [more]
A0A4Z2DPU40.000e+069.48DNA-directed RNA polymerase subunit beta OS=Schist... [more]
C1LF250.000e+069.39DNA-directed RNA polymerase subunit beta OS=Schist... [more]
G4VSK50.000e+069.70DNA-directed RNA polymerase subunit beta OS=Schist... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
POLR2B0.000e+068.98RNA polymerase II subunit B [Source:HGNC Symbol;Ac... [more]
polr3b0.000e+038.00RNA polymerase III subunit B [Source:NCBI gene;Acc... [more]
polr3b0.000e+038.12RNA polymerase III subunit B [Source:NCBI gene;Acc... [more]
polr1b3.710e-11927.41RNA polymerase I subunit B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008572.10.000e+063.60pep scaffold:Pmarinus_7.0:GL476831:175452:211422:1... [more]
ENSPMAT00000001310.10.000e+070.89pep scaffold:Pmarinus_7.0:GL477974:3852:23589:-1 g... [more]
ENSPMAT00000009064.12.445e-13844.51pep scaffold:Pmarinus_7.0:GL481227:16752:24008:-1 ... [more]
ENSPMAT00000002293.17.655e-3233.33pep scaffold:Pmarinus_7.0:GL487410:805:8051:1 gene... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPB20.000e+053.80RNA polymerase II second largest subunit B150; par... [more]
RET10.000e+036.63Second-largest subunit of RNA polymerase III; RNA ... [more]
RPA1359.324e-12329.98RNA polymerase I second largest subunit A135 [Sour... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368970.000e+067.27DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO333682.067e-7426.40DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO302351.502e-4847.13DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO302362.035e-2152.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447982.035e-2152.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polr2b0.000e+068.42RNA polymerase II subunit B [Source:NCBI gene;Acc:... [more]
polr3b0.000e+036.98RNA polymerase III subunit B [Source:NCBI gene;Acc... [more]
polr3b0.000e+037.03RNA polymerase III subunit B [Source:NCBI gene;Acc... [more]
polr1b4.104e-12028.01RNA polymerase I subunit B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067331.10.000e+099.91SMESG000067331.1[more]
SMESG000055060.10.000e+069.43SMESG000055060.1[more]
SMESG000054853.10.000e+076.89SMESG000054853.1[more]
SMESG000032705.10.000e+032.97SMESG000032705.1[more]
SMESG000009943.13.109e-8626.50SMESG000009943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002529 ID=SMED30002529|Name=DNA-directed RNA polymerase subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3626bp
TGCTTGTTATTTTCAAATTTTAACTATTTTCTTGCAATTGTTGCATCTAT
AATTTACTTTTTAAAACAAGAATGGACGATGAGGAAATCACATCAGAGTT
TTGGCAAGAGTCATCATGGACTGTGATTAGTAGCTTCTTTGAAGAGAAAG
GGTTGGTTCGTCAACAACTAGATTCTTTTGATGAGTTTTTAATGACATCA
ATTCAACGGATTGTGGAAGAATTTCCGAAACTTGAAATTCAGGGTGAGAC
GCAATATGGTTCAGGATGTGACACGCCAAACAAATGTGAATATTCGTTTG
GACAAATTTATTTAAGCAAAGCTACACATTGGGAATCTGATGGGACAGGC
AGTCCTATGATGCCAAATGATGCTAGACTAAGAAATTTAACTTATTGTGC
TCCAGTTTTTGTTGACGTTACTCAAAAAAATATGCGTAGTGATGATGAAA
TTACGGATACTACAGATAGAACTTGTATCGGTAAAATACCCATTATGTTA
CGATCAACTTATTGCTTGCTTTCTGAAATGTCTGACGTGGATTTAGCTCA
ATTAAATGAATGTCCATTAGATCCAGGCGGATATTTCATTATTAACGGAT
CTGAAAAAGTCATAATTGCTCAGGAACGAATGGCAAATAATACTGTTTTC
GTATTTCCAGCAAAGGATAAATATTCTTATAAATGCAATGTCAAATCAAT
GGTGGAATATAGTTTCAGATCAGCAAGTAATTTGGGTGTAAATCTTTTAG
CTAAAAGTGGATCTGGAAAACGCGTCGTGGGTCCAAAAATTGTCTGTACC
ATGCCGTTTTTAAAACAGGAAATTCCTATTATCATATTATTTCGTGCTAT
GGGATTTGTGTCTGATCGAGATATTATTGAACATACAATTTACGATCCTG
ATGATACTGATATGCATGAAATGTTAAAACCGTCAATTGATGAAGCATTT
GTCATTCAAGATGAACATCACGCATTGAATTATATCGGATCAAGAGGAGT
TAAACCTGGTATCCCAGTTGCACAGAGAATCAAATTTGCCAAAGATGTTA
TTACCAAGGAAACATTACCCCACATTGGAACAACGGAATTTCGATCAACA
AGAAAAGCATATTTTCTTGGTTATATGGTTCACCGGTTATTATCAACTGC
TTTGAAACGACGAAATCCCGATGACCGGGATCACATGGGACATAAGCGAT
TGGATTTAGCAGGACCGTTATTGGCATTTCTGTTTAAAGGATTCTTTAAA
AATCTTGCTAAAGAATTGAAAAATAATACTCTAAAAATAATCGATAAAAC
GCGTGAATTAAAAGCTGGATTGGCGTTGAAGAGTAACGTGATTACTGACG
GATTGAAGTATAGTTTGGCAACAGGAAATTGGGGCGATCAAAAGAAAGCC
AGTGAAACGAGAAAGGGAGTATCTCAGGTGTTGAATCGATTGACATTTGC
CTCGACTCTCTCGCATTTGAGAAGATTGAATTCCCCGAGTGGTCGAGACG
GTAAAATCCCGAAACCCCGTCAGTTACACAACACCCAATGGGGCATGGTG
TGTCCCGCTGAAACCCCAGAAGGTCACGCAGTTGGATTGGTTAAAAACCT
CGCATTGATGGCTTACATTTCCGTTGGCAGTAAAAGCGACCCGATTATCG
AATTTCTCGAAGAATGGTCTATGGAAAGCCTTGAGGAAATCGCCCCTTCC
GCTATCGCAAACGCCACGAAAATCTTCATCAACGGCAGCTGGGTCGGTAT
TCATCGTGATCCGGATCAATTAATGGCCACGCTGAAAAAGCTGAGACGAT
CAATGGATGTCGTAGTGAGCGAGGTGAGTATCGTTCGGGATTACTCGGGA
AAAGAGATAAAAATCTACACGGATAGCGGTCGAATCTGTCGGCCGTTAAT
CATTGTCAATGATGGGAAATTCGCGATTAAAAAGGAGCACATAAAACGGT
TGAAGGAAAAGGCGCACGCAAGATACGGTTGGCAGGAGCTTGTGTCGGAC
GGAGTCGTGGAATATATCGACACGCTTGAGGAAGAGACATCAATGATTGC
GATGGTACCGGCAGATATCACCAAGAACTCCCAGTACTGCAAAACCCACA
CTCACTGTGAGATCCACCCGTCGATGATCCTCGGTGTGTGTGCCAGCATC
ATCCCGTTCCCGGATCACAATCAATCCCCAAGGAACACCTATCAGAGTGC
TATGGGCAAGCAAGCTATGGGAGTATACATCAGCAATTTCCATACCCGGA
TGGACACACTGGCACATGTGCTCTATTACTCCCAGAAACCATTGACAACT
ACCCGGGCCATGGAGTACCTCCGGTTTCGCGAGTTACCGGCCGGAATCAA
CGCCGTCGTAGCAATCGCCTCATATACCGGATACAATCAAGAGGATTCTG
TGATTCTCAATGAATCGGCAATTGAAAGGGGGATATTCCGATCCGAGTTC
TATCGGACCGTCAATGAAAGCGAGAGTAGGAATAATTCCACGGAATTTGT
GGAAAATATCGAAAAACCCAACAAAGAAGAAACTCTGGGAATGAGAGAAG
AGGAATATGTGAAACTCGATGCGGATGGAATCGTTTCCCCGGGGGTTCGG
GTGTCGGGTGGCGATGTGTTGCTGGGGAAAACCGTCACGTTGCCAGCTAC
TGATGACTTCATTGAAACTGTAGGCAATTCGAAATTCAAAAAGCGAGACT
GTAGTTTGTTTATGCGTAAAACCGAGCAGGGAATTGTCGATAAGGTTATG
TTGACGACAAACAACGAGGGCTCGAAATTCTGTAAGATTAGAATTAGGAC
TACGAAAATTCCGCAAATCGGCGATAAGTTTGCGTCCCGTCACGGACAAA
AGGGAACCTGTGGTATTAGATACCGACAGGAAGATATGCCGTTCACCAGT
GAAGGAATCACTCCTGATATCATCATTAATCCACACGCAATTCCCAGCCG
GATGACGGTTGGGCATTTAATTGAATGCTTGCAAGGTAAAGTCAGCGCAA
ATCGAGGGGAAATCGGTGATGCTACTCCGTTTAATGATGCAGTTAATGTG
AGGAAAATATCTCGCGTTTTAAGTGATTATGGTTATGAAGCTAATGGAAA
TGAGATAATGTATAATGGTTATACCGGAAGAAAAATGACAACAACTGTGT
TTTTTGGACCAACTTATTATCAAAGATTGAAACACATGGTGGATGATAAA
ATCCACAGTAGAGCACGAGGCCCAGTGACAATGATGACTAGGCAACCGTT
AGAAGGTCGATCCAAAGAAGGCGGCCTTCGTTTCGGTGAGATGGAACGCG
ATTGCCAGATAGCTCATGGAGCAGCTCAATTTCTGAAAGAGCGACTCCTT
GATGTCAGTGATTCGTACTTTATCTACGTGTGCCGTATTTGTGGCCAAAT
GGTTACGGCGAACATTAAAAATCAAACATTCAAATGCTTATCCTGCAATA
AGAGCACAGAAGTATCGAAAATCAGATTGCCTTATGCGGCGAAACTGCTG
TCACAGGAATTGCAGTCAATGCACATCACCATGCGATTATTTGTGGATTA
AATATCTTCATTTTATTGGATTTTTTGCTGTCAATTTTGTTATATTTGTT
TATTCATGTAGAAATTTTCATCAAAT
back to top

protein sequence of SMED30002529-orf-1

>SMED30002529-orf-1 ID=SMED30002529-orf-1|Name=SMED30002529-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1160bp
MDDEEITSEFWQESSWTVISSFFEEKGLVRQQLDSFDEFLMTSIQRIVEE
FPKLEIQGETQYGSGCDTPNKCEYSFGQIYLSKATHWESDGTGSPMMPND
ARLRNLTYCAPVFVDVTQKNMRSDDEITDTTDRTCIGKIPIMLRSTYCLL
SEMSDVDLAQLNECPLDPGGYFIINGSEKVIIAQERMANNTVFVFPAKDK
YSYKCNVKSMVEYSFRSASNLGVNLLAKSGSGKRVVGPKIVCTMPFLKQE
IPIIILFRAMGFVSDRDIIEHTIYDPDDTDMHEMLKPSIDEAFVIQDEHH
ALNYIGSRGVKPGIPVAQRIKFAKDVITKETLPHIGTTEFRSTRKAYFLG
YMVHRLLSTALKRRNPDDRDHMGHKRLDLAGPLLAFLFKGFFKNLAKELK
NNTLKIIDKTRELKAGLALKSNVITDGLKYSLATGNWGDQKKASETRKGV
SQVLNRLTFASTLSHLRRLNSPSGRDGKIPKPRQLHNTQWGMVCPAETPE
GHAVGLVKNLALMAYISVGSKSDPIIEFLEEWSMESLEEIAPSAIANATK
IFINGSWVGIHRDPDQLMATLKKLRRSMDVVVSEVSIVRDYSGKEIKIYT
DSGRICRPLIIVNDGKFAIKKEHIKRLKEKAHARYGWQELVSDGVVEYID
TLEEETSMIAMVPADITKNSQYCKTHTHCEIHPSMILGVCASIIPFPDHN
QSPRNTYQSAMGKQAMGVYISNFHTRMDTLAHVLYYSQKPLTTTRAMEYL
RFRELPAGINAVVAIASYTGYNQEDSVILNESAIERGIFRSEFYRTVNES
ESRNNSTEFVENIEKPNKEETLGMREEEYVKLDADGIVSPGVRVSGGDVL
LGKTVTLPATDDFIETVGNSKFKKRDCSLFMRKTEQGIVDKVMLTTNNEG
SKFCKIRIRTTKIPQIGDKFASRHGQKGTCGIRYRQEDMPFTSEGITPDI
IINPHAIPSRMTVGHLIECLQGKVSANRGEIGDATPFNDAVNVRKISRVL
SDYGYEANGNEIMYNGYTGRKMTTTVFFGPTYYQRLKHMVDDKIHSRARG
PVTMMTRQPLEGRSKEGGLRFGEMERDCQIAHGAAQFLKERLLDVSDSYF
IYVCRICGQMVTANIKNQTFKCLSCNKSTEVSKIRLPYAAKLLSQELQSM
HITMRLFVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037033DNA-dir_RNAP_su2_hyb_sf
IPR037034RNA_pol_Rpb2_2_sf
IPR015712DNA-dir_RNA_pol_su2
IPR007644RNA_pol_bsu_protrusion
IPR007647RNA_pol_Rpb2_5
IPR007645RNA_pol_Rpb2_3
IPR007646RNA_pol_Rpb2_4
IPR007642RNA_pol_Rpb2_2
IPR007120DNA-dir_RNAP_su2_dom
IPR007641RNA_pol_Rpb2_7
IPR014724RNA_pol_RPB2_OB-fold
IPR007121RNA_pol_bsu_CS
Vocabulary: molecular function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0003677DNA binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0032549ribonucleoside binding
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007644RNA polymerase, beta subunit, protrusionPFAMPF04563RNA_pol_Rpb2_1coord: 27..425
e-value: 1.1E-56
score: 192.1
NoneNo IPR availableGENE3DG3DSA:3.90.1100.10coord: 19..189
e-value: 1.5E-7
score: 32.7
NoneNo IPR availableGENE3DG3DSA:3.90.1800.10coord: 1052..1159
e-value: 9.7E-42
score: 143.2
NoneNo IPR availableGENE3DG3DSA:3.90.1070.20coord: 519..601
e-value: 1.0E-35
score: 123.1
NoneNo IPR availablePANTHERPTHR20856:SF7DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2coord: 8..1158
NoneNo IPR availableSUPERFAMILYSSF64484beta and beta-prime subunits of DNA dependent RNA-polymerasecoord: 8..1159
IPR007645RNA polymerase Rpb2, domain 3PFAMPF04565RNA_pol_Rpb2_3coord: 452..516
e-value: 1.6E-23
score: 82.6
IPR007120DNA-directed RNA polymerase, subunit 2, hybrid-binding domainPFAMPF00562RNA_pol_Rpb2_6coord: 690..1065
e-value: 5.4E-128
score: 427.4
IPR007641RNA polymerase Rpb2, domain 7PFAMPF04560RNA_pol_Rpb2_7coord: 1067..1157
e-value: 4.0E-30
score: 104.0
IPR007646RNA polymerase Rpb2, domain 4PFAMPF04566RNA_pol_Rpb2_4coord: 551..613
e-value: 1.7E-22
score: 79.4
IPR007642RNA polymerase Rpb2, domain 2PFAMPF04561RNA_pol_Rpb2_2coord: 189..378
e-value: 5.4E-42
score: 143.6
IPR007647RNA polymerase Rpb2, domain 5PFAMPF04567RNA_pol_Rpb2_5coord: 637..683
e-value: 2.2E-17
score: 63.3
IPR037033DNA-directed RNA polymerase, subunit 2, hybrid-binding domain superfamilyGENE3DG3DSA:2.40.270.10coord: 691..1051
e-value: 6.2E-153
score: 511.0
IPR014724RNA polymerase Rpb2, OB-foldGENE3DG3DSA:2.40.50.150coord: 721..913
e-value: 6.2E-153
score: 511.0
IPR037034RNA polymerase Rpb2, domain 2 superfamilyGENE3DG3DSA:3.90.1110.10coord: 190..368
e-value: 3.7E-65
score: 220.9
IPR015712DNA-directed RNA polymerase, subunit 2PANTHERPTHR20856DNA-DIRECTED RNA POLYMERASE I SUBUNIT 2coord: 8..1158
IPR015712DNA-directed RNA polymerase, subunit 2CDDcd00653RNA_pol_B_RPB2coord: 28..1157
e-value: 0.0
score: 1121.11
IPR007121RNA polymerase, beta subunit, conserved sitePROSITEPS01166RNA_POL_BETAcoord: 917..929