Histidine ammonia-lyase

Overview
NameHistidine ammonia-lyase
Smed IDSMED30002513
Length (bp)2137
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histidine ammonia-lyase (SMED30002513) t-SNE clustered cells

Violin plots show distribution of expression levels for Histidine ammonia-lyase (SMED30002513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histidine ammonia-lyase (SMED30002513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histidine ammonia-lyase (SMED30002513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30002513SMESG000002694.1 SMESG000002559.1 SmedASXL_017838SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v4_2970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig50886newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig50886uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig6438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig6438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig44140uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig44140newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig4726uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig4726newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 Contig30601uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 Contig30601newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig4727uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002513SMESG000002694.1 SMESG000002559.1 Contig4727newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v6_2970_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v6_2219_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30002513SMESG000002694.1 SMESG000002559.1 dd_Smed_v6_2219_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Match: HAL (histidine ammonia-lyase [Source:HGNC Symbol;Acc:HGNC:4806])

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 369/657 (56.16%), Postives = 469/657 (71.39%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+D   +V  L   A+ +Y K K         D     +RR K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG  LT EDLV LGKG Y IKL+     +V KSR ++D I+ E                VVYGITTGFGKF+  +I I+K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH +RPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  VS GNFHGEYPAK LDYLAIGIHELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLDNEDRLEVALENNEFVEVVIEGDAMS--PDFIPSQPEGVYLYSK-YREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKT--------------VVYGITTGFGKFARTVIPINKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQ 642          
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Match: HAL (histidine ammonia-lyase [Source:HGNC Symbol;Acc:HGNC:4806])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 346/603 (57.38%), Postives = 438/603 (72.64%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIK 1841
            R  V +  +W+ V C+D   +V  L   A+ +Y K K         D     +RR K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG  LT EDLV LGKG Y IKL+     +V KSR ++D I+ E                VVYGITTGFGKF+  +I I+K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH +RPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  VS GNFHGEYPAK LDYLAIGIHELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++
Sbjct:    3 RYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLDNEDRLEVALENNEFVEVVIEGDAMS--PDFIPSQPEGVYLYSK-YREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKT--------------VVYGITTGFGKFARTVIPINKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVR 588          
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Match: HAL (histidine ammonia-lyase [Source:HGNC Symbol;Acc:HGNC:4806])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 290/434 (66.82%), Postives = 351/434 (80.88%), Query Frame = 3
Query:  702 MMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            M+LALRIN LAKGYSGI++ETL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH +RPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  VS GNFHGEYPAK LDYLAIGIHELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    1 MLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQ 434          
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Match: HAL (histidine ammonia-lyase [Source:HGNC Symbol;Acc:HGNC:4806])

HSP 1 Score: 282.337 bits (721), Expect = 1.626e-88
Identity = 162/363 (44.63%), Postives = 224/363 (61.71%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDIT--AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAF 1121
            R  V +  +W+ V C+D   +V  L   A+ +Y K K         D     +RR K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG  LT EDLV LGKG Y IKL+     +V KSR ++D I+ E K    M+           G+                  ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AF
Sbjct:    3 RYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLDNEDRLEVALENNEFVEVVIEGDAMS--PDFIPSQPEGVYLYSK-YREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKE-KTDQRMRL----------GLPC---------------MELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAF 336          
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Match: HAL (histidine ammonia-lyase [Source:HGNC Symbol;Acc:HGNC:4806])

HSP 1 Score: 194.512 bits (493), Expect = 7.065e-58
Identity = 95/132 (71.97%), Postives = 109/132 (82.58%), Query Frame = 3
Query: 1485 RTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIE 1880
            R ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE
Sbjct:    2 RIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIE 133          
BLAST of Histidine ammonia-lyase vs. Ensembl Celegans
Match: haly-1 (Histidine ammonia-lyase [Source:UniProtKB/Swiss-Prot;Acc:Q20502])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 337/656 (51.37%), Postives = 440/656 (67.07%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITL-----DVDGNNLNNKSGAVPNLYTHTECF--------------PKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFE 1949
            MR+ VQ+ ++ + V CK  D++  +   ++ K  + +   K     D   +RRT  ++LLDPEDL+  VL   ++I +     + +      K   + N     E                P       ++  +DG SL PEDLV   KG   I+LS +   ++ K+R+ +++I +E++               VYG+TTGFG FS+V I   K+++LQ +LIRSH+ G G P+   +ARM+LALRIN LAKG+SGI++E ++K++ AFN   V ++P +G+VG SGDL PLAHLALGL+GEG++WSP TGW  +   L    L PL+L  KEGL LINGTQ +T +GA  L RA NIARQADVIAALSL+VLKGTTRA+D  IH +RPH GQ   A RLRALLH+   PS+I+ESHR C+KVQDAYTLRC PQVHG+V DT++FVR I+TTEMNSATDNPLVF +   I+S GNFHGEYPAK LD+LAI + ELA MSERR ERLVN   SGLP FL  DGGLNSGFM   + AA+LVSENKVL HPSSVDS+ TS  QEDHVSMG F ARKAL VV +VE+VLA+ELLAA Q +EFL+PL ST PL  + +L+R+V  PL++DR+M P+I+ V+ ++R   +W  V P +E+ E
Sbjct:    1 MRLQVQIGTECVVVPCKPDDTIHAVAKKSVEKLRRLR--PKLPLADDYFEVRRTVGNSLLDPEDLVSDVLKDSDFIIVAASVEETEDAKEAKKQEEIDNARAEIEKIDNRRRKVSFADSLAPMVLAPPTKLLILDGNSLLPEDLVRCEKGECAIQLSMESEDRIRKARTFLEKIASEHRA--------------VYGVTTGFGTFSNVTIPPEKLKKLQLNLIRSHATGYGEPLAPNRARMLLALRINILAKGHSGISVENIKKMIAAFNAFCVSYVPQQGTVGCSGDLCPLAHLALGLLGEGKMWSPTTGWQPADVVLKKNNLEPLELGPKEGLALINGTQMVTALGAYTLERAHNIARQADVIAALSLDVLKGTTRAYDPDIHRIRPHRGQNLSALRLRALLHSEANPSQIAESHRNCTKVQDAYTLRCVPQVHGVVHDTIEFVREIITTEMNSATDNPLVFADREEIISGGNFHGEYPAKALDFLAIAVAELAQMSERRLERLVNKELSGLPTFLTPDGGLNSGFMTVQLCAASLVSENKVLCHPSSVDSIPTSCNQEDHVSMGGFAARKALTVVEHVEAVLAMELLAACQGIEFLKPLISTAPLHKIYQLVRSVAPPLNEDRYMKPEIDAVLEMIRENRIWEAVLPHLETLE 640          
BLAST of Histidine ammonia-lyase vs. Ensembl Zebrafish
Match: hal (histidine ammonia-lyase [Source:ZFIN;Acc:ZDB-GENE-070410-5])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 375/656 (57.16%), Postives = 483/656 (73.63%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGDS-VENLVDSAIVKYNKFKKPAKNIE-MKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            R  V +  +W+TV CKD  S V+ L   A+ +Y K K     I+ +K++   +RR +   LLD +D++  VL   +++ L ++G+ ++     +P+    T    + +   E+  T+DG SLT  DLV LGKG Y IKL+ +   KV +SR L+D IV ENK              VVYGITTGFGKF+  +I +SK++ELQE+L+RSHS+G+GSP++ E+ RM+LALRIN LAKG+SG++ ETL  ++ AFN   + ++P KG+VGASGDLAPL+HLALGLMGEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +GAEA+ RA  IARQAD+IAAL+LEVLKGTT+AFD+ IH++RPH GQ +VA R R+LL +  +PSEI+ESHRFC +VQDAYT+RCCPQVHGIV DT++FV+ I+ TE+NSATDNP+VF E G  +S GNFHGEYPAK LDYLAIG+HELA++SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENKVL HPSS+DSL+TSA  EDHVSMG + ARKAL VV +VE VLAIELLAA Q +EFLRPL++T PLE V  L+R  +KP  KDRFM+PDIE V  +L   +VWN+  P+IE +    +P+   SSPT  +L
Sbjct:    3 RFTVHVRDEWITVPCKDATSTVKWLGFEALKRYVKNKPDNGGIKHVKEVCFVVRRCQGFGLLDNDDIVEDVLEDNDFVELAIEGDTMSQD--FIPS-QPATSHLTRAYREPEQHITLDGNSLTSTDLVNLGKGLYKIKLTPEAEQKVVESRELLDTIVKENK--------------VVYGITTGFGKFARTVIPVSKLKELQENLLRSHSSGLGSPLSPERTRMLLALRINVLAKGHSGVSPETLHSMIQAFNASCLSYVPEKGTVGASGDLAPLSHLALGLMGEGKMWSPKSGWADAKYVLEAHGLKPISLKPKEGLALINGTQMITSLGAEAVERAEAIARQADIIAALTLEVLKGTTKAFDSDIHKLRPHPGQNEVAMRFRSLLDSDHHPSEIAESHRFCDRVQDAYTMRCCPQVHGIVNDTIEFVKKIINTEINSATDNPMVFAERGETISGGNFHGEYPAKALDYLAIGVHELASISERRIERLCNPSLSELPAFLVNEGGLNSGFMIAHCTAAALVSENKVLCHPSSIDSLSTSAATEDHVSMGGWAARKALRVVEHVEQVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRAAVKPWIKDRFMAPDIEAVHRLLVDQKVWNIAGPYIEKYCMEYIPESRPSSPTAFAL 641          
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:Xenbase;Acc:XB-GENE-1009307])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 371/659 (56.30%), Postives = 482/659 (73.14%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKNIE-MKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRV 2009
            R  V +  +W+T+ CKD  ++++ L   A+ +Y K K   + +  ++D+   +RR K   LLD +D I  VL  +E++ + V+ +        +P+    +  + K    SE IY +DG SLTP+D+  LGKG Y IKLS +   KV +SR L++ I+ E+K              VVYGI TGFGKF+  +I   K++ELQE+L+RSHSAGVG P++ E+ RM+ ALRIN LAKGYSGI++ETL++ +DAFN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A  L P+ LK KEGL LINGTQ IT +G EA+ RA+ IA+QAD++AAL+LEVLKGT +AFD  IH +RPH GQ +VA R R+LL +  +PSEI+ESHRFC+KVQD YTLRCCPQVHG+V DT+ FV+ I+ TE+NSATDNP+VF E G I+S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL+V+ +VE VLAIELLAA Q +EFLRPL++T PLE V  L+R+V++P  KDRFM+PDIE V  +L   ++WNV EP+IE +    +P+   SSPT+ SL  V
Sbjct:    3 RYTVHVRGEWLTIPCKDACETIKWLGKEALRRYIKNKPDNEFLSCVEDVKFCVRRCKGLGLLDLDDAIEDVLENDEFLEVVVEDDV--TSPDFIPSQPEGSHLYSKYQEPSEYIY-VDGESLTPQDVFNLGKGLYKIKLSPEAEFKVKQSRLLIESIIQEHK--------------VVYGINTGFGKFARTVIPECKLKELQENLVRSHSAGVGKPLSPERTRMLFALRINVLAKGYSGISLETLQQAIDAFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLKAHKLKPVSLKPKEGLALINGTQLITSLGCEAVERANAIAKQADIVAALTLEVLKGTVKAFDADIHRIRPHPGQEEVAFRFRSLLDSDHHPSEIAESHRFCNKVQDPYTLRCCPQVHGVVNDTIAFVKNIIMTEVNSATDNPMVFSERGEIISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVTEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALKVIEHVEHVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRSVVRPWMKDRFMAPDIEAVHRLLVDLKIWNVAEPYIEKYRMEHIPESRPSSPTSFSLDSV 644          
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:Xenbase;Acc:XB-GENE-1009307])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 360/638 (56.43%), Postives = 469/638 (73.51%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKNIE-MKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESF 1946
            R  V +  +W+T+ CKD  ++++ L   A+ +Y K K   + +  ++D+   +RR K   LLD +D I  VL  +E++ + V+ +        +P+    +  + K    SE IY +DG SLTP+D+  LGKG Y IKLS +   KV +SR L++ I+ E+K              VVYGI TGFGKF+  +I   K++ELQE+L+RSHSAGVG P++ E+ RM+ ALRIN LAKGYSGI++ETL++ +DAFN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A  L P+ LK KEGL LINGTQ IT +G EA+ RA+ IA+QAD++AAL+LEVLKGT +AFD  IH +RPH GQ +VA R R+LL +  +PSEI+ESHRFC+KVQD YTLRCCPQVHG+V DT+ FV+ I+ TE+NSATDNP+VF E G I+S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENKVL HPSSVDS++TSA  EDHVSMG + ARKAL+V+ +VE V+AIELLAA Q +EF RPL++T PLE V  L+R+ ++P  KDRFM+PDIE V  +L   +VW V EP+IE +
Sbjct:    3 RYTVHVRGEWLTIPCKDACETIKWLGKEALRRYIKNKPDNEFLSCVEDVKFCVRRCKGLGLLDLDDAIEDVLENDEFLEVVVEDDV--TSPDFIPSQPEGSHLYSKYQEPSEYIY-VDGESLTPQDVFNLGKGLYKIKLSPEAEFKVKQSRLLIESIIQEHK--------------VVYGINTGFGKFARTVIPECKLKELQENLVRSHSAGVGKPLSPERTRMLFALRINVLAKGYSGISLETLQQAIDAFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLKAHKLKPVSLKPKEGLALINGTQLITSLGCEAVERANAIAKQADIVAALTLEVLKGTVKAFDADIHRIRPHPGQEEVAFRFRSLLDSDHHPSEIAESHRFCNKVQDPYTLRCCPQVHGVVNDTIAFVKNIIMTEVNSATDNPMVFSERGEIISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVTEGGLNSGFMIAHCTAAALVSENKVLCHPSSVDSISTSAATEDHVSMGGWAARKALKVIEHVEYVVAIELLAACQGMEFRRPLQTTTPLEKVYELVRSAVRPWMKDRFMAPDIERVHRLLLDQKVWEVAEPYIEKY 623          
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:Xenbase;Acc:XB-GENE-1009307])

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 363/660 (55.00%), Postives = 474/660 (71.82%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKN--IEMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRV 2009
            R  V +  +W+ V CKD  +++  L   A+ +Y K  KP       ++D+   +RR K   LLD +D I   L   E++ + V+G+ ++     +P+       +P +             SL+ +DL++LGKG + IK+                       G  F++   I ++ VVYGITTGFGKF+  +I I+K++ELQE+L+RSHSAGVG P++ E+ RM+LALRIN LAKGYSGI++ETL ++++AFN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RA+ IA+QAD++AAL+LEVLKGTTRAFDT IH +RPH GQ++VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF E G  +S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL+V+ +VE VLAIELLAA Q +EFLRPL++T PLE V  L+R+V++P  KDRFM+PDIE V  +L   ++WNV EP+IE +    +P+   SSPT+ SL  V
Sbjct:    3 RYTVHVRGEWLAVPCKDASETIRWLGKEALRRYIK-NKPDNGGFTSVEDVKFYLRRCKGLGLLDLDDRIEDSLEDNEFVEVVVEGDVMS--PDFIPSQPEGVHLYPLQTFWE---------SLSTQDLLSLGKGLFKIKV----------------------HGGFFLQRLVIVLVPVVYGITTGFGKFARTVIPITKLKELQENLVRSHSAGVGKPLSPERTRMLLALRINVLAKGYSGISLETLHQVIEAFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLQAHGLQPISLKPKEGLALINGTQMITSLGCEAVERANAIAKQADIVAALTLEVLKGTTRAFDTDIHALRPHPGQVEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTITFVKNIITTEINSATDNPMVFSERGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVTEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALKVIEHVEHVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRSVVRPWMKDRFMAPDIEAVHRLLVDLKIWNVAEPYIEKYRMEHIPESRPSSPTSFSLDSV 628          
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:Xenbase;Acc:XB-GENE-1009307])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 363/665 (54.59%), Postives = 478/665 (71.88%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKN--IEMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESG-----MIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRV 2009
            R  V +  +W+ V CKD  +++  L   A+ +Y K  KP       ++D+   +RR K   LLD +D I   L   E++ + V+G+ ++     +P+       + + +    E   I+G SL+ +DL++LGKG + IKL+     KV +SR L+D IV E K              VVYGITTGFGKF+  +I I+K++ELQE+L+RSHSAGVG P++ E+ RM+LALRIN LAKGYSGI++ETL ++++AFN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RA+ IA+QAD++AAL+LEVLKGTTRAFDT IH +RPH GQ++VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+   E       + + + N HG +P + LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL+V+ +VE VLAIELLAA Q +EFLRPL++T PLE V  L+R+V++P  KDRFM+PDIE V  +L   ++WNV EP+IE +    +P+   SSPT+ SL  V
Sbjct:    3 RYTVHVRGEWLAVPCKDASETIRWLGKEALRRYIK-NKPDNGGFTSVEDVKFYLRRCKGLGLLDLDDRIEDSLEDNEFVEVVVEGDVMS--PDFIPSQPEGVHLYSR-YKEPVEYILIEGESLSTQDLLSLGKGLFKIKLTPQAENKVQQSRLLIDSIVQEQK--------------VVYGITTGFGKFARTVIPITKLKELQENLVRSHSAGVGKPLSPERTRMLLALRINVLAKGYSGISLETLHQVIEAFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLQAHGLQPISLKPKEGLALINGTQMITSLGCEAVERANAIAKQADIVAALTLEVLKGTTRAFDTDIHALRPHPGQVEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTITFVKNIITTEINSATDNPVSLLEMNRQVVTICLCSLNTHGGFPFQALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVTEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALKVIEHVEHVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRSVVRPWMKDRFMAPDIEAVHRLLVDLKIWNVAEPYIEKYRMEHIPESRPSSPTSFSLDSV 649          
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:Xenbase;Acc:XB-GENE-1009307])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 361/665 (54.29%), Postives = 474/665 (71.28%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKN--IEMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESG-----MIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRV 2009
            R  V +  +W+ V CKD  +++  L   A+ +Y K  KP       ++D+   +RR K   LLD +D I   L   E++ + V+G+ ++     +P+       +P +             SL+ +DL++LGKG + IKL+     KV +SR L+D IV E K              VVYGITTGFGKF+  +I I+K++ELQE+L+RSHSAGVG P++ E+ RM+LALRIN LAKGYSGI++ETL ++++AFN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RA+ IA+QAD++AAL+LEVLKGTTRAFDT IH +RPH GQ++VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+   E       + + + N HG +P + LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL+V+ +VE VLAIELLAA Q +EFLRPL++T PLE V  L+R+V++P  KDRFM+PDIE V  +L   ++WNV EP+IE +    +P+   SSPT+ SL  V
Sbjct:    3 RYTVHVRGEWLAVPCKDASETIRWLGKEALRRYIK-NKPDNGGFTSVEDVKFYLRRCKGLGLLDLDDRIEDSLEDNEFVEVVVEGDVMS--PDFIPSQPEGVHLYPLQTFWE---------SLSTQDLLSLGKGLFKIKLTPQAENKVQQSRLLIDSIVQEQK--------------VVYGITTGFGKFARTVIPITKLKELQENLVRSHSAGVGKPLSPERTRMLLALRINVLAKGYSGISLETLHQVIEAFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLQAHGLQPISLKPKEGLALINGTQMITSLGCEAVERANAIAKQADIVAALTLEVLKGTTRAFDTDIHALRPHPGQVEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTITFVKNIITTEINSATDNPVSLLEMNRQVVTICLCSLNTHGGFPFQALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVTEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALKVIEHVEHVLAIELLAACQGIEFLRPLRTTTPLEKVYDLVRSVVRPWMKDRFMAPDIEAVHRLLVDLKIWNVAEPYIEKYRMEHIPESRPSSPTSFSLDSV 641          
BLAST of Histidine ammonia-lyase vs. Ensembl Mouse
Match: Hal (histidine ammonia lyase [Source:MGI Symbol;Acc:MGI:96010])

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 368/657 (56.01%), Postives = 469/657 (71.39%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+DG  +V  L   A+ +Y K K         D     + R K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG SL+ EDLV LGKG Y IKL+     KV +SR ++D I+ E                VVYGITTGFGKF+  +I  +K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++AFN   + ++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EAL RAS IARQAD++AAL+LEVLKGTT+AFDT IH VRPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  +S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSE+K L HPSSVDSL+TSA  EDHVSMG + ARKAL VV +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDGKLTVGWLGREAVRRYMKNKPDNGGFTSVDEVQFLVHRCKGLGLLDNEDELEVALEDNEFVEVVIEGDVMS--PDFIPSQPEGVFLYSK-YREPEKYIALDGDSLSTEDLVNLGKGRYKIKLTSIAEKKVQQSREVIDSIIKERT--------------VVYGITTGFGKFARTVIPANKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEAFNASCLSYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLEAHGLKPIVLKPKEGLALINGTQMITSLGCEALERASAIARQADIVAALTLEVLKGTTKAFDTDIHAVRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKDIITTELNSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSESKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVVEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLDQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLE 642          
BLAST of Histidine ammonia-lyase vs. Ensembl Mouse
Match: Hal (histidine ammonia lyase [Source:MGI Symbol;Acc:MGI:96010])

HSP 1 Score: 67.3958 bits (163), Expect = 1.595e-12
Identity = 51/163 (31.29%), Postives = 80/163 (49.08%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKG 521
            R  V +  +W+ V C+DG  +V  L   A+ +Y K K         D     + R K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG SL+ EDLV LGKG Y IKL+     KV +SR ++D I+ E  G
Sbjct:    3 RYTVHVRGEWLAVPCQDGKLTVGWLGREAVRRYMKNKPDNGGFTSVDEVQFLVHRCKGLGLLDNEDELEVALEDNEFVEVVIEGDVMS--PDFIPSQPEGVFLYSK-YREPEKYIALDGDSLSTEDLVNLGKGRYKIKLTSIAEKKVQQSREVIDSIIKERTG 162          
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Match: sp|A7YWP4|HUTH_BOVIN (Histidine ammonia-lyase OS=Bos taurus OX=9913 GN=HAL PE=2 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 369/657 (56.16%), Postives = 471/657 (71.69%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+D   +V  L   A+ +Y K K         D     +RR K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG SLT EDLV+LGKG Y IKL+     +V KSR ++D IV E                VVYGITTGFGKF+  +I +SK+ ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ TL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ LAA GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH VRPH GQ++VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  +S GNFHGEYPAK LDYLAIG+HELA++SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFASVDDARFLVRRCKGLGLLDNEDPLDVALEDNEFVEVVIEGDAMS--PDFIPSQPEGVYLYSK-YREPEKYIALDGDSLTTEDLVSLGKGHYKIKLTPTAEKRVQKSREVIDRIVEEKT--------------VVYGITTGFGKFARTVIPVSKLEELQFNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLGTLKQVIEVFNASCLPYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLAAHGLKPIVLKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHAVRPHRGQVEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTEINSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELASISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLVEQKVWEVAAPYIEKYRMEHIPESRPVSPTAFSLE 642          
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Match: sp|P42357|HUTH_HUMAN (Histidine ammonia-lyase OS=Homo sapiens OX=9606 GN=HAL PE=1 SV=1)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 369/657 (56.16%), Postives = 469/657 (71.39%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+D   +V  L   A+ +Y K K         D     +RR K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG  LT EDLV LGKG Y IKL+     +V KSR ++D I+ E                VVYGITTGFGKF+  +I I+K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++ FN   +P++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH +RPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  VS GNFHGEYPAK LDYLAIGIHELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENK L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLDNEDRLEVALENNEFVEVVIEGDAMS--PDFIPSQPEGVYLYSK-YREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQKSREVIDSIIKEKT--------------VVYGITTGFGKFARTVIPINKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQ 642          
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Match: sp|P21213|HUTH_RAT (Histidine ammonia-lyase OS=Rattus norvegicus OX=10116 GN=Hal PE=1 SV=1)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 368/657 (56.01%), Postives = 470/657 (71.54%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+DG  SV  L   A+ +Y K K         D     +RR K   LLD EDL+   L   E++ + ++G+ ++     +P+       + K +   E+   +DG SL+ EDLV LGKG Y IKL+     KV +SR ++D I+ E                VVYGITTGFGKF+  +I  +K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++ FN   + ++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EA+ RAS IARQAD++AAL+LEVLKGTT+AFDT IH VRPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  +S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSE+K L HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDGKLSVGWLGREAVRRYMKNKPDNGGFTSVDEVRFLVRRCKGLGLLDNEDLLEVALEDNEFVEVVIEGDVMS--PDFIPSQPEGVFLYSK-YREPEKYIALDGDSLSTEDLVNLGKGHYKIKLTSIAEKKVQQSREVIDSIIKERT--------------VVYGITTGFGKFARTVIPANKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEVFNASCLSYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLEAHGLKPIVLKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDTDIHAVRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKDIITTELNSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSESKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLDQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLE 642          
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Match: sp|P35492|HUTH_MOUSE (Histidine ammonia-lyase OS=Mus musculus OX=10090 GN=Hal PE=1 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 368/657 (56.01%), Postives = 469/657 (71.39%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGD-SVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLK 2003
            R  V +  +W+ V C+DG  +V  L   A+ +Y K K         D     + R K   LLD ED +   L   E++ + ++G+ ++     +P+       + K +   E+   +DG SL+ EDLV LGKG Y IKL+     KV +SR ++D I+ E                VVYGITTGFGKF+  +I  +K++ELQ +L+RSHS+GVG P++ E+ RM+LALRIN LAKGYSGI++ETL+++++AFN   + ++P KG+VGASGDLAPL+HLALGL+GEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +G EAL RAS IARQAD++AAL+LEVLKGTT+AFDT IH VRPH GQI+VA R R+LL +  +PSEI+ESHRFC +VQDAYTLRCCPQVHG+V DT+ FV+ I+TTE+NSATDNP+VF   G  +S GNFHGEYPAK LDYLAIG+HELA +SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSE+K L HPSSVDSL+TSA  EDHVSMG + ARKAL VV +VE VLAIELLAA Q +EFLRPLK+T PLE V  L+R+V++P  KDRFM+PDIE    +L   +VW V  P+IE +    +P+    SPT  SL+
Sbjct:    3 RYTVHVRGEWLAVPCQDGKLTVGWLGREAVRRYMKNKPDNGGFTSVDEVQFLVHRCKGLGLLDNEDELEVALEDNEFVEVVIEGDVMS--PDFIPSQPEGVFLYSK-YREPEKYIALDGDSLSTEDLVNLGKGRYKIKLTSIAEKKVQQSREVIDSIIKERT--------------VVYGITTGFGKFARTVIPANKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEAFNASCLSYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLEAHGLKPIVLKPKEGLALINGTQMITSLGCEALERASAIARQADIVAALTLEVLKGTTKAFDTDIHAVRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKDIITTELNSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSESKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVVEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLDQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLE 642          
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Match: sp|Q20502|HUTH1_CAEEL (Histidine ammonia-lyase OS=Caenorhabditis elegans OX=6239 GN=haly-1 PE=1 SV=1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 337/656 (51.37%), Postives = 440/656 (67.07%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITL-----DVDGNNLNNKSGAVPNLYTHTECF--------------PKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFE 1949
            MR+ VQ+ ++ + V CK  D++  +   ++ K  + +   K     D   +RRT  ++LLDPEDL+  VL   ++I +     + +      K   + N     E                P       ++  +DG SL PEDLV   KG   I+LS +   ++ K+R+ +++I +E++               VYG+TTGFG FS+V I   K+++LQ +LIRSH+ G G P+   +ARM+LALRIN LAKG+SGI++E ++K++ AFN   V ++P +G+VG SGDL PLAHLALGL+GEG++WSP TGW  +   L    L PL+L  KEGL LINGTQ +T +GA  L RA NIARQADVIAALSL+VLKGTTRA+D  IH +RPH GQ   A RLRALLH+   PS+I+ESHR C+KVQDAYTLRC PQVHG+V DT++FVR I+TTEMNSATDNPLVF +   I+S GNFHGEYPAK LD+LAI + ELA MSERR ERLVN   SGLP FL  DGGLNSGFM   + AA+LVSENKVL HPSSVDS+ TS  QEDHVSMG F ARKAL VV +VE+VLA+ELLAA Q +EFL+PL ST PL  + +L+R+V  PL++DR+M P+I+ V+ ++R   +W  V P +E+ E
Sbjct:    1 MRLQVQIGTECVVVPCKPDDTIHAVAKKSVEKLRRLR--PKLPLADDYFEVRRTVGNSLLDPEDLVSDVLKDSDFIIVAASVEETEDAKEAKKQEEIDNARAEIEKIDNRRRKVSFADSLAPMVLAPPTKLLILDGNSLLPEDLVRCEKGECAIQLSMESEDRIRKARTFLEKIASEHRA--------------VYGVTTGFGTFSNVTIPPEKLKKLQLNLIRSHATGYGEPLAPNRARMLLALRINILAKGHSGISVENIKKMIAAFNAFCVSYVPQQGTVGCSGDLCPLAHLALGLLGEGKMWSPTTGWQPADVVLKKNNLEPLELGPKEGLALINGTQMVTALGAYTLERAHNIARQADVIAALSLDVLKGTTRAYDPDIHRIRPHRGQNLSALRLRALLHSEANPSQIAESHRNCTKVQDAYTLRCVPQVHGVVHDTIEFVREIITTEMNSATDNPLVFADREEIISGGNFHGEYPAKALDFLAIAVAELAQMSERRLERLVNKELSGLPTFLTPDGGLNSGFMTVQLCAASLVSENKVLCHPSSVDSIPTSCNQEDHVSMGGFAARKALTVVEHVEAVLAMELLAACQGIEFLKPLISTAPLHKIYQLVRSVAPPLNEDRYMKPEIDAVLEMIRENRIWEAVLPHLETLE 640          
BLAST of Histidine ammonia-lyase vs. TrEMBL
Match: C3Z929 (Histidine ammonia-lyase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_209115 PE=3 SV=1)

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 393/656 (59.91%), Postives = 489/656 (74.54%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKNIEMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            M+I V+++++  TV CKDG   +E L +  + +Y K +     +  K     +RR +   LLDP+D IV VL   +++ + + G    + S  VP   T +    +E N   E  ++DG SLTP DL+ LGKG Y IKL+++ ++KV ++R L++ I+ ENK              V YGI TGFGKF+  +I  +K+ ELQE+LIRSHSAGVG P+  E+ RM+ ALRIN LAKGYSG++ ETL +++DAFN   +PWIP KG+VGASGDLAPL+HLA G++GEGR+WSPKTGW ++K  L A GL P+KL  KEGL LINGTQ IT +GAEAL RA  IARQAD++AAL+L+VLKGTTRAFD+ IH  RPH GQI+VARR R+LLH+  YPSEISESHRFC +VQDAYTLRCCPQVHGIV DT+DFVRGI+TTEMNSATDNP+VFP+   I+S GNFHGEYPAK LDYLAIG+HELA+MSERR ERL NP+ S LPAFLV++GGLNSGFM+AH TAAALVSENKVLTHPSSVDSL+TSA  EDHVSMG F ARKAL+VV +VE VLAIELLAA QA+EFLRPL +T PLE V  L+RNV  P DKDRFMSPDI+ V  +LR GEVW   +P+++ F    + +L + SPT++ L
Sbjct:    1 MKITVKILNETFTVPCKDGSQKIEWLAEETMRRYRKARSLPVGLAGKSPEFQVRRARGDGLLDPDDPIVDVLDDNDFVHVGITG--CGSGSALVP-AGTQSGLHYQEPN---EYLSLDGNSLTPADLMQLGKGLYKIKLTDNSLSKVKEARKLLENILTENK--------------VCYGINTGFGKFARTVIPGNKLVELQENLIRSHSAGVGPPLTPERTRMLFALRINVLAKGYSGVSFETLTRMIDAFNASCLPWIPEKGTVGASGDLAPLSHLAQGMLGEGRMWSPKTGWGEAKDVLEAHGLKPVKLGPKEGLALINGTQLITSLGAEALERAEGIARQADIVAALTLDVLKGTTRAFDSDIHAARPHKGQIEVARRFRSLLHSELYPSEISESHRFCDRVQDAYTLRCCPQVHGIVKDTIDFVRGIITTEMNSATDNPMVFPQRHEIISGGNFHGEYPAKALDYLAIGVHELASMSERRIERLCNPSLSELPAFLVEEGGLNSGFMIAHCTAAALVSENKVLTHPSSVDSLSTSAATEDHVSMGGFAARKALQVVEHVEQVLAIELLAACQAMEFLRPLHTTVPLEKVYDLVRNVADPWDKDRFMSPDIDAVTRLLREGEVWGAAKPYLDDFHEREVKELRMGSPTSSYL 636          
BLAST of Histidine ammonia-lyase vs. TrEMBL
Match: R7TAK1 (Par3_HAL_N_term domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167650 PE=3 SV=1)

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 378/653 (57.89%), Postives = 497/653 (76.11%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNI-EMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTT 1994
            M++ V++  +W  V CK  + ++ L + A+ +Y+K +  + ++ + + +  IR+T+  ALLD  D I SVL  ++++++ +  +  N K+G     Y   E  P +F    E  ++DG +LT +DL+ LGKG   IKLS++ +  VNK+R L++EI+A+NK              VVYGITTGFGKF++ +ID   + ELQE+LIRSHSAGVG+P+  E+ R +LALR+N LAKGYSGI+I  LE+ V AFN   +PWIP KG+VGASGDLAP++HLALG+MGEG++WSP++GW ++++ L + GL P+KL  KEGL LINGTQ I  +G EA+ RA NIA+QADV+AAL+LEVLKGTT AFD  IH+VRPH GQ +VA+R R+LLH++ +PSEIS+SHRFC +VQDAYT+RCCPQVHGIV DT++FVR IL TE+NSATDNP+VF +   I+S GNFHGEYPAK LDYLAIG+HELAN+SERRT+RL+NPAYS LPAFLVKDGGLNSGFM+AH TAAALVSENKVLTHPSSVDSLTTSAG EDHVSMG F ARKAL VV NVE V+AIELLAA QA+EFLRPLK+T PLE V +L+R V KP DKDR+M+PDI+ V  +L+ G++W V +  ++ F + ++ + + +SPT +
Sbjct:    1 MKLSVRVRGEWFAVPCKGTEHIKWLGEEALRRYHKLQPESTHVAKAESVFEIRKTRGGALLDSADSIKSVLNDDDFVSVVLLSDKSNPKTGPEEIPYV-PEQVPGKFVSPTEFISLDGNTLTCDDLMRLGKGELKIKLSKEAVDNVNKARRLLEEILADNK--------------VVYGITTGFGKFANTLIDKKDLVELQENLIRSHSAGVGTPLTPERTRRLLALRVNVLAKGYSGISIRVLEQYVAAFNASCLPWIPEKGTVGASGDLAPMSHLALGMMGEGKMWSPESGWAEARYVLESHGLEPIKLGPKEGLALINGTQLIAALGVEAVERADNIAKQADVVAALTLEVLKGTTNAFDVGIHDVRPHKGQGQVAKRFRSLLHSNIHPSEISQSHRFCHRVQDAYTMRCCPQVHGIVNDTVEFVRNILHTEINSATDNPMVFADKKEIISGGNFHGEYPAKALDYLAIGVHELANISERRTDRLMNPAYSELPAFLVKDGGLNSGFMIAHCTAAALVSENKVLTHPSSVDSLTTSAGTEDHVSMGGFSARKALTVVENVEQVVAIELLAACQAIEFLRPLKTTAPLEEVYKLVRTVAKPWDKDRYMAPDIDAVTKLLQEGKIWKVSKALMDDFHSKQVIETFPNSPTAS 638          
BLAST of Histidine ammonia-lyase vs. TrEMBL
Match: A0A210PYI6 (Histidine ammonia-lyase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11866 PE=3 SV=1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 383/653 (58.65%), Postives = 496/653 (75.96%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKE-FNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTT 1994
            M++ V++  DW  V CK  + V  L + ++ +Y K K    + E + +  +R+ K  A+LDP+D I  VL   +++T+ ++ +  +  +G    +Y   E  PKE   +++E+ ++DG SL+ +DLV LGKG Y+IKL+ +   KVNK+R L+++I++ NK              VVYGITTGFGKF++ II+ SK+ ELQE+LIRSH+AGVG P+  E+ RM+LALRIN LAKG+SGI+++TL+K + AFN   +P++P KG+VGASGDLAPL+HLALG+MGEG++WSPK+GW D+K+ L   GL P+KL  KEG+ LINGTQ I  +G+EA+ RA  IARQAD++AA +L+VLKGTTRAFD+ IHEVRPH GQIKVARRLR+LLH+  +PSEI+ SHRFC KVQDAYTLRCCPQVHGIV DT++FV+GILTTE+NSATDNP+VF +   I+S GNFHGEYPAK LDYLAIG+HELANMSERR ERLVNPAYS LPAFL  DGGLNSGFM+AH TAA+LVSENKVL HP+SVDSLTTSAG EDHVSMG F ARK L VV +VE VLAIELLAA QA+EFLRPLKST PLE V +L+R  + P DKDR+M+PDIE V  +L+  +VW   +P ++++ + +  +  V SPTT+
Sbjct:    1 MKLSVRVHGDWFAVPCKGSEKVNWLGEESLRRYYKSKCNTGHAE-ETVFEVRKAKGGAILDPDDSIRDVLDDSDFVTIVLESDMSSPATGPAEPVYWE-EKIPKESVQVAKEVMSLDGNSLSTDDLVRLGKGYYSIKLTVESEQKVNKARKLLEDIISSNK--------------VVYGITTGFGKFANTIIERSKLIELQENLIRSHAAGVGPPLTPERTRMVLALRINVLAKGFSGISMDTLQKYIAAFNASCLPFVPEKGTVGASGDLAPLSHLALGMMGEGKMWSPKSGWADAKYVLEFNGLEPVKLGPKEGIALINGTQLIAGLGSEAVERAEAIARQADIVAAFTLDVLKGTTRAFDSNIHEVRPHKGQIKVARRLRSLLHSETHPSEIAASHRFCDKVQDAYTLRCCPQVHGIVNDTIEFVKGILTTEINSATDNPMVFADIEEIISGGNFHGEYPAKALDYLAIGVHELANMSERRIERLVNPAYSELPAFLTPDGGLNSGFMIAHCTAASLVSENKVLCHPASVDSLTTSAGTEDHVSMGGFAARKCLRVVEHVEQVLAIELLAACQAIEFLRPLKSTPPLEEVYKLVRTKVGPWDKDRYMTPDIESVTKMLQEEQVWRKAKPMMDNYHSLQSIETRVFSPTTS 637          
BLAST of Histidine ammonia-lyase vs. TrEMBL
Match: A0A4D5RK89 (Histidine ammonia-lyase (Fragment) OS=Ixodes scapularis OX=6945 PE=3 SV=1)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 384/657 (58.45%), Postives = 496/657 (75.49%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDG-DSVENLVDSAIVKYNKFKKPAKNIEMKD--ITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            M++ V++  +W+ V C+DG  +V+ L + A+ +Y K + P+  ++ +   I  IR+T+  A+LD ED+I +VL   E++++ +D +  +   G     Y   E  P +F    +I TIDG +LTPEDL+ L KG Y I+LS D + +V K+R +++ I+ ENK              V YG+ TGFGKF+ V+I    + ELQE+L+RSHSAGVG+P+  E+ RM+LALRIN LAKGYSGI+ ETL +LVDAFN   + W+P +G+VGASGDLAPLAHLALGL+GEG++WSP+TGW D+K+ L +  LTP+KLK KEGLCL+NGTQ IT IGAEA+ RA+ ++RQADV+AAL+LEVLKGTTRAF++ I ++RPH GQ  VA+RLRALLH+  + SEI+ESHRFC++VQDAYTLRCCPQVHGIV DT+DFVRGI+TTEMNSATDNPLVF E G I+S GNFHGEYPAK LDYLAI +HEL +MSERRTERL+NPAYS LPAFLV+DGGLNSGFMLAH TAAALVSENKVL HP+SVDS+ TSAG EDHVSMG F ARKAL VV NVE V+AIELL A QA+EFLRPLK+T PLEAV +L+R  +K  DKDR M+PDI+    +L+   +W+ V+P ++ +   +  +  + SPTT+ +
Sbjct:    1 MKVSVRIRGEWLAVPCRDGRQTVQWLGEEALRRYIKLQ-PSSYLDGRSEKIFEIRKTRGGAILDGEDVIKNVLDDNEFVSVVLDTDRPSPVLGPAEITYI-PEQVPGKFKAPSQIMTIDGNNLTPEDLLELSKGKYRIQLSSDSLDRVKKAREMLEAILKENK--------------VAYGLNTGFGKFARVVIPDHSLLELQENLVRSHSAGVGNPLTPEKTRMLLALRINVLAKGYSGISTETLLQLVDAFNASCLSWVPEQGTVGASGDLAPLAHLALGLIGEGKMWSPETGWGDAKYVLESHKLTPIKLKPKEGLCLLNGTQLITSIGAEAVERATILSRQADVVAALTLEVLKGTTRAFESDIQKIRPHWGQGMVAKRLRALLHSETFRSEIAESHRFCNRVQDAYTLRCCPQVHGIVHDTIDFVRGIITTEMNSATDNPLVFCERGEIISGGNFHGEYPAKALDYLAIAVHELGSMSERRTERLINPAYSELPAFLVQDGGLNSGFMLAHCTAAALVSENKVLCHPASVDSVPTSAGTEDHVSMGGFAARKALSVVQNVERVIAIELLCACQAIEFLRPLKTTAPLEAVYKLVRMFVKCWDKDRVMAPDIDAATDLLKQSRIWDTVKPHMDHYFLVQEEETRMPSPTTSEI 641          
BLAST of Histidine ammonia-lyase vs. TrEMBL
Match: A0A4Y2HJQ4 (Histidine ammonia-lyase OS=Araneus ventricosus OX=182803 GN=Hal PE=3 SV=1)

HSP 1 Score: 776.548 bits (2004), Expect = 0.000e+0
Identity = 370/640 (57.81%), Postives = 490/640 (76.56%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSC-KDGDSVENLVDSAIVKYNKFKKPAKNIEMKD--ITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFE 1949
            M++ V++  +W  V C +   ++  + + A+ KY K +  + ++  ++  I  IR+TK  A+LDP+D +  VL   +++++ ++ +  N  + A   ++   E  P +F I  E +T+DG +L P+DL+ LGKG Y IKLS++   ++N+SR +++ I+ ENK              V YG+ TGFGKF+  +I   K+ ELQE+LIRSHSAGVG+P++ E+ RM++ALRIN LAKG+SGI++ETL ++++AFN   +PW+P KG+VGASGDLAPLAHLALGL+GEG++WSP++GW ++K+ L +  L P+ L  KEG+ L+NGTQ IT IGAEA+ RA  IA+QADV+AALSLEVLKGTTRAFD  I +VRPH GQ +VA RLR+LLH+  +PSE++ESHRFC++VQDAYTLRCCPQVHGIV DT++FVR I+TTEMNSATDNPLVF E   I+S GNFHGEYPAK LDYLAIG+HEL +MSERRTERL+NPA SGLPAFLVKDGGLNSG M+ H TAAALVSENKVL HP+SVDSL TSAG EDHVSMG F ARKAL VV NVE V+AIELLAA QA+EFLRPLK+T+PLEAV  ++R+V+KPLDKDRF++PDI+ +  +LR G++W+ V P +E ++
Sbjct:    1 MKVSVRVRGEWFAVPCTRSSTTIRFVGEEALRKYQKLRPQSSHVSGREEKIYQIRKTKGGAILDPDDQVNHVLDDNDFVSVVLETDKPNPVT-APAEIHYVPEQVPGKFKIPSEYFTLDGYNLIPDDLLKLGKGMYKIKLSQESQARINRSREMLERILKENK--------------VAYGVNTGFGKFATTVISEEKIIELQENLIRSHSAGVGTPLSPEKTRMLMALRINVLAKGFSGISLETLNRVINAFNASCLPWVPEKGTVGASGDLAPLAHLALGLIGEGKMWSPESGWGEAKYVLESHNLKPISLGAKEGIALLNGTQLITSIGAEAVQRAEIIAKQADVVAALSLEVLKGTTRAFDGDIQKVRPHRGQSRVAYRLRSLLHSDTHPSEMAESHRFCNRVQDAYTLRCCPQVHGIVHDTIEFVRDIITTEMNSATDNPLVFVEREEIISGGNFHGEYPAKALDYLAIGVHELGSMSERRTERLINPALSGLPAFLVKDGGLNSGLMIPHCTAAALVSENKVLCHPASVDSLPTSAGTEDHVSMGGFAARKALTVVENVERVIAIELLAATQAIEFLRPLKTTQPLEAVYSVVRSVVKPLDKDRFIAPDIDAITELLRDGKIWDAVFPHMERYK 625          
BLAST of Histidine ammonia-lyase vs. Ensembl Cavefish
Match: hal (histidine ammonia-lyase-like [Source:NCBI gene;Acc:103041200])

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 381/656 (58.08%), Postives = 479/656 (73.02%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGDSVENLVD-SAIVKYNKFKKPAKNI-EMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            R  V +  +W+TV CKD     N +   A+ +Y K K     I + K++  A RR +   LLD +D+I  VL   +++ L+++G+ ++  S  +P+         + +    E   +DG SL+  DLV LG+  Y IKL+ +   KV +SR L+D IV E K              VVYGITTGFGKF+  +I ISK++ELQE+LIRSHSAG+G P++ E+ RM+LALRIN LAKGYSGI++ETL  ++ AFN   + ++P KG+VGASGDLAPLAHLALGLMGEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +GAEA+ RA +IA QADVIAAL+LEVLKGTT+AFD+ IHE+RPH GQ +VA R RALL +  +PSEI+ESHRFC +VQDAYT+RCCPQVHG+V DT+ FVR I+ TE+NSATDNP+VF E G  +S GNFHGEYPAK LDYLAIG+HELA++SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENKVL HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRP+++T PLE V  L+R+V+KP  KDRFMS DIE V  +L   +VWNV +P+IE + T  LP+   SSPT  SL
Sbjct:    3 RFTVHVRDEWLTVPCKDTSYTINWLGVEALKRYVKNKPDNGGIPQAKEVRFAARRCQGQGLLDADDIIEDVLEDNDFVELEIEGDTMS--SDFIPS-QPGMSYLTRPYREPSEYIFLDGSSLSSTDLVNLGRCRYKIKLTPEAEKKVEQSRELLDTIVKEKK--------------VVYGITTGFGKFARTVIPISKLKELQENLIRSHSAGLGRPLSPERTRMLLALRINVLAKGYSGISLETLHNMIQAFNASCLSYVPEKGTVGASGDLAPLAHLALGLMGEGKMWSPKSGWADAKYVLEAHGLKPVSLKPKEGLALINGTQMITSLGAEAVERAESIAMQADVIAALTLEVLKGTTKAFDSDIHELRPHPGQKEVALRFRALLDSDHHPSEIAESHRFCDRVQDAYTMRCCPQVHGVVNDTIAFVRNIINTEINSATDNPMVFSERGETISGGNFHGEYPAKALDYLAIGVHELASISERRIERLCNPSLSELPAFLVNEGGLNSGFMIAHCTAAALVSENKVLCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPVRTTTPLEKVYDLVRSVVKPWIKDRFMSADIEAVHRLLVDQKVWNVAKPYIEKYCTELLPESRPSSPTAFSL 641          
BLAST of Histidine ammonia-lyase vs. Ensembl Cavefish
Match: hal (histidine ammonia-lyase-like [Source:NCBI gene;Acc:103041200])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 365/656 (55.64%), Postives = 456/656 (69.51%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKDGDSVENLVD-SAIVKYNKFKKPAKNI-EMKDIT-AIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            R  V +  +W+TV CKD     N +   A+ +Y K K     I + K++  A RR +   LLD +D+I  VL   +++ L+++G+ ++                      S+ I +  G+S                               L+D IV E K              VVYGITTGFGKF+  +I ISK++ELQE+LIRSHSAG+G P++ E+ RM+LALRIN LAKGYSGI++ETL  ++ AFN   + ++P KG+VGASGDLAPLAHLALGLMGEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +GAEA+ RA +IA QADVIAAL+LEVLKGTT+AFD+ IHE+RPH GQ +VA R RALL +  +PSEI+ESHRFC +VQDAYT+RCCPQVHG+V DT+ FVR I+ TE+NSATDNP+VF E G  +S GNFHGEYPAK LDYLAIG+HELA++SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAAALVSENKVL HPSSVDSL+TSA  EDHVSMG + ARKAL V+ +VE VLAIELLAA Q +EFLRP+++T PLE V  L+R+V+KP  KDRFMS DIE V  +L   +VWNV +P+IE + T  LP+   SSPT  SL
Sbjct:    3 RFTVHVRDEWLTVPCKDTSYTINWLGVEALKRYVKNKPDNGGIPQAKEVRFAARRCQGQGLLDADDIIEDVLEDNDFVELEIEGDTMS----------------------SDFIPSQPGMSYL----------------------------ELLDTIVKEKK--------------VVYGITTGFGKFARTVIPISKLKELQENLIRSHSAGLGRPLSPERTRMLLALRINVLAKGYSGISLETLHNMIQAFNASCLSYVPEKGTVGASGDLAPLAHLALGLMGEGKMWSPKSGWADAKYVLEAHGLKPVSLKPKEGLALINGTQMITSLGAEAVERAESIAMQADVIAALTLEVLKGTTKAFDSDIHELRPHPGQKEVALRFRALLDSDHHPSEIAESHRFCDRVQDAYTMRCCPQVHGVVNDTIAFVRNIINTEINSATDNPMVFSERGETISGGNFHGEYPAKALDYLAIGVHELASISERRIERLCNPSLSELPAFLVNEGGLNSGFMIAHCTAAALVSENKVLCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPVRTTTPLEKVYDLVRSVVKPWIKDRFMSADIEAVHRLLVDQKVWNVAKPYIEKYCTELLPESRPSSPTAFSL 594          
BLAST of Histidine ammonia-lyase vs. Ensembl Cavefish
Match: ENSAMXT00000010519.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:40506713:40520194:-1 gene:ENSAMXG00000010242.2 transcript:ENSAMXT00000010519.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 324/621 (52.17%), Postives = 413/621 (66.51%), Query Frame = 3
Query:  150 KPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNI----SEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            +P + +  ++   IR   +  LLD E+ I S L   + I L + G+          +L    + +P    +    S+ IY +DG SLT  DL +LGKG   IK+                                      VYG+ TGFGKF+  ++     R+ Q              +N E+ RM+LALRINTLAKG+SG+++ETL+K+V AFN   + W+P KG+VGASGDL+PLAHLALGLMGEGR+WSP TGWT+S   L A GLTP+ LK KEG+ LINGTQ ++ +GAEA+ RA  +ARQADVIAAL+LEVL+GT +AFD  +H VRPH GQ  VA+  R+LLH+  +PSEI+E   +  +VQDAYTLRCCPQVHG+ +DT+ FV+ IL TE+NS TDNPLVF E G+ +S GNFHGEYPAK LD+L+IG+HELA++SERR ERL NP+ S LPAFLVKDGGLNSGFM+AH TAAALVSENK L HP+SVDS++TSA  EDHVSMG + ARKAL VV +VE VLAIELLAA QALEF RPL++T PLE V  L+R+V++P DKDR MS DIE    +L   +VW  V  +I+ ++    P L  S P+ T+L
Sbjct:   42 RPGEGLSSEEEFVIRSRADGRLLDLEESISSALDDGDSIELYIHGDTWKQSDSL--SLSGSAKMYPSSLLLCCFFSQYIY-LDGNSLTTVDLFSLGKGLIKIKV-------------------------------------FVYGVNTGFGKFAGTVV-----RKDQ--------------LNPERTRMLLALRINTLAKGHSGVSLETLQKMVAAFNESCLSWVPEKGTVGASGDLSPLAHLALGLMGEGRMWSPLTGWTESSTVLEAHGLTPISLKPKEGIALINGTQMMSALGAEAVERAEAVARQADVIAALTLEVLRGTNKAFDKDVHAVRPHPGQTVVAQHFRSLLHSDIFPSEIAEDKPY-DRVQDAYTLRCCPQVHGVAVDTIAFVKKILNTELNSGTDNPLVFAERGVTLSGGNFHGEYPAKALDFLSIGVHELASISERRIERLCNPSLSELPAFLVKDGGLNSGFMVAHCTAAALVSENKALCHPASVDSISTSAATEDHVSMGGWAARKALRVVEHVEQVLAIELLAACQALEFHRPLRTTAPLEKVYELLRSVVRPWDKDRVMSSDIEAAHKLLLDEKVWEAVWSYIKKYKKTPSPHL-SSIPSNTTL 601          
BLAST of Histidine ammonia-lyase vs. Ensembl Nematostella
Match: EDO46864 (Histidine ammonia-lyase [Source:UniProtKB/TrEMBL;Acc:A7RNI1])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 367/661 (55.52%), Postives = 499/661 (75.49%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKD--GDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISE-EIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLM-GEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESF---ETYRLPDLWVSSPTTTSL 2000
            MR+ V++  +W+ V C++   +S+++LVD  +++     KP  +    +   +R  +++ LL P D++  VL   ++I L  +GN  ++    VP + + +    ++ +  + +   +DG +L+ + LV LGKG   IKL+E+   ++NK+R+L+DEIV EN+              V YG+TTGFGKF+ V+I   K+++LQ++L+RSH+ GVG+P+ +E+ RM+LALRIN LAKGYSGI++ETL++ ++A+N  ++P +P +G+VGASGDLAPLAHLALG+M GEG++WSPK+GW D+K  L A  + P++L  KEG+ LINGTQ IT +GAEAL R+  IARQA++IAA+S+EVLKG++RAFD  +H VRPH GQ+KVA  LRA+LH+  +PSEI+ESHRFC++VQDAYTLRCCPQVHGIV DT++FVRGILTTE+NSATDNP+VF +   I+S GNFHGEYPAK LDYLAIG+HELA+MSERR ERL+NPAYSGLPAFLVK+GGLNSGFM+AH T+AALVSENKVL HPSSVDSL+TSAGQEDHVSMG F ARKAL VV NVE  LAIELLAA Q +EFLRPLK+TEPLEA+ +L+R+ ++PL+ DRFM+PDI+ V  +LR  + W VV PF+  +   +T    +    SPT+++L
Sbjct:    1 MRVNVRIEGEWIVVPCEEDNNNSIQSLVDKCLLRRKSISKPFDS--NSESFEVRLAESTGLLSPTDIVRDVLKDNDFIWLGKEGNGSSHAYLLVPTISSSSVLQNEQLDACKCKFVALDGETLSTDVLVKLGKGGLKIKLTEESEKRINKARALLDEIVRENR--------------VSYGVTTGFGKFAQVVISKDKLQDLQQNLVRSHAVGVGNPLTLERTRMLLALRINVLAKGYSGISLETLQQYIEAYNKSLLPRVPEQGTVGASGDLAPLAHLALGIMLGEGQMWSPKSGWADAKLVLEAHDMKPVELGPKEGIALINGTQLITALGAEALERSFAIARQANIIAAMSVEVLKGSSRAFDFDVHRVRPHKGQVKVAETLRAVLHSDIHPSEIAESHRFCNRVQDAYTLRCCPQVHGIVFDTIEFVRGILTTEINSATDNPIVFVDREEIISGGNFHGEYPAKALDYLAIGVHELASMSERRLERLMNPAYSGLPAFLVKNGGLNSGFMMAHCTSAALVSENKVLCHPSSVDSLSTSAGQEDHVSMGGFSARKALLVVENVERALAIELLAACQGIEFLRPLKTTEPLEALHKLVRSRVEPLETDRFMAPDIDAVTQLLREEKAWEVVAPFVRDYRIKQTNGQMEDGRYSPTSSTL 645          
BLAST of Histidine ammonia-lyase vs. Ensembl Medaka
Match: hal (histidine ammonia-lyase [Source:NCBI gene;Acc:101164474])

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 367/662 (55.44%), Postives = 476/662 (71.90%), Query Frame = 3
Query:   42 RIYVQLVSDWMTVSCKD-GDSVENLVDSAIVKYNKFKKPAKNIEMKDITA--IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISE------EIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSL 2000
            R  V +  +W+ V C++   +V  L   A+ +Y K K     I     T   +RR +   LLD +D I  VL   +++ L +DG+ ++      P+      C P   N++       +  ++DG SLT  DLV LG+G Y IKL+ +   KV +SR L+D IV ENK              VVYGITTGFGKF+  +I +SK++ELQE+L+RSHSAG+G+P++ E+ RM+LALRIN LAKGYSG+++ETL  ++ AFN   + ++P KG+VGASGDLAPL+HLALGLMGEG++WSPK+GW D+K+ L A GL P+ LK KEGL LINGTQ IT +GAEA+ RA  IA+QAD++AAL+LEVLKGTT+AFD+ IH +RPH GQ++VA+R R+LL +  +PS+++ESHRFC +VQDAYT+RCCPQVHGI  DT++FV+ I+ TE+NSATDNP+VF E G  +S GNFHGEYPAK LD+LAI +HELA++SERR ERL NP+ S LPAFLV +GGLNSGFM+AH TAA+LVSENKVL HPSSVDSL+TSA  EDHVSMG + ARKAL VV +VE VLAIELLAA Q +EFLRPL +T PLE V  L+R V KP  KDRFMS DIE V  +L   +VW V +P+I+ +++  +P+   SSPT  SL
Sbjct:    3 RFTVHIRDEWLAVPCRETSRTVGWLGQEALKRYIKNKPDNGGITSVKETRFIVRRCQGLGLLDVDDAIEDVLEDNDFVELAIDGDTMS------PDFIP---CAPGVSNLTAAYKEPGDFISLDGNSLTSTDLVNLGRGLYKIKLTPEAERKVVQSRELLDTIVKENK--------------VVYGITTGFGKFARTVIPVSKLKELQENLVRSHSAGLGNPLSPERTRMLLALRINVLAKGYSGVSLETLHAMIQAFNASCLSFVPEKGTVGASGDLAPLSHLALGLMGEGKMWSPKSGWADAKYVLEAHGLKPITLKPKEGLALINGTQMITSLGAEAVERAEAIAQQADIVAALTLEVLKGTTKAFDSDIHLLRPHPGQVEVAQRFRSLLDSDHHPSQLAESHRFCDRVQDAYTMRCCPQVHGIANDTINFVKNIINTEINSATDNPMVFAERGETISGGNFHGEYPAKALDFLAIAVHELASISERRIERLCNPSLSELPAFLVNEGGLNSGFMIAHCTAASLVSENKVLCHPSSVDSLSTSAATEDHVSMGGWAARKALRVVEHVEQVLAIELLAACQGIEFLRPLCTTTPLEKVYELVRTVAKPWIKDRFMSADIEAVQRLLLDQKVWGVAKPYIDKYKSEYIPESRPSSPTAFSL 641          
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Match: SMESG000002694.1 (SMESG000002694.1)

HSP 1 Score: 1350.88 bits (3495), Expect = 0.000e+0
Identity = 686/703 (97.58%), Postives = 686/703 (97.58%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS-----------------ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVXXXXXXXXXXXXXXXXXXXXRSVTSE 2096
            MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS                 ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE
Sbjct:    1 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISGRFFITQNSLTKNVLIEESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE 703          
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Match: SMESG000002694.1 (SMESG000002694.1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 675/692 (97.54%), Postives = 675/692 (97.54%), Query Frame = 3
Query:   72 MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS-----------------ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVXXXXXXXXXXXXXXXXXXXXRSVTSE 2096
            MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS                 ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE
Sbjct:    1 MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISGRFFITQNSLTKNVLIEESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE 692          
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Match: SMESG000002559.1 (SMESG000002559.1)

HSP 1 Score: 1314.67 bits (3401), Expect = 0.000e+0
Identity = 662/703 (94.17%), Postives = 674/703 (95.87%), Query Frame = 3
Query:   39 MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS-----------------ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVXXXXXXXXXXXXXXXXXXXXRSVTSE 2096
            MRIYVQLVSDWMTVSCKDGDS+ENLVDSAIVKYNKFKK AKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYT TECFPKEF ISEEIYTIDGVSLTPEDL+ALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQES++RS SAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGW DSKHAL ACGLTPLKL TKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS                 ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAK+LDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVE VLAIELLAA+QALE LRPLKSTEPLEAVARL+RNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIES+E+++LPDLWVSSPTTTSLKRV NVSGG+KRKASVS SSSYIK KRSVTSE
Sbjct:    1 MRIYVQLVSDWMTVSCKDGDSIENLVDSAIVKYNKFKKLAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTDTECFPKEFKISEEIYTIDGVSLTPEDLMALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESVVRSSSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWIDSKHALDACGLTPLKLNTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISGRFFITQNSLTKNVLIEESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKILDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVEYVLAIELLAAIQALELLRPLKSTEPLEAVARLVRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESYESFKLPDLWVSSPTTTSLKRVFNVSGGEKRKASVSGSSSYIKSKRSVTSE 703          
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Match: SMESG000002559.1 (SMESG000002559.1)

HSP 1 Score: 1291.56 bits (3341), Expect = 0.000e+0
Identity = 651/692 (94.08%), Postives = 663/692 (95.81%), Query Frame = 3
Query:   72 MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS-----------------ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVXXXXXXXXXXXXXXXXXXXXRSVTSE 2096
            MTVSCKDGDS+ENLVDSAIVKYNKFKK AKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYT TECFPKEF ISEEIYTIDGVSLTPEDL+ALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQES++RS SAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGW DSKHAL ACGLTPLKL TKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS                 ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAK+LDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVE VLAIELLAA+QALE LRPLKSTEPLEAVARL+RNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIES+E+++LPDLWVSSPTTTSLKRV NVSGG+KRKASVS SSSYIK KRSVTSE
Sbjct:    1 MTVSCKDGDSIENLVDSAIVKYNKFKKLAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTDTECFPKEFKISEEIYTIDGVSLTPEDLMALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESVVRSSSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWIDSKHALDACGLTPLKLNTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISGRFFITQNSLTKNVLIEESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKILDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVEYVLAIELLAAIQALELLRPLKSTEPLEAVARLVRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESYESFKLPDLWVSSPTTTSLKRVFNVSGGEKRKASVSGSSSYIKSKRSVTSE 692          
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Match: SMESG000002694.1 (SMESG000002694.1)

HSP 1 Score: 1288.09 bits (3332), Expect = 0.000e+0
Identity = 660/692 (95.38%), Postives = 660/692 (95.38%), Query Frame = 3
Query:   72 MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAFNVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS-----------------ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVXXXXXXXXXXXXXXXXXXXXRSVTSE 2096
            MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYS               VGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEIS                 ESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE
Sbjct:    1 MTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITAIRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTECFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRSLVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYS---------------VGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHALAACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALSLEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISGRFFITQNSLTKNVLIEESHRFCSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGMIVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLVKDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAFGARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVIKPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPTTTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE 677          
The following BLAST results are available for this feature:
BLAST of Histidine ammonia-lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HAL0.000e+056.16histidine ammonia-lyase [Source:HGNC Symbol;Acc:HG... [more]
HAL0.000e+057.38histidine ammonia-lyase [Source:HGNC Symbol;Acc:HG... [more]
HAL0.000e+066.82histidine ammonia-lyase [Source:HGNC Symbol;Acc:HG... [more]
HAL1.626e-8844.63histidine ammonia-lyase [Source:HGNC Symbol;Acc:HG... [more]
HAL7.065e-5871.97histidine ammonia-lyase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
haly-10.000e+051.37Histidine ammonia-lyase [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hal0.000e+057.16histidine ammonia-lyase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps26c0.000e+056.30VPS26 endosomal protein sorting factor C [Source:X... [more]
vps26c0.000e+056.43VPS26 endosomal protein sorting factor C [Source:X... [more]
vps26c0.000e+055.00VPS26 endosomal protein sorting factor C [Source:X... [more]
vps26c0.000e+054.59VPS26 endosomal protein sorting factor C [Source:X... [more]
vps26c0.000e+054.29VPS26 endosomal protein sorting factor C [Source:X... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hal0.000e+056.01histidine ammonia lyase [Source:MGI Symbol;Acc:MGI... [more]
Hal1.595e-1231.29histidine ammonia lyase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Histidine ammonia-lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7YWP4|HUTH_BOVIN0.000e+056.16Histidine ammonia-lyase OS=Bos taurus OX=9913 GN=H... [more]
sp|P42357|HUTH_HUMAN0.000e+056.16Histidine ammonia-lyase OS=Homo sapiens OX=9606 GN... [more]
sp|P21213|HUTH_RAT0.000e+056.01Histidine ammonia-lyase OS=Rattus norvegicus OX=10... [more]
sp|P35492|HUTH_MOUSE0.000e+056.01Histidine ammonia-lyase OS=Mus musculus OX=10090 G... [more]
sp|Q20502|HUTH1_CAEEL0.000e+051.37Histidine ammonia-lyase OS=Caenorhabditis elegans ... [more]
back to top
BLAST of Histidine ammonia-lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Z9290.000e+059.91Histidine ammonia-lyase OS=Branchiostoma floridae ... [more]
R7TAK10.000e+057.89Par3_HAL_N_term domain-containing protein OS=Capit... [more]
A0A210PYI60.000e+058.65Histidine ammonia-lyase OS=Mizuhopecten yessoensis... [more]
A0A4D5RK890.000e+058.45Histidine ammonia-lyase (Fragment) OS=Ixodes scapu... [more]
A0A4Y2HJQ40.000e+057.81Histidine ammonia-lyase OS=Araneus ventricosus OX=... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hal0.000e+058.08histidine ammonia-lyase-like [Source:NCBI gene;Acc... [more]
hal0.000e+055.64histidine ammonia-lyase-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000010519.20.000e+052.17pep primary_assembly:Astyanax_mexicanus-2.0:7:4050... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO468640.000e+055.52Histidine ammonia-lyase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hal0.000e+055.44histidine ammonia-lyase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Histidine ammonia-lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002694.10.000e+097.58SMESG000002694.1[more]
SMESG000002694.10.000e+097.54SMESG000002694.1[more]
SMESG000002559.10.000e+094.17SMESG000002559.1[more]
SMESG000002559.10.000e+094.08SMESG000002559.1[more]
SMESG000002694.10.000e+095.38SMESG000002694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002513 ID=SMED30002513|Name=Histidine ammonia-lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=2137bp
CAATTTTAGTAAATAGATTTGATAAAAAAAACTGAAAAATGAGAATTTAC
GTCCAGTTAGTGAGTGATTGGATGACAGTTTCTTGCAAAGATGGAGATTC
CGTCGAGAATTTGGTGGATTCGGCGATTGTCAAATACAATAAGTTCAAGA
AACCGGCAAAGAATATCGAAATGAAAGACATTACAGCTATTCGGAGAACT
AAAAATTCAGCATTACTAGACCCAGAAGACCTAATTGTGTCAGTTTTGGT
CCCCGAGGAATATATTACATTAGATGTTGATGGAAACAATCTAAATAACA
AATCTGGAGCTGTTCCAAATCTCTACACTCACACCGAATGCTTTCCGAAA
GAGTTTAACATATCTGAAGAAATTTATACTATCGATGGAGTGTCTTTAAC
CCCAGAGGATTTGGTGGCACTAGGCAAGGGGTGTTACACCATTAAGCTGT
CCGAAGATTGTATAACGAAAGTAAATAAGAGTCGTTCCTTGGTTGATGAG
ATCGTTGCAGAAAATAAAGGCAAGAATTTTATGAAATTTTGTAAAATTTT
CATTATTCTAGTTGTATATGGAATCACTACGGGATTCGGGAAATTTTCTG
ATGTGATAATTGATATTTCTAAAATGAGAGAATTGCAAGAATCTCTAATT
CGATCCCATTCAGCTGGTGTTGGGAGCCCGATGAATGTTGAACAAGCCAG
GATGATGCTCGCCTTGAGGATAAATACATTGGCAAAAGGGTACAGTGGTA
TCACCATTGAAACCCTTGAGAAGTTGGTCGATGCATTCAATGTTGGTATT
GTACCATGGATTCCTCTTAAAGGCAGCGTTGGAGCATCTGGAGACCTGGC
TCCATTGGCCCATCTTGCACTTGGATTGATGGGAGAAGGAAGAGTTTGGA
GTCCTAAAACAGGATGGACAGATTCAAAACATGCCTTGGCTGCTTGTGGA
CTCACTCCATTGAAACTTAAAACTAAAGAAGGTCTATGTCTAATAAACGG
TACTCAATTCATTACATGTATTGGTGCAGAAGCTTTGGCTCGAGCTTCAA
ATATTGCTCGACAAGCCGATGTTATTGCAGCCTTAAGTTTGGAAGTTCTT
AAAGGAACTACGAGAGCTTTTGATACAGCGATTCATGAAGTCCGACCTCA
CTCTGGTCAAATTAAAGTGGCCCGTCGACTGAGAGCATTGCTTCACAATA
GTAAATATCCATCAGAAATTTCTGAAAGCCACAGATTTTGTAGTAAAGTT
CAGGATGCTTATACCTTGCGGTGTTGTCCCCAGGTTCACGGAATTGTCCT
CGATACGCTGGATTTTGTCAGAGGAATCCTCACAACGGAAATGAACAGCG
CAACAGATAATCCTTTGGTATTTCCTGAAAGTGGAATGATAGTTTCGGCC
GGCAATTTCCACGGTGAATATCCGGCTAAGGTTCTTGATTACCTCGCTAT
CGGTATCCATGAATTAGCAAATATGTCAGAAAGAAGAACGGAAAGATTAG
TAAACCCAGCTTACAGTGGTTTACCCGCATTTCTCGTGAAAGACGGTGGG
TTGAATTCTGGATTCATGTTGGCACATGTAACGGCCGCAGCACTAGTATC
AGAAAATAAAGTTCTTACTCATCCTTCAAGTGTAGATTCGTTAACAACAA
GTGCTGGGCAAGAGGATCATGTCAGTATGGGAGCTTTTGGTGCCCGTAAA
GCATTGGAAGTCGTGTCTAATGTAGAAAGCGTACTGGCCATAGAATTACT
TGCAGCCGTTCAAGCTTTGGAGTTTTTAAGACCGCTGAAGTCAACGGAAC
CTTTAGAAGCAGTTGCAAGATTAATTAGAAACGTCATAAAGCCTTTGGAT
AAAGACAGATTTATGTCACCAGATATTGAGCTGGTTGTGAGTATCTTAAG
ATCTGGAGAAGTATGGAATGTCGTAGAGCCGTTTATTGAGAGTTTTGAGA
CTTACAGATTACCAGATTTGTGGGTATCTAGTCCAACGACAACATCTTTG
AAAAGAGTGATTAATGTTAGTGGAGGGAAAAAAAGAAAAGCATCTGTATC
AAAATCTTCAAGTTATATAAAGCCAAAACGATCCGTTACGTCAGAATGAA
GGAATTACTAGTTTTATATATTTAATATTTTCCGTGG
back to top

protein sequence of SMED30002513-orf-1

>SMED30002513-orf-1 ID=SMED30002513-orf-1|Name=SMED30002513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=687bp
MRIYVQLVSDWMTVSCKDGDSVENLVDSAIVKYNKFKKPAKNIEMKDITA
IRRTKNSALLDPEDLIVSVLVPEEYITLDVDGNNLNNKSGAVPNLYTHTE
CFPKEFNISEEIYTIDGVSLTPEDLVALGKGCYTIKLSEDCITKVNKSRS
LVDEIVAENKGKNFMKFCKIFIILVVYGITTGFGKFSDVIIDISKMRELQ
ESLIRSHSAGVGSPMNVEQARMMLALRINTLAKGYSGITIETLEKLVDAF
NVGIVPWIPLKGSVGASGDLAPLAHLALGLMGEGRVWSPKTGWTDSKHAL
AACGLTPLKLKTKEGLCLINGTQFITCIGAEALARASNIARQADVIAALS
LEVLKGTTRAFDTAIHEVRPHSGQIKVARRLRALLHNSKYPSEISESHRF
CSKVQDAYTLRCCPQVHGIVLDTLDFVRGILTTEMNSATDNPLVFPESGM
IVSAGNFHGEYPAKVLDYLAIGIHELANMSERRTERLVNPAYSGLPAFLV
KDGGLNSGFMLAHVTAAALVSENKVLTHPSSVDSLTTSAGQEDHVSMGAF
GARKALEVVSNVESVLAIELLAAVQALEFLRPLKSTEPLEAVARLIRNVI
KPLDKDRFMSPDIELVVSILRSGEVWNVVEPFIESFETYRLPDLWVSSPT
TTSLKRVINVSGGKKRKASVSKSSSYIKPKRSVTSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR021922Par3/HAL_N
IPR005921HutH
IPR001106Aromatic_Lyase
IPR024083Fumarase/histidase_N
IPR022313Phe/His_NH3-lyase_AS
IPR008948L-Aspartase-like
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0016841ammonia-lyase activity
GO:0003824catalytic activity
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0004397histidine ammonia-lyase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006547histidine metabolic process
GO:0006548histidine catabolic process
GO:0019556histidine catabolic process to glutamate and formamide
GO:0019557histidine catabolic process to glutamate and formate
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021922Par3/HAL, N-terminalPFAMPF12053Par3_HAL_N_termcoord: 1..70
e-value: 6.4E-5
score: 23.1
IPR005921Histidine ammonia-lyaseTIGRFAMTIGR01225TIGR01225coord: 114..629
e-value: 8.2E-208
score: 688.9
IPR024083Fumarase/histidase, N-terminalGENE3DG3DSA:1.10.275.10coord: 106..321
e-value: 3.1E-57
score: 195.5
IPR001106Aromatic amino acid lyasePFAMPF00221Lyase_aromaticcoord: 120..597
e-value: 2.6E-185
score: 616.5
IPR001106Aromatic amino acid lyasePANTHERPTHR10362HISTIDINE AMMONIA-LYASEcoord: 112..627
IPR001106Aromatic amino acid lyaseCDDcd00332PAL-HALcoord: 119..580
e-value: 0.0
score: 668.836
NoneNo IPR availableGENE3DG3DSA:1.20.200.10coord: 322..634
e-value: 2.9E-121
score: 406.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..686
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 666..686
NoneNo IPR availablePANTHERPTHR10362:SF7HISTIDINE AMMONIA-LYASEcoord: 112..627
IPR022313Phenylalanine/histidine ammonia-lyases, active sitePROSITEPS00488PAL_HISTIDASEcoord: 262..278
IPR008948L-Aspartase-likeSUPERFAMILYSSF48557L-aspartase-likecoord: 105..633