Ethanolamine-phosphate cytidylyltransferase

Overview
NameEthanolamine-phosphate cytidylyltransferase
Smed IDSMED30002505
Length (bp)1238
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ethanolamine-phosphate cytidylyltransferase (SMED30002505) t-SNE clustered cells

Violin plots show distribution of expression levels for Ethanolamine-phosphate cytidylyltransferase (SMED30002505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ethanolamine-phosphate cytidylyltransferase (SMED30002505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ethanolamine-phosphate cytidylyltransferase (SMED30002505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002505h1SMcG0005923 Contig4909GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002505h1SMcG0020742 Contig4909GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30002505h1SMcG0020742 Contig51201uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002505h1SMcG0020742 Contig51201newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30002505h1SMcG0020742 dd_Smed_v4_3373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002505h1SMcG0020742 dd_Smed_v4_3373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002505h1SMcG0020742 dd_Smed_v4_3373_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002505h1SMcG0020742 dd_Smed_v4_3373_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT2 (phosphate cytidylyltransferase 2, ethanolamine [Source:HGNC Symbol;Acc:HGNC:8756])

HSP 1 Score: 359.377 bits (921), Expect = 1.357e-121
Identity = 177/353 (50.14%), Postives = 242/353 (68.56%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAF 370          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT2 (phosphate cytidylyltransferase 2, ethanolamine [Source:HGNC Symbol;Acc:HGNC:8756])

HSP 1 Score: 351.673 bits (901), Expect = 3.121e-118
Identity = 177/374 (47.33%), Postives = 240/374 (64.17%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG--------------------------------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E     + +   Y   FG                                FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQE----MSSEYREYADSFGKPPHPIPAGDILSSEGCSQCPGGRNPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAF 388          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT2 (phosphate cytidylyltransferase 2, ethanolamine [Source:HGNC Symbol;Acc:HGNC:8756])

HSP 1 Score: 338.576 bits (867), Expect = 6.817e-114
Identity = 169/340 (49.71%), Postives = 232/340 (68.24%), Query Frame = 1
Query:  115 MLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
            M+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:    1 MVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAF 338          

HSP 2 Score: 72.4034 bits (176), Expect = 2.331e-13
Identity = 41/135 (30.37%), Postives = 67/135 (49.63%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLL 480
            ++V G FD+ H GH + L +   L +   +I G+H D E+  +KG   P+ +  ER   + + ++V EVV  APY    E L  +  D   HG  +I    DG D Y + K    F++      ++T  +V R++
Sbjct:  184 IYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII 318          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT2 (phosphate cytidylyltransferase 2, ethanolamine [Source:HGNC Symbol;Acc:HGNC:8756])

HSP 1 Score: 334.724 bits (857), Expect = 3.457e-112
Identity = 169/350 (48.29%), Postives = 231/350 (66.00%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++                     F+ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSH-------------------FKEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAF 348          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT2 (phosphate cytidylyltransferase 2, ethanolamine [Source:HGNC Symbol;Acc:HGNC:8756])

HSP 1 Score: 304.679 bits (779), Expect = 1.531e-101
Identity = 146/269 (54.28%), Postives = 197/269 (73.23%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMM 876
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K    A  + +C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTK----AHHSSQCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELL 282          

HSP 2 Score: 66.2402 bits (160), Expect = 1.323e-11
Identity = 42/140 (30.00%), Postives = 65/140 (46.43%), Query Frame = 1
Query:  613 GPRAGEKV-LYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            GP     V ++  G +D+ H GH   L +   +G Y+IVGV++DE +    G   P+    ER   V + K+V  VV   PY  T   ++  N D  VHG   T   D  D +E  +Q G++        ++   L+ R+
Sbjct:   16 GPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGP--PVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRM 153          

HSP 3 Score: 53.1434 bits (126), Expect = 2.976e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKY 333
            ++V G FD+ H GH + L +   L +   +I G+H D E+  +KG   P+ +  ER   + + ++V EVV  APY    E L  +
Sbjct:  201 IYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHF 285          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-2.1 (Phosphocholine CYtidylylTransferase [Source:UniProtKB/TrEMBL;Acc:X5M8X2])

HSP 1 Score: 338.576 bits (867), Expect = 4.854e-114
Identity = 171/358 (47.77%), Postives = 237/358 (66.20%), Query Frame = 1
Query:   88 RVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGE----------CATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAE--------DIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRII 1107
            RVW DGC+DM+HFGHAN LRQAK+ G  LIVGVH+D+EI  HKGPPVF+E+ERY+M+  IKWVDEVVENAPY T VETL+KY+CDFC HGDDIT+ ADG DTY +VK   +++E KRT G+STTDLV R+L ++K +    E+ E             + +S +T+   F+P++  I +F +  R P+  +KV+YV GSFDLFH+GH  FLE+  + G Y+IVG+ SD+TV    G  +PIM+++ERVLSVL+ K V+ VV   PY+IT ++++  N+  V++G      +         D F   ++ G +  VDSGS +T + +I RI  +   YE R K KE KE + + +  +I
Sbjct:   14 RVWADGCYDMVHFGHANQLRQAKQFGQKLIVGVHNDEEIRLHKGPPVFNEQERYRMVAGIKWVDEVVENAPYATTVETLDKYDCDFCVHGDDITLTADGKDTYQEVKDHQRYRECKRTCGVSTTDLVGRMLLLTKNHHTQDEHIEQHVERARSLSTDNVAMSPWTRVSRFIPTTTTILEFAEG-RPPKPTDKVVYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKEADVAKAMNLI 370          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-2.1 (Phosphocholine CYtidylylTransferase [Source:UniProtKB/TrEMBL;Acc:X5M8X2])

HSP 1 Score: 335.109 bits (858), Expect = 1.134e-112
Identity = 172/365 (47.12%), Postives = 236/365 (64.66%), Query Frame = 1
Query:   88 RVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCA-------VENGECATMKI----------SSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAE--------DIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRII 1107
            RVW DGC+DM+HFGHAN LRQAK+ G  LIVGVH+D+EI  HKGPPVF+E+ERY+M+  IKWVDEVVENAPY T VETL+KY+CDFC HGDDIT+ ADG DTY +VK   +++E KRT G+STTDLV R+L ++K +          VE     +  I          S +T+   F+P++  I +F +  R P+  +KV+YV GSFDLFH+GH  FLE+  + G Y+IVG+ SD+TV    G  +PIM+++ERVLSVL+ K V+ VV   PY+IT ++++  N+  V++G      +         D F   ++ G +  VDSGS +T + +I RI  +   YE R K KE KE + + +  +I
Sbjct:   14 RVWADGCYDMVHFGHANQLRQAKQFGQKLIVGVHNDEEIRLHKGPPVFNEQERYRMVAGIKWVDEVVENAPYATTVETLDKYDCDFCVHGDDITLTADGKDTYQEVKDHQRYRECKRTCGVSTTDLVGRMLLLTKNHHTQDEHIEQHVERARSLSTAILEYSKDNVAMSPWTRVSRFIPTTTTILEFAEG-RPPKPTDKVVYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKEADVAKAMNLI 377          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-2.1 (Phosphocholine CYtidylylTransferase [Source:UniProtKB/TrEMBL;Acc:X5M8X2])

HSP 1 Score: 330.872 bits (847), Expect = 8.328e-111
Identity = 171/379 (45.12%), Postives = 237/379 (62.53%), Query Frame = 1
Query:   88 RVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGE-------------------------------CATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAE--------DIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRII 1107
            RVW DGC+DM+HFGHAN LRQAK+ G  LIVGVH+D+EI  HKGPPVF+E+ERY+M+  IKWVDEVVENAPY T VETL+KY+CDFC HGDDIT+ ADG DTY +VK   +++E KRT G+STTDLV R+L ++K +    E+ E                                  + +S +T+   F+P++  I +F +  R P+  +KV+YV GSFDLFH+GH  FLE+  + G Y+IVG+ SD+TV    G  +PIM+++ERVLSVL+ K V+ VV   PY+IT ++++  N+  V++G      +         D F   ++ G +  VDSGS +T + +I RI  +   YE R K KE KE + + +  +I
Sbjct:   14 RVWADGCYDMVHFGHANQLRQAKQFGQKLIVGVHNDEEIRLHKGPPVFNEQERYRMVAGIKWVDEVVENAPYATTVETLDKYDCDFCVHGDDITLTADGKDTYQEVKDHQRYRECKRTCGVSTTDLVGRMLLLTKNHHTQDEHIEQHVERARSLSTAILEYSKRMQSKKRRLNRLIADNVAMSPWTRVSRFIPTTTTILEFAEG-RPPKPTDKVVYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKEADVAKAMNLI 391          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-2.1 (Phosphocholine CYtidylylTransferase [Source:UniProtKB/TrEMBL;Acc:X5M8X2])

HSP 1 Score: 244.202 bits (622), Expect = 4.176e-78
Identity = 131/303 (43.23%), Postives = 189/303 (62.38%), Query Frame = 1
Query:  253 MIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGE----------CATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAE--------DIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRII 1107
            M+  IKWVDEVVENAPY T VETL+KY+CDFC HGDDIT+ ADG DTY +VK   +++E KRT G+STTDLV R+L ++K +    E+ E             + +S +T+   F+P++  I +F +  R P+  +KV+YV GSFDLFH+GH  FLE+  + G Y+IVG+ SD+TV    G  +PIM+++ERVLSVL+ K V+ VV   PY+IT ++++  N+  V++G      +         D F   ++ G +  VDSGS +T + +I RI  +   YE R K KE KE + + +  +I
Sbjct:    1 MVAGIKWVDEVVENAPYATTVETLDKYDCDFCVHGDDITLTADGKDTYQEVKDHQRYRECKRTCGVSTTDLVGRMLLLTKNHHTQDEHIEQHVERARSLSTDNVAMSPWTRVSRFIPTTTTILEFAEG-RPPKPTDKVVYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKEADVAKAMNLI 302          

HSP 2 Score: 68.1662 bits (165), Expect = 1.543e-12
Identity = 44/139 (31.65%), Postives = 71/139 (51.08%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHG--DD----ITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            V+V G FD+ H GH   L +AKE GD LIVG+ SD  +  +KG   P+ S  ER   + + K V+EVV  APY    + L+++N     +G  D+    +      +D + + K    + E      ++T  ++DR++ 
Sbjct:  138 VYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIH 276          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-2.1 (Phosphocholine CYtidylylTransferase [Source:UniProtKB/TrEMBL;Acc:X5M8X2])

HSP 1 Score: 236.498 bits (602), Expect = 7.062e-75
Identity = 130/316 (41.14%), Postives = 185/316 (58.54%), Query Frame = 1
Query:  253 MIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGE-------------------------------CATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAE--------DIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEIN 1083
            M+  IKWVDEVVENAPY T VETL+KY+CDFC HGDDIT+ ADG DTY +VK   +++E KRT G+STTDLV R+L ++K +    E+ E                                  + +S +T+   F+P++  I +F +  R P+  +KV+YV GSFDLFH+GH  FLE+  + G Y+IVG+ SD+TV    G  +PIM+++ERVLSVL+ K V+ VV   PY+IT ++++  N+  V++G      +         D F   ++ G +  VDSGS +T + +I RI  +   YE R K KE KE +
Sbjct:    1 MVAGIKWVDEVVENAPYATTVETLDKYDCDFCVHGDDITLTADGKDTYQEVKDHQRYRECKRTCGVSTTDLVGRMLLLTKNHHTQDEHIEQHVERARSLSTAILEYSKRMQSKKRRLNRLIADNVAMSPWTRVSRFIPTTTTILEFAEG-RPPKPTDKVVYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIHHRLEYETRNKKKEKKEAD 315          

HSP 2 Score: 68.1662 bits (165), Expect = 1.538e-12
Identity = 44/139 (31.65%), Postives = 71/139 (51.08%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHG--DD----ITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            V+V G FD+ H GH   L +AKE GD LIVG+ SD  +  +KG   P+ S  ER   + + K V+EVV  APY    + L+++N     +G  D+    +      +D + + K    + E      ++T  ++DR++ 
Sbjct:  159 VYVTGSFDLFHIGHLAFLEKAKEFGDYLIVGILSDQTVNQYKGSNHPIMSIHERVLSVLAYKPVNEVVFGAPYEITSDILDQFNVQAVINGFRDNNSSVVNSSLASIDPFAEAKRRGIYHEVDSGSDMTTDLIIDRIIH 297          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pect (gene:FBgn0032482 transcript:FBtr0080440)

HSP 1 Score: 365.925 bits (938), Expect = 1.321e-124
Identity = 185/345 (53.62%), Postives = 244/345 (70.72%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKEN---GCA---VENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + K VRVW DGC+DM+HFGHAN+LRQAK LGD +IVG+H+D+EI  HKGPPVF+EEER KM+K IKWVDEVV  APYVT ++ L++ NCDFC HGDDIT+ A+G+DTYH VKSAN++KE KRT G+STTDLV R+L +++ +   G A   +E  + A    S +T    FLP++ +I QF    + P  G+K++YV G+FDLFHVGH  FLE+  KLG Y+IVG+++D  V S  G  YPIMNL+ERVLSVL+CKFV+ VVI  PY +TE ++E   ID+V HG+T         D + VP+    F  +DSG+ +T E +++RI  +   YE R + KE KEI
Sbjct:   17 QRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGRMLLLTRNHFRQGSAEYDIEKEDSAAK--SPWTGCSQFLPTTQKIIQFSDG-KSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYCVTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMTTERIVERIISHRLEYERRNQAKEKKEI 358          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pect (gene:FBgn0032482 transcript:FBtr0334752)

HSP 1 Score: 364.77 bits (935), Expect = 3.626e-124
Identity = 184/342 (53.80%), Postives = 242/342 (70.76%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKEN---GCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + K VRVW DGC+DM+HFGHAN+LRQAK LGD +IVG+H+D+EI  HKGPPVF+EEER KM+K IKWVDEVV  APYVT ++ L++ NCDFC HGDDIT+ A+G+DTYH VKSAN++KE KRT G+STTDLV R+L +++ +   G A  + E      S +T    FLP++ +I QF    + P  G+K++YV G+FDLFHVGH  FLE+  KLG Y+IVG+++D  V S  G  YPIMNL+ERVLSVL+CKFV+ VVI  PY +TE ++E   ID+V HG+T         D + VP+    F  +DSG+ +T E +++RI  +   YE R + KE KEI
Sbjct:   17 QRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGRMLLLTRNHFRQGSAEYDIEKEAK--SPWTGCSQFLPTTQKIIQFSDG-KSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYCVTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMTTERIVERIISHRLEYERRNQAKEKKEI 355          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pect (gene:FBgn0032482 transcript:FBtr0080441)

HSP 1 Score: 364.385 bits (934), Expect = 6.222e-124
Identity = 185/350 (52.86%), Postives = 244/350 (69.71%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKEN---GCA---VENGECATM-----KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + K VRVW DGC+DM+HFGHAN+LRQAK LGD +IVG+H+D+EI  HKGPPVF+EEER KM+K IKWVDEVV  APYVT ++ L++ NCDFC HGDDIT+ A+G+DTYH VKSAN++KE KRT G+STTDLV R+L +++ +   G A   +E    + M       S +T    FLP++ +I QF    + P  G+K++YV G+FDLFHVGH  FLE+  KLG Y+IVG+++D  V S  G  YPIMNL+ERVLSVL+CKFV+ VVI  PY +TE ++E   ID+V HG+T         D + VP+    F  +DSG+ +T E +++RI  +   YE R + KE KEI
Sbjct:   17 QRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGRMLLLTRNHFRQGSAEYDIEKEGSSNMGQDSAAKSPWTGCSQFLPTTQKIIQFSDG-KSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYCVTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMTTERIVERIISHRLEYERRNQAKEKKEI 365          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pect (gene:FBgn0032482 transcript:FBtr0080439)

HSP 1 Score: 359.377 bits (921), Expect = 9.216e-122
Identity = 186/363 (51.24%), Postives = 246/363 (67.77%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKEN---GCA---VEN------------------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + K VRVW DGC+DM+HFGHAN+LRQAK LGD +IVG+H+D+EI  HKGPPVF+EEER KM+K IKWVDEVV  APYVT ++ L++ NCDFC HGDDIT+ A+G+DTYH VKSAN++KE KRT G+STTDLV R+L +++ +   G A   +E                   G+ +  K S +T    FLP++ +I QF    + P  G+K++YV G+FDLFHVGH  FLE+  KLG Y+IVG+++D  V S  G  YPIMNL+ERVLSVL+CKFV+ VVI  PY +TE ++E   ID+V HG+T         D + VP+    F  +DSG+ +T E +++RI  +   YE R + KE KEI
Sbjct:   17 QRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKVIVGIHTDEEITKHKGPPVFTEEERVKMVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVGRMLLLTRNHFRQGSAEYDIEKEVSILKRQIKSHPGSSNMGQDSAAK-SPWTGCSQFLPTTQKIIQFSDG-KSPNPGDKIVYVAGAFDLFHVGHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAPYCVTEELLEHFKIDVVCHGRTPIALENGKIDPYAVPKTRAIFELIDSGNEMTTERIVERIISHRLEYERRNQAKEKKEI 377          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt2 (gene:FBgn0035231 transcript:FBtr0072742)

HSP 1 Score: 102.064 bits (253), Expect = 1.154e-23
Identity = 58/136 (42.65%), Postives = 85/136 (62.50%), Query Frame = 1
Query:   85 VRVWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGL-DTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            VRV+ DG +D+ H GHA  L QAK +     LIVGV +D+  L  KG  V +  ERY+ ++  ++VDE+V NAP+    E +E++  DF AH DDI  GA G+ D Y  +K+   F   +RT G+ST+D+V R+++
Sbjct:   79 VRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAH-DDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARIVK 213          

HSP 2 Score: 66.6254 bits (161), Expect = 1.077e-11
Identity = 48/167 (28.74%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  619 RAGEKV----LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTH--CKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRK--KNKEAKEINYS 1089
            RAG+      +Y  G +DLFH GH   L +   +    Y+IVGV +DE    + G    +MN +ER  +V  C++V  +V   P+ + E  +E   ID V H           DI+   +  G F   +    ++   ++ RI  ++ +Y  R   +   AKE+N S
Sbjct:   71 RAGKTTRRVRVYADGIYDLFHQGHARQLMQAKNVFPNVYLIVGVCNDELTLRMKGRT--VMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARIVKDYDVYVRRNLARGYSAKELNVS 235          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:ZFIN;Acc:ZDB-GENE-041010-132])

HSP 1 Score: 350.132 bits (897), Expect = 4.897e-118
Identity = 169/346 (48.84%), Postives = 237/346 (68.50%), Query Frame = 1
Query:   85 VRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENG--ECATMKISSYTKGFG-------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            +RVW DGC+DM+H+GH+N LRQAK +GD L+VGVH+D+EI  HKGPPVF++ ERYKMI++IKWVDE+VE APYVT +ETL+KYNCDFC HGDDIT+  DG DTY +VK   +++E KRT G+STTDLV R+L ++K +   ++N   +  T       KG         FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  ++     YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY + +++++   +DLV HGKT+     D  D +  P++ G F  +DS + LT + ++QRI +N   +E R + KEAKE+
Sbjct:   31 IRVWCDGCYDMVHYGHSNQLRQAKAMGDYLVVGVHTDEEIAKHKGPPVFTQAERYKMIRAIKWVDEIVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDGKDTYDEVKRTGRYRECKRTQGVSTTDLVGRMLLLTKAHHSNIDNAAYQVHTDNFGKGPKGHSPWTGVSQFLQTSQKIIQFASG-KEPQPGDTIIYVAGAFDLFHIGHVDFLETVHRQAEKPYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVEKDLLDHFKVDLVCHGKTNVFPDADGTDPYAEPKKRGIFRILDSSNNLTTDDIVQRIIENRLQFEARNQKKEAKEM 375          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:ZFIN;Acc:ZDB-GENE-041010-132])

HSP 1 Score: 130.183 bits (326), Expect = 2.108e-35
Identity = 62/144 (43.06%), Postives = 95/144 (65.97%), Query Frame = 1
Query:  616 PRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDN 1032
            P+ G+ ++YV G+FDLFH+GH  FLE  ++     YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY + +++++   +DLV HGKT+     D  D +  P++ G F  +DS + LT + ++QRI +N
Sbjct:    3 PQPGDTIIYVAGAFDLFHIGHVDFLETVHRQAEKPYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVEKDLLDHFKVDLVCHGKTNVFPDADGTDPYAEPKKRGIFRILDSSNNLTTDDIVQRIIEN 146          

HSP 2 Score: 76.2554 bits (186), Expect = 8.323e-16
Identity = 45/138 (32.61%), Postives = 76/138 (55.07%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANAL----RQAKELGDALIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L    RQA++    +IVG+H D E+  +KG   P+ +  ER   + + ++V EVV  APY  E + L+ +  D   HG  ++   ADG D Y + K    F+    ++ ++T D+V R+++
Sbjct:   10 IYVAGAFDLFHIGHVDFLETVHRQAEK--PYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVEKDLLDHFKVDLVCHGKTNVFPDADGTDPYAEPKKRGIFRILDSSNNLTTDDIVQRIIE 145          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 118.627 bits (296), Expect = 1.921e-29
Identity = 69/161 (42.86%), Postives = 92/161 (57.14%), Query Frame = 1
Query:    7 LQNLKFKYY*TFDLE*NLTRMSENKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            L++++ K Y    +E        ++PVRV+ DG FDM H GHA AL QAK L     LIVGV SDD     KG  V +E+ERY  +   ++VDEVV NAP+    E L K+  DF AH D     AD  D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   48 LESMEDKQYQRVTIEEARRGTPPDRPVRVYADGIFDMFHSGHARALMQAKCLFPNTHLIVGVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 208          

HSP 2 Score: 73.559 bits (179), Expect = 7.425e-14
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFL--EECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKT--HCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FD+FH GH   L   +C    T++IVGV SD+    + G  + +MN  ER  +V  C++V  VV   P+ +T   +    ID V H        D++D+++  +  G F+       ++   +I RI  ++ +Y  R  ++   AKE+N S
Sbjct:   76 VYADGIFDMFHSGHARALMQAKCLFPNTHLIVGVCSDDLTHKLKG--FTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYDVYVRRNLQRGYTAKELNVS 230          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 118.627 bits (296), Expect = 1.921e-29
Identity = 69/161 (42.86%), Postives = 92/161 (57.14%), Query Frame = 1
Query:    7 LQNLKFKYY*TFDLE*NLTRMSENKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            L++++ K Y    +E        ++PVRV+ DG FDM H GHA AL QAK L     LIVGV SDD     KG  V +E+ERY  +   ++VDEVV NAP+    E L K+  DF AH D     AD  D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   48 LESMEDKQYQRVTIEEARRGTPPDRPVRVYADGIFDMFHSGHARALMQAKCLFPNTHLIVGVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 208          

HSP 2 Score: 73.559 bits (179), Expect = 7.425e-14
Identity = 47/157 (29.94%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFL--EECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKT--HCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FD+FH GH   L   +C    T++IVGV SD+    + G  + +MN  ER  +V  C++V  VV   P+ +T   +    ID V H        D++D+++  +  G F+       ++   +I RI  ++ +Y  R  ++   AKE+N S
Sbjct:   76 VYADGIFDMFHSGHARALMQAKCLFPNTHLIVGVCSDDLTHKLKG--FTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYDVYVRRNLQRGYTAKELNVS 230          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta a [Source:ZFIN;Acc:ZDB-GENE-061220-4])

HSP 1 Score: 115.546 bits (288), Expect = 1.362e-28
Identity = 62/138 (44.93%), Postives = 86/138 (62.32%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++PVRV+ DG FD+ H GHA AL QAK L     LIVGV SD+    +KG  V +E+ERY+ ++  ++VDEV+ +AP+    + LEK+  DF AH D     A   D Y  +K A  F   KRT GIST+DL+ R+++
Sbjct:   48 DRPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHKYKGFTVMTEDERYEALRHCRYVDEVLRDAPWTLTQDFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTKRTEGISTSDLITRIVR 185          

HSP 2 Score: 75.8702 bits (185), Expect = 1.068e-14
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FDLFH GH   L +   L   TY+IVGV SDE      G  + +M   ER  ++  C++V  V+   P+ +T++ +E   ID V H       A  ED+++  ++ G F        ++   LI RI  ++ +Y  R  ++   AKE+N S
Sbjct:   53 VYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHKYKG--FTVMTEDERYEALRHCRYVDEVLRDAPWTLTQDFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTKRTEGISTSDLITRIVRDYDVYARRNLQRGYTAKELNVS 207          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 342.428 bits (877), Expect = 5.449e-115
Identity = 168/346 (48.55%), Postives = 235/346 (67.92%), Query Frame = 1
Query:   85 VRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCA---------VENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            VRVW DGC+DM+H+GH+N LRQA+ +G  LIVGVH+D+EI  HKGPPVF++EERYKM+K+IKWVDE+V  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK+A +++E +RT G+STTDLV R+L ++K +             +N        S +T    FL +S +I QF    + P  G+ ++YV G+FDLFH+GH  FLE+ Y L    YVIVG++ D+ V       YPIMN++ER LSVL+C++V+ VVI  PY ++ ++++   +D+V HGKT     +D  D +  P++   F  VDSG++LT + ++QRI  N   YE R + KEAKE+
Sbjct:   19 VRVWCDGCYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRMLLMTKAHHSIEVTLDYQKHQDNLSKDARGHSPWTGVSQFLQTSQKIMQFASG-KEPSPGDTIIYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKEL 363          

HSP 2 Score: 65.855 bits (159), Expect = 3.346e-11
Identity = 39/138 (28.26%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  616 PRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            P  G+  ++  G +D+ H GH   L +   +G Y+IVGV++DE +    G   P+    ER   V + K+V  +V   PY  T   ++  N D  VHG   T   D +D +E  +  G++        ++   L+ R+
Sbjct:   14 PVRGQVRVWCDGCYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGP--PVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRM 149          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 331.257 bits (848), Expect = 1.230e-110
Identity = 161/329 (48.94%), Postives = 229/329 (69.60%), Query Frame = 1
Query:  109 FDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            +DM+H+GH+N LRQA+ +G  LIVGVH+D+EI  HKGPPVF++EERYKM+K+IKWVDE+V  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK+A +++E +RT G+STTDLV R+L ++K +   V   +  +   S +T    FL +S +I QF    + P  G+ ++YV G+FDLFH+GH  FLE+ Y L    YVIVG++ D+ V       YPIMN++ER LSVL+C++V+ VVI  PY ++ ++++   +D+V HGKT     +D  D +  P++   F  VDSG++LT + ++QRI  N   YE R + KEAKE+
Sbjct:   42 YDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRMLLMTKAHHSIVSYTKQGSH--SPWTGVSQFLQTSQKIMQFASG-KEPSPGDTIIYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKEL 367          

HSP 2 Score: 70.0922 bits (170), Expect = 1.306e-12
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L +   L +   +IVG+H D E+  +K    P+ +  ER   + + ++V EVV  APY    + L+ +  D   HG  D+    DG D Y + K    F+     + ++T D+V R+++
Sbjct:  215 IYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIK 350          

HSP 3 Score: 63.929 bits (154), Expect = 1.671e-10
Identity = 39/141 (27.66%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  607 IRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            ++G      +L +  S+D+ H GH   L +   +G Y+IVGV++DE +    G   P+    ER   V + K+V  +V   PY  T   ++  N D  VHG   T   D +D +E  +  G++        ++   L+ R+
Sbjct:   26 LKGKGNQHHILLILFSYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGP--PVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRM 164          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 328.946 bits (842), Expect = 3.887e-110
Identity = 162/333 (48.65%), Postives = 230/333 (69.07%), Query Frame = 1
Query:  109 FDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAV---ENGECATMKIS-SYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            +DM+H+GH+N LRQA+ +G  LIVGVH+D+EI  HKGPPVF++EERYKM+K+IKWVDE+V  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK+A +++E +RT G+STTDLV R+L ++K +   V   + G C    +   +T    FL +S +I QF    + P  G+ ++YV G+FDLFH+GH  FLE+ Y L    YVIVG++ D+ V       YPIMN++ER LSVL+C++V+ VVI  PY ++ ++++   +D+V HGKT     +D  D +  P++   F  VDSG++LT + ++QRI  N   YE R + KEAKE+
Sbjct:    2 YDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRMLLMTKAHHSIVSYTKQGICPGEILEFPWTGVSQFLQTSQKIMQFASG-KEPSPGDTIIYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKEL 333          

HSP 2 Score: 70.0922 bits (170), Expect = 1.145e-12
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L +   L +   +IVG+H D E+  +K    P+ +  ER   + + ++V EVV  APY    + L+ +  D   HG  D+    DG D Y + K    F+     + ++T D+V R+++
Sbjct:  181 IYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIK 316          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 328.946 bits (842), Expect = 4.636e-110
Identity = 162/339 (47.79%), Postives = 229/339 (67.55%), Query Frame = 1
Query:  106 CFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCA---------VENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            C+DM+H+GH+N LRQA+ +G  LIVGVH+D+EI  HKGPPVF++EERYKM+K+IKWVDE+V  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK+A +++E +RT G+STTDLV R+L ++K +             +N        S +T    FL +S +I QF    + P  G+ ++YV G+FDLFH+GH  FLE+ Y L    YVIVG++ D+ V       YPIMN++ER LSVL+C++V+ VVI  PY ++ ++++   +D+V HGKT     +D  D +  P++   F  VDSG++LT + ++QRI  N   YE R + KEAKE+
Sbjct:    9 CYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRMLLMTKAHHSIEVTLDYQKHQDNLSKDARGHSPWTGVSQFLQTSQKIMQFASG-KEPSPGDTIIYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKEL 346          

HSP 2 Score: 69.3218 bits (168), Expect = 2.041e-12
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L +   L +   +IVG+H D E+  +K    P+ +  ER   + + ++V EVV  APY    + L+ +  D   HG  D+    DG D Y + K    F+     + ++T D+V R+++
Sbjct:  194 IYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIK 329          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 328.561 bits (841), Expect = 7.396e-110
Identity = 162/338 (47.93%), Postives = 229/338 (67.75%), Query Frame = 1
Query:  106 CFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAV--------ENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
             +DM+H+GH+N LRQA+ +G  LIVGVH+D+EI  HKGPPVF++EERYKM+K+IKWVDE+V  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK+A +++E +RT G+STTDLV R+L ++K +   V        +N        S +T    FL +S +I QF    + P  G+ ++YV G+FDLFH+GH  FLE+ Y L    YVIVG++ D+ V       YPIMN++ER LSVL+C++V+ VVI  PY ++ ++++   +D+V HGKT     +D  D +  P++   F  VDSG++LT + ++QRI  N   YE R + KEAKE+
Sbjct:   12 SYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRMLLMTKAHHSIVTLDYQKHQDNLSKDARGHSPWTGVSQFLQTSQKIMQFASG-KEPSPGDTIIYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKNRLEYEARNQKKEAKEL 348          

HSP 2 Score: 69.707 bits (169), Expect = 1.674e-12
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L +   L +   +IVG+H D E+  +K    P+ +  ER   + + ++V EVV  APY    + L+ +  D   HG  D+    DG D Y + K    F+     + ++T D+V R+++
Sbjct:  196 IYVAGAFDLFHIGHIDFLEKVYSLAEKPYVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIK 331          

HSP 3 Score: 62.7734 bits (151), Expect = 3.066e-10
Identity = 38/132 (28.79%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  634 VLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            +L +  S+D+ H GH   L +   +G Y+IVGV++DE +    G   P+    ER   V + K+V  +V   PY  T   ++  N D  VHG   T   D +D +E  +  G++        ++   L+ R+
Sbjct:    6 ILLILFSYDMVHYGHSNQLRQARAMGGYLIVGVHTDEEISQHKGP--PVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRM 135          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:MGI Symbol;Acc:MGI:1915921])

HSP 1 Score: 358.607 bits (919), Expect = 1.767e-121
Identity = 179/355 (50.42%), Postives = 243/355 (68.45%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+K+NCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + S +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FL+E +KL    YVI G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   18 GDQRIVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGQ-SPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPDRDGSDPYQEPKRRGIFYQIDSGSDLTTDLIVQRIIKNRLEYEARNQKKEAKELAF 370          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:MGI Symbol;Acc:MGI:1915921])

HSP 1 Score: 353.984 bits (907), Expect = 2.336e-119
Identity = 179/371 (48.25%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVE--------------------NGECATMKISSYTKG--------FGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
            + + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+K+NCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E                     G+  + ++SS   G          FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FL+E +KL    YVI G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   19 DQRIVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKPPHPTPAGDTLSSEVSSQCPGGQSPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPDRDGSDPYQEPKRRGIFYQIDSGSDLTTDLIVQRIIKNRLEYEARNQKKEAKELAF 388          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 113.235 bits (282), Expect = 1.014e-27
Identity = 61/138 (44.20%), Postives = 84/138 (60.87%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++PVRV+ DG FD+ H GHA AL QAK L     L+VGV SDD     KG  V +E ERY+ ++  ++VDEV+ +AP+    E LEK+  DF AH D     A   D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   44 DRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 181          

HSP 2 Score: 72.4034 bits (176), Expect = 1.276e-13
Identity = 46/158 (29.11%), Postives = 77/158 (48.73%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYSI 1092
            +Y  G FDLFH GH   L +   L   +Y++VGV SD+      G  + +MN  ER  ++  C++V  V+   P+ +T   +E   ID V H       A  +D+++  ++ G F        ++   +I RI  ++ +Y  R  ++   AKE+N S 
Sbjct:   49 VYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKG--FTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSF 204          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 113.62 bits (283), Expect = 1.123e-27
Identity = 61/138 (44.20%), Postives = 84/138 (60.87%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++PVRV+ DG FD+ H GHA AL QAK L     L+VGV SDD     KG  V +E ERY+ ++  ++VDEV+ +AP+    E LEK+  DF AH D     A   D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   74 DRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVR 211          

HSP 2 Score: 72.0182 bits (175), Expect = 2.526e-13
Identity = 46/158 (29.11%), Postives = 77/158 (48.73%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYSI 1092
            +Y  G FDLFH GH   L +   L   +Y++VGV SD+      G  + +MN  ER  ++  C++V  V+   P+ +T   +E   ID V H       A  +D+++  ++ G F        ++   +I RI  ++ +Y  R  ++   AKE+N S 
Sbjct:   79 VYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKG--FTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSF 234          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 111.309 bits (277), Expect = 7.510e-27
Identity = 61/137 (44.53%), Postives = 81/137 (59.12%), Query Frame = 1
Query:   79 KPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            +PVRV+ DG FD+ H GHA AL QAK L     LIVGV SD+     KG  V +E ERY  ++  ++VDEVV NAP+    E L ++  DF AH D     A   D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 211          

HSP 2 Score: 76.2554 bits (186), Expect = 9.586e-15
Identity = 50/157 (31.85%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FDLFH GH   L +   L   TY+IVGV SDE   +  G  + +MN  ER  +V  C++V  VV   P+ +T   +    ID V H       A  +D+++  +  G F+       ++   +I RI  ++ +Y  R  ++   AKE+N S
Sbjct:   79 VYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHNFKG--FTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVS 233          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q5EA75|PCY2_BOVIN (Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus OX=9913 GN=PCYT2 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 1.825e-121
Identity = 182/358 (50.84%), Postives = 244/358 (68.16%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDR 1101
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ Y L    YVI G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  +++   +DLV HGKT     KD  D +E P++ G F  VDSG+ LT + ++QRI  N   YE R + KEAKE+ +  + R
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDHLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVYGLAERPYVIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYSVTAELLDHFKVDLVCHGKTEVVPDKDGSDPYEEPKRRGIFCQVDSGNDLTTDLIVQRIIKNRLEYEARNQKKEAKELAFQEAMR 375          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q99447|PCY2_HUMAN (Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 PE=1 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 6.515e-121
Identity = 177/353 (50.14%), Postives = 242/353 (68.56%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN-----------GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+KYNCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E            G+C   + + +T    FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FLE+ ++L    Y+I G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   20 RRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGR-NPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAF 370          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|O88637|PCY2_RAT (Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus OX=10116 GN=Pcyt2 PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 3.530e-119
Identity = 180/370 (48.65%), Postives = 243/370 (65.68%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVE--------------------NGECATMKISSYTKG--------FGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
             + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+K+NCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E                     G+  + ++SS   G          FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FL+E +KL    YVI G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D +E P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   20 QRTVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKPPHPTPAGDTLSSEVSSQCPGGQSPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPDRDGSDPYEEPKRRGIFCQIDSGSDLTTDLIVQRIIKNRLEYEARNQKKEAKELAF 388          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q922E4|PCY2_MOUSE (Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus OX=10090 GN=Pcyt2 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.634e-118
Identity = 179/371 (48.25%), Postives = 244/371 (65.77%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVE--------------------NGECATMKISSYTKG--------FGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
            + + VRVW DGC+DM+H+GH+N LRQA+ +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDEVV  APYVT +ETL+K+NCDFC HG+DIT+  DG DTY +VK A +++E KRT G+STTDLV R+L V+K +  + E                     G+  + ++SS   G          FL +S +I QF    + P+ GE V+YV G+FDLFH+GH  FL+E +KL    YVI G++ D+ V    G  YPIMNL+ER LSVL+C++VS VVI  PY +T  ++    +DLV HGKT     +D  D ++ P++ G F  +DSGS LT + ++QRI  N   YE R + KEAKE+ +
Sbjct:   19 DQRIVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKPPHPTPAGDTLSSEVSSQCPGGQSPWTGVSQFLQTSQKIIQFASG-KEPQPGETVIYVAGAFDLFHIGHVDFLQEVHKLAKRPYVIAGLHFDQEVNRYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYSVTAELLNHFKVDLVCHGKTEIVPDRDGSDPYQEPKRRGIFYQIDSGSDLTTDLIVQRIIKNRLEYEARNQKKEAKELAF 388          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q55BZ4|PCY2_DICDI (Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum OX=44689 GN=pctA PE=1 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 9.418e-117
Identity = 169/356 (47.47%), Postives = 238/356 (66.85%), Query Frame = 1
Query:   58 LTRMSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATM---------KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC----KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINY 1086
            ++  +  KP+RV+VDGCFD++HFGHANALRQA+ELGD L+VGVH+D+EI  +KGPPV +E+ERYK +++ KW DEV E APY    E L+  NCDFC HG+DI+VGADG D Y  +K + KF+  KRT G+STT+LV R+L  +K++   V   + + +         K S YT    FLP++ +I QF +  R P+  +K++Y+ G FDLFHVGH   L++   LG Y+IVGV+ D  V    G  +PIMNL+ERVLSVLSC++V  VVI  P+ +T++M++ L+I++VVHG        +   D +++PR+LG +  V     LT   +++RI DN   YE R + KEAKEIN+
Sbjct:    1 MSTTTNKKPIRVYVDGCFDLMHFGHANALRQARELGDILVVGVHTDEEIAKNKGPPVMNEQERYKAVRACKWADEVAEGAPYTLTEEYLDSLNCDFCVHGEDISVGADGKDVYEGIKKSGKFRFIKRTEGVSTTELVGRMLLCTKDHLQNVSGEQTSPLGGVNPNVLHKQSPYTSLSHFLPTTRKIVQFSEG-RSPKPNDKIIYMDGGFDLFHVGHTEALKQARALGDYLIVGVHDDRVVHEQKGSNFPIMNLHERVLSVLSCRYVDEVVIGAPFSVTKDMIDSLHINVVVHGDDQVVLGPEGGVDPYKLPRELGIYKEVKHTEGLTATEIVKRIIDNRLQYEARNRKKEAKEINF 355          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A267GA91 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034139g1 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 6.108e-133
Identity = 193/354 (54.52%), Postives = 252/354 (71.19%), Query Frame = 1
Query:   67 MSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCA---VENGECATM--------KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTH----CKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEIN 1083
            + + K +RVWVDGCFDM+HFGHANA+RQAK LGD L+VGVHSD+EI  HKGPPVF+  ERYKM+++IKWVDEVVE APY+T VETLEK+NCDFCAHGDDIT  ADG DTYH VK+A K++EFKRT G+STTDLV R+L  ++ +  A   V + E AT           S YT    F+P++ Q+ +F    R P  GEK+ +V G+FDLFHVGH  FLE+CY + TYVI+G++SD+ V    G  YPIM ++ERVLSVL+C++VSNVVI  P+KI+E +M+ L +D V+HG       C D  D +   ++LG +  VDSG+ +T  S+I+RI  N   +E R K+KE KE++
Sbjct:    8 IEKKKQIRVWVDGCFDMVHFGHANAIRQAKSLGDYLLVGVHSDEEIEHHKGPPVFTSAERYKMVRAIKWVDEVVEAAPYITTVETLEKHNCDFCAHGDDITTSADGHDTYHLVKAAGKYREFKRTEGVSTTDLVGRMLLATRSHHSANVTVGDSERATFDQMATAATSRSPYTATCQFVPTTQQLKEFSTG-RAPEPGEKIAFVCGAFDLFHVGHIDFLEKCYSMATYVIIGIHSDQIVNWYRGYNYPIMTMFERVLSVLACRYVSNVVIDAPFKISEQLMKHLKVDYVIHGVRTPVKPCPDGSDPYSEAKRLGLYREVDSGNDMTAYSVIERIIKNRVKFEERNKSKEQKELD 360          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A1I8GNV3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009432g1 PE=4 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 9.062e-130
Identity = 189/359 (52.65%), Postives = 249/359 (69.36%), Query Frame = 1
Query:   55 NLTRMSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCA---VENGECATM---------KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK----THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEIN 1083
            +L+   ENK VRVW+DGCFD++HFGHANA+RQAK LGD L+VGVHSD+EI  HKGPPV +E ER +++++IKWVDEVVEN PY+T V TL+KYNCDFCAHGDD+T  ADG D+Y +VK+  +FKEFKRT G+STTDLV R+L  ++ +  +   V   E AT          + S YTK   F+P++ Q+ +F    R P  GEKV YV GSFDLFHVGH  FLE+CY + TY+IVGV+SD  V S  G  YPIM ++ERVLSVLSC++V+NVVI  PY +TE +++   +DLV+ G     +   D  D F   ++LG +  VDSG+ +T  ++I+RI  N   +E R + KE KE+ 
Sbjct:    4 SLSANKENKKVRVWLDGCFDIIHFGHANAIRQAKALGDVLVVGVHSDEEIAQHKGPPVLNETERCRIVRAIKWVDEVVENVPYITSVATLDKYNCDFCAHGDDLTTSADGRDSYEEVKAVGRFKEFKRTAGVSTTDLVGRMLLATRSHHSSTLTVGEAEKATFAQMASSPNSQNSPYTKTCQFVPTTQQLVEFSTG-RAPAPGEKVAYVCGSFDLFHVGHVAFLEKCYAMATYIIVGVHSDSVVNSYRGANYPIMTVFERVLSVLSCRYVANVVIDAPYCVTEELIKQFKVDLVISGSRTAVSASTDGSDPFGQAKRLGVYREVDSGTDMTAYTVIERIIANRIKFEERNRKKEQKEMT 361          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A1I8JD44 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022729g1 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.608e-128
Identity = 188/359 (52.37%), Postives = 247/359 (68.80%), Query Frame = 1
Query:   55 NLTRMSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSK---ENGCAVENGECATM---------KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK----THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEIN 1083
            +L+   ENK VRVW+DGCFD++HFGHANA++QAK LGD L+VGVHSD+EI  HKGPPV +E ER +++ +IKWVDEVVEN PY+T V TL+KYNCDFCAHGDD+T  ADG D+Y +VK+  +FKEFKRT G+STTDLV R+L  ++    +   V   E AT          + S YTK   F+P++ Q+ +F    R P  GEKV YV GSFDLFHVGH  FLE+CY + TY+IVGV+SD  V S  G  YPIM ++ERVLSVLSC++V+NVVI  PY +TE +++   +DLV+ G     +   D  D F   ++LG +  VDSG+ +T  ++I+RI  N   +E R + KE KE+ 
Sbjct:    4 SLSANKENKKVRVWLDGCFDIIHFGHANAIQQAKALGDVLVVGVHSDEEIAQHKGPPVLNETERCRIVHAIKWVDEVVENVPYITSVATLDKYNCDFCAHGDDLTTSADGRDSYEEVKAVGRFKEFKRTAGVSTTDLVGRMLLATRSHHSSALTVGEAEKATFAQMASSPNSQNSPYTKTCQFVPTTQQLVEFSTG-RAPAPGEKVAYVCGSFDLFHVGHVAFLEKCYAMATYIIVGVHSDSVVNSYRGANYPIMTVFERVLSVLSCRYVANVVIDAPYCVTEELIKQFKVDLVISGSRTAVSASTDGSDPFGQAKRLGVYREVDSGTDMTAYTVIERIIANRIKFEERNRKKEQKEMT 361          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Match: C3XXM7 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_113520 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.617e-127
Identity = 184/346 (53.18%), Postives = 248/346 (71.68%), Query Frame = 1
Query:   82 PVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSK-----ENGCAVENGECATMK-----ISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            P+RVWVDGCFDM+HFGHANALRQAK++GD LIVGVHSD+EI  HKGPPV +EEERYKM++++KWVDEVVE APYVT +ETL+KYNCD+C HGDDIT+ ADG DTY +VK+  ++KE KRT G+STTDLV R+L ++K     EN   +   +   ++      S +T    FLP++ +IAQF +   GP  G++++YV G+FDLFHVGH  FL+   + G Y+IVG+++D  V    G  +PIMN++ER L VL+C+ VS VVI  PY +TE +ME  NIDLVVHG+T+     +  D ++VP+ LG++  +DSG+ +T   +I+RI  N   +E R K KE KE+
Sbjct:   16 PLRVWVDGCFDMVHFGHANALRQAKKMGDYLIVGVHSDEEISKHKGPPVMTEEERYKMVRAVKWVDEVVEAAPYVTTIETLDKYNCDYCVHGDDITMTADGHDTYAEVKNGGRYKECKRTAGVSTTDLVGRMLLLTKTHHDRENEAQLPRDKVEELRENPQARSPWTGVSQFLPTTQKIAQFAEGGSGPEPGDRIVYVSGAFDLFHVGHLDFLQRARQEGDYLIVGLHTDPVVNGYKGSNHPIMNIHERTLCVLACRHVSEVVIGAPYTVTEELMEHFNIDLVVHGRTNVIPDTEGHDPYKVPKGLGKYKQIDSGNDMTTTKIIERIIRNRLHFEARNKAKEEKEM 361          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Match: N6T3N7 (Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=109543305 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 1.763e-127
Identity = 182/351 (51.85%), Postives = 253/351 (72.08%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKEN------GCAVENGECATM-----KISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCK---DAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            +  +P+RVW DGC+DM+HFGHAN+LRQAK LGD L+VGVH+D+EI  HKGPPVF+++ERYKM++ IKWVDEV+E APYVT ++TL+KY+CDFC HGDDIT+ A+G+DTYH VKSA ++KE +RT G+STTDLV R+L +++ +        +VE     TM       S +T    FLP++ +I QF    + P+ G++V+YV G+FDLFHVGH  FLE+  + G Y+IVG+++D  V    G  +PIMNL+ERVLSVL+CK+VS VVI  PYK++E++M    +D+V+HGKT      D  D +E+P++LG+F  VDSG+ +T E ++ RI  N   ++ R + KE KEI
Sbjct:   19 AHERPIRVWCDGCYDMVHFGHANSLRQAKALGDYLVVGVHTDEEITKHKGPPVFTQQERYKMVRGIKWVDEVIEGAPYVTTLDTLDKYDCDFCVHGDDITMTAEGVDTYHMVKSAGRYKEVQRTEGVSTTDLVGRMLLLTRNHFKQGQYEYSVEKEHSTTMGQDSSARSPWTGCSQFLPTTQKIIQFSDG-KAPKIGDRVVYVAGAFDLFHVGHLDFLEKAREQGDYLIVGLHTDPIVNIYKGSNFPIMNLHERVLSVLACKYVSEVVIGAPYKVSESLMSHFKVDIVIHGKTSVMKDVDGSDPYEIPKRLGKFKAVDSGNEMTTEKIVDRIIRNRMEFQERNRLKEKKEI 368          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt2 (ethanolamine-phosphate cytidylyltransferase [Source:NCBI gene;Acc:103026757])

HSP 1 Score: 347.821 bits (891), Expect = 3.201e-117
Identity = 167/348 (47.99%), Postives = 239/348 (68.68%), Query Frame = 1
Query:   79 KPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGEC---------ATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + VRVW DGC+DM+H+GH+N LRQAK +GD L+VGVH+D+EI  HKGPPVF++EERYKM+++IKWVDE+VE APYVT +ETL+KYNCDFC HGDDIT+  DG DTY +VK   +++E +RT G+STTDLV R+L ++K +   ++N +               S +T    FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  +K     YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY + +++++   +D+V HG+T     KD  D +  P++ G F  ++S + LT + ++QRI +N   +E R + KEAKE+
Sbjct:   23 RAVRVWCDGCYDMVHYGHSNQLRQAKAMGDYLVVGVHTDEEISKHKGPPVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDGKDTYEEVKRMERYRECRRTQGVSTTDLVGRMLLMTKAHHTNMDNSDYQQHADNFGKGPKGHSPWTGVSQFLQTSQKIIQFASG-KEPQPGDTIIYVAGAFDLFHIGHVDFLETVFKQAERPYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVNKDLLDHFRVDMVCHGQTEVFPDKDGTDPYAEPKKRGIFRIINSRNGLTTDDIVQRIIENRLQFEARNQKKEAKEM 369          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt2 (ethanolamine-phosphate cytidylyltransferase [Source:NCBI gene;Acc:103026757])

HSP 1 Score: 333.183 bits (853), Expect = 1.095e-111
Identity = 162/337 (48.07%), Postives = 230/337 (68.25%), Query Frame = 1
Query:  106 CFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSK-------ENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            C+DM+H+GH+N LRQAK +GD L+VGVH+D+EI  HKGPPVF++EERYKM+++IKWVDE+VE APYVT +ETL+KYNCDFC HGDDIT+  DG DTY +VK   +++E +RT G+STTDLV R+L ++K        N    +N        S +T    FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  +K     YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY + +++++   +D+V HG+T     KD  D +  P++ G F  ++S + LT + ++QRI +N   +E R + KEAKE+
Sbjct:   25 CYDMVHYGHSNQLRQAKAMGDYLVVGVHTDEEISKHKGPPVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDGKDTYEEVKRMERYRECRRTQGVSTTDLVGRMLLMTKAHHTNMVSNRHHADNFGKGPKGHSPWTGVSQFLQTSQKIIQFASG-KEPQPGDTIIYVAGAFDLFHIGHVDFLETVFKQAERPYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVNKDLLDHFRVDMVCHGQTEVFPDKDGTDPYAEPKKRGIFRIINSRNGLTTDDIVQRIIENRLQFEARNQKKEAKEM 360          

HSP 2 Score: 71.2478 bits (173), Expect = 3.349e-13
Identity = 41/136 (30.15%), Postives = 71/136 (52.21%), Query Frame = 1
Query:   91 VWVDGCFDMLHFGHANALRQAKELGDA--LIVGVHSDDEILFHKGP--PVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGD-DITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++V G FD+ H GH + L    +  +   +IVG+H D E+  +KG   P+ +  ER   + + ++V EVV  APY    + L+ +  D   HG  ++    DG D Y + K    F+     +G++T D+V R+++
Sbjct:  208 IYVAGAFDLFHIGHVDFLETVFKQAERPYVIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVNKDLLDHFRVDMVCHGQTEVFPDKDGTDPYAEPKKRGIFRIINSRNGLTTDDIVQRIIE 343          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000043395.1 (ethanolamine-phosphate cytidylyltransferase-like [Source:NCBI gene;Acc:103030423])

HSP 1 Score: 329.717 bits (844), Expect = 4.604e-110
Identity = 166/351 (47.29%), Postives = 231/351 (65.81%), Query Frame = 1
Query:   85 VRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG--------------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            VRVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D+EI  HKGPPVF++ ERYKM+  ++        APYVT +ETL+KY  DFC HGDDIT+  DG DTY +VK + +++E KRT G+STTDLV R+L ++K +   + N E        +T  FG              FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  YKL    YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY +++++++   +DLV HGKT     +D  D + VPR+ G    VDSG++LT + ++QRI  N  +++ R + KEAKE+
Sbjct:   34 VRVWCDGCYDMVHYGHSNQLRQAKAMGDYLIVGVHTDEEISKHKGPPVFTQAERYKMVAGVEGGG---PGAPYVTTLETLDKYTSDFCVHGDDITLTVDGKDTYEEVKKSGRYRECKRTQGVSTTDLVGRMLLMTKAHHSNIGNSE-----YQQHTDNFGRGPKGHSPWTGVSQFLQTSQKIIQFASG-KEPQPGDTIIYVAGAFDLFHIGHVDFLEAVYKLSDKPYVIVGLHFDQEVNRYKGKNYPIMNVHERTLSVLACRYVSEVVIGAPYTVSKDLLDHFKVDLVCHGKTEVFPDRDGSDPYTVPRRKGILRIVDSGNSLTTDDIVQRIIKNRLLFQARNQKKEAKEM 375          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000039747.1 (ethanolamine-phosphate cytidylyltransferase-like [Source:NCBI gene;Acc:103030423])

HSP 1 Score: 293.893 bits (751), Expect = 3.005e-96
Identity = 157/351 (44.73%), Postives = 218/351 (62.11%), Query Frame = 1
Query:   85 VRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG--------------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            VRVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D+EI  HKGPPVF++ ERYKM+  ++        APYVT +ETL+KY  DFC HG  +      L           F+E KRT G+STTDLV R+L ++K +   + N E        +T  FG              FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  YKL    YVIVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  PY +++++++   +DLV HGKT     +D  D + VPR+ G    VDSG++LT + ++QRI  N  +++ R + KEAKE+
Sbjct:   34 VRVWCDGCYDMVHYGHSNQLRQAKAMGDYLIVGVHTDEEISKHKGPPVFTQAERYKMVAGVEGGG---PGAPYVTTLETLDKYTSDFCVHGGTVCCVCYWL----------CFRECKRTQGVSTTDLVGRMLLMTKAHHSNIGNSE-----YQQHTDNFGRGPKGHSPWTGVSQFLQTSQKIIQFASG-KEPQPGDTIIYVAGAFDLFHIGHVDFLEAVYKLSDKPYVIVGLHFDQEVNRYKGKNYPIMNVHERTLSVLACRYVSEVVIGAPYTVSKDLLDHFKVDLVCHGKTEVFPDRDGSDPYTVPRRKGILRIVDSGNSLTTDDIVQRIIKNRLLFQARNQKKEAKEM 365          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:103043836])

HSP 1 Score: 117.087 bits (292), Expect = 3.873e-29
Identity = 63/138 (45.65%), Postives = 86/138 (62.32%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++PVRV+ DG FD+ H GHA AL QAK L     LIVGV SD+    +KG  V +E+ERY+ ++  ++VDEVV +AP+    E LEK+  DF AH D     A   D Y  +K A  F   +RT GIST+DL+ R+++
Sbjct:   48 DRPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDELTHKYKGFTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVR 185          

HSP 2 Score: 75.485 bits (184), Expect = 1.228e-14
Identity = 50/157 (31.85%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FDLFH GH   L +   L   +Y+IVGV SDE      G  + +M   ER  ++  C++V  VV   P+ +T+  +E   ID V H       A  ED+++  ++ G F        ++   LI RI  ++ +Y  R  ++   AKE+N S
Sbjct:   53 VYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDELTHKYKG--FTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVRDYDVYARRNLQRGYTAKELNVS 207          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: ECT1 (Ethanolamine-phosphate cytidylyltransferase; catalyzes the second step of phosphatidylethanolamine biosynthesis; involved in the maintenance of plasma membrane; similar to mammalian CTP: phosphocholine cytidylyl-transferases; inability of the null mutant to synthesize phosphatidylethanolamine and phosphatidylcholine from ethanolamine is functionally complemented by human PCYT2 [Source:SGD;Acc:S000003239])

HSP 1 Score: 168.703 bits (426), Expect = 1.732e-49
Identity = 114/343 (33.24%), Postives = 172/343 (50.15%), Query Frame = 1
Query:   82 PVRVWVDGCFDMLHFGHANALRQAKEL----GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQF---QQFIRGPRA--GEKVLYVPGSFDLFHVGHCMFLEECYKL------GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNK 1065
            P +VW+DGCFD  H GHA A+ QA+         L  GVH+D++I  +KG PV +  ERY+  +S +W  EVVE APYVT+   ++KY C +  HGDDIT+ A+G D Y  VK   +FK  KRT+G+STT+++ R+L   K       +    T ++S Y+     +     + Q       + G      E  +YV G FDLFH+G    +++  KL         +IVG+ + +   +       IM + ERVLSVLSCK+V  V+I              + D     + +C+       V    G+FS       LT E +++R++   ++Y  R + K
Sbjct:    7 PDKVWIDGCFDFTHHGHAGAILQARRTVSKENGKLFCGVHTDEDIQHNKGTPVMNSSERYEHTRSNRWCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANGEDCYKLVKEMGRFKVVKRTYGVSTTEIIHRIL-TKKSLPPTHPDYYPTTQELSFYSVAQDAVSKHCYVFQRDLDNVLVNGGYKFDAEDCVYVDGDFDLFHMGD---IDQLRKLKMDLHPDKKLIVGITTSDYSST-------IMTMKERVLSVLSCKYVDAVII--------------DADATSMSQYNCEKYHIGTAVLTAAGKFS-----EYLTKELIVKRVESQREVYIARNQKK 319          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: PCT1 (Cholinephosphate cytidylyltransferase; a rate-determining enzyme of the CDP-choline pathway for phosphatidylcholine synthesis, inhibited by Sec14p, activated upon lipid-binding; contains an element within the regulatory domain involved in both silencing and activation of enzymatic activity [Source:SGD;Acc:S000003434])

HSP 1 Score: 98.9821 bits (245), Expect = 3.376e-23
Identity = 52/138 (37.68%), Postives = 81/138 (58.70%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++P+R++ DG FD+ H GH   L Q K+      LIVGV SD      KG  V ++++R + +   +WVDEVV NAP+    E L ++  D+ AH D   V AD  D Y  +K   KF   +RT+G+ST+D++ ++++
Sbjct:  101 DRPIRIYADGVFDLFHLGHMKQLEQCKKAFPNVTLIVGVPSDKITHKLKGLTVLTDKQRCETLTHCRWVDEVVPNAPWCVTPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSDIITKIIR 238          

HSP 2 Score: 68.5514 bits (166), Expect = 3.916e-13
Identity = 42/143 (29.37%), Postives = 74/143 (51.75%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTH--CKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR 1053
            +Y  G FDLFH+GH   LE+C K      +IVGV SD+    + GL   ++   +R  ++  C++V  VV   P+ +T   +    ID V H        D++DI++  +++G+F T    + ++   +I +I  ++  Y +R
Sbjct:  106 IYADGVFDLFHLGHMKQLEQCKKAFPNVTLIVGVPSDKITHKLKGLT--VLTDKQRCETLTHCRWVDEVVPNAPWCVTPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSDIITKIIRDYDKYLMR 246          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO31320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY83])

HSP 1 Score: 363.999 bits (933), Expect = 2.571e-124
Identity = 177/350 (50.57%), Postives = 238/350 (68.00%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKE-----------NGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCK---DAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + K +RVW DGCFDM+HFGHANALRQAK +GD L VGVHSD EI  +KGPPVF+EEERYKM+++IKWVDEV+ENAPY T +ET++ + C+FC HGDDIT+ ADG DTYH VK A ++KE KRT G+STT+LV R+L ++K            +   V          S +T    FLP+S +I QF    R P+ G+K++Y  G+FDLFHVG   FLE+   LG Y+IVG+++D+ V    G  YPIMNL+ERVLSVL+C++V  V+I  PY +++ +++   +DLVVHG T      + ED + +PR+LG F T++S ST+T   ++ RI  N   +E R + KE KEI
Sbjct:    9 KKKQIRVWTDGCFDMVHFGHANALRQAKAMGDWLCVGVHSDAEIAHNKGPPVFNEEERYKMVRAIKWVDEVIENAPYTTTLETMDDHGCEFCVHGDDITLTADGTDTYHIVKDAGRYKECKRTAGVSTTNLVGRMLLLTKSHFDKGVPISALDPAEVSGASSDASAKSPWTCVSHFLPTSQRIVQFSDG-REPQPGDKIIYTAGAFDLFHVGFLDFLEKAKALGDYLIVGLHTDQIVNRYKGSNYPIMNLHERVLSVLACRYVDQVIIGAPYSVSQELIDQFKVDLVVHGNTPVMNDVNGEDPYRIPRKLGIFKTINSESTITTADIVARIIRNKLKFEERNRKKEKKEI 357          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO39372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC0])

HSP 1 Score: 100.523 bits (249), Expect = 2.796e-25
Identity = 56/141 (39.72%), Postives = 85/141 (60.28%), Query Frame = 1
Query:   79 KPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDI---TVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            +P+RV+ DG +D  HFGHA +L QAK        L+VGV SD+     KG  V +E+ERY  +   ++VDEV+ +AP++   + ++ +  DF AH DDI   T G    D Y  +K+  KF   +RT GIST+D++ R+++
Sbjct:    1 RPIRVYADGIYDCFHFGHARSLMQAKRAFPTEVYLMVGVCSDELTHKLKGFTVMTEDERYMSLLHSRYVDEVIRDAPWIVSPDFIDIHKIDFVAH-DDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDIIARVVK 140          

HSP 2 Score: 67.0106 bits (162), Expect = 2.358e-13
Identity = 42/159 (26.42%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHC---MFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHG----KTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRK---KNKEAKEIN 1083
            +Y  G +D FH GH    M  +  +    Y++VGV SDE    + G  + +M   ER +S+L  ++V  V+   P+ ++ + +++  ID V H     KT     +D+++  + +G+F   +    ++   +I R+  ++ +Y IR+   +   AKE+N
Sbjct:    5 VYADGIYDCFHFGHARSLMQAKRAFPTEVYLMVGVCSDELTHKLKG--FTVMTEDERYMSLLHSRYVDEVIRDAPWIVSPDFIDIHKIDFVAHDDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDIIARVVKDYDVY-IRRNLARGYTAKELN 160          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: PCYT2 (ethanolamine-phosphate cytidylyltransferase [Source:NCBI gene;Acc:101172414])

HSP 1 Score: 363.229 bits (931), Expect = 3.548e-123
Identity = 176/351 (50.14%), Postives = 245/351 (69.80%), Query Frame = 1
Query:   79 KPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG------------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + +RVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D EI  HKGPPVF++EERYKM+++IKWVDEVVE APYVT +ETL+KYNCDFC HGDDIT+  DG DTY +VK + +++E KRT G+STTDLV R+L ++K +   +++ +        +T  FG            FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  +KL    Y+IVG++ D+ V    G  YPIMN++ER LSVL+C++VS VVI  P+ +T+++++ L +DLV HGKT     KD  D +  PR+ G    VDSG++LT ++++QRI  N  ++E R + KEAKEI
Sbjct:   35 RKIRVWCDGCYDMVHYGHSNQLRQAKAMGDYLIVGVHTDSEISKHKGPPVFTQEERYKMVRAIKWVDEVVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDGKDTYEEVKKSGRYRECKRTQGVSTTDLVGRMLLMTKAHHSNIDSSD-----YKQHTDNFGKKGHSPWTGVSQFLQTSQKIIQFASG-QEPQPGDTIIYVAGAFDLFHIGHVDFLEAVHKLAENPYIIVGLHFDQEVNRYKGKNYPIMNIHERTLSVLACRYVSEVVIGAPFAVTKDLIDHLRVDLVCHGKTEIYPDKDGSDPYAEPRRKGILRMVDSGNSLTTDAIVQRIIKNRLLFETRNQKKEAKEI 379          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:101171141])

HSP 1 Score: 355.14 bits (910), Expect = 5.001e-120
Identity = 173/349 (49.57%), Postives = 243/349 (69.63%), Query Frame = 1
Query:   79 KPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG----------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
            + +RVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDE+VE APYVT +ETL+K++CDFC HGDDIT+  DG DTY +VK A +++E KRT G+STTDLV R+L ++K +   ++N +    K  ++ KG G          FL +S +I QF      P+ G+ ++YV G+FDLFH+GH  FLE  YK     YVIVG++ D+ V       YPIMN++ER LSVL+C++VS VVI  PY + +++++   +DLV HGKT     KD  D +  P++ G F ++DSG+ LT + ++QRI +N   +E R + KEAKE+
Sbjct:   30 REIRVWCDGCYDMVHYGHSNQLRQAKAMGDRLIVGVHTDEEISKHKGPPVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKHSCDFCVHGDDITLTVDGKDTYEEVKRAGRYRECKRTQGVSTTDLVGRMLLMTKAHHSTMDNPDYQEHK-DNFGKGPGGHSPWTGVCQFLQTSQKIIQFASG-EEPQPGDTIIYVAGAFDLFHIGHVDFLEMVYKQAERPYVIVGLHFDQEVNRYKRKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPDKDGSDPYSEPKRRGIFRSIDSGNNLTTDDIVQRIIENRLQFEARNQKKEAKEM 376          

HSP 2 Score: 62.003 bits (149), Expect = 4.114e-10
Identity = 41/155 (26.45%), Postives = 70/155 (45.16%), Query Frame = 1
Query:  571 PSSLQIAQFQQFIRGP--RAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            P   +  + Q   R P  R  E  ++  G +D+ H GH   L +   +G  +IVGV++DE +    G   P+    ER   V + K+V  +V   PY  T   ++  + D  VHG   T   D +D +E  ++ G++        ++   L+ R+
Sbjct:   10 PRGGEAGKPQSSARSPEKRRREIRVWCDGCYDMVHYGHSNQLRQAKAMGDRLIVGVHTDEEISKHKGP--PVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKHSCDFCVHGDDITLTVDGKDTYEEVKRAGRYRECKRTQGVSTTDLVGRM 162          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:101171141])

HSP 1 Score: 352.058 bits (902), Expect = 7.012e-119
Identity = 173/343 (50.44%), Postives = 239/343 (69.68%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSK-ENGCAVENGEC--ATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHC---KDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
             + +RVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D+EI  HKGPPVF++EERYKM+++IKWVDE+VE APYVT +ETL+K++CDFC HGDDIT+  DG DTY +VK A +++E KRT G+STTDLV R+L ++K  +   V  GE        S +T    FL +S +I QF      P+ G+ ++YV G+FDLFH+GH  FLE  YK     YVIVG++ D+ V       YPIMN++ER LSVL+C++VS VVI  PY + +++++   +DLV HGKT     KD  D +  P++ G F ++DSG+ LT + ++QRI +N   +E R + KEAKE+
Sbjct:   29 RREIRVWCDGCYDMVHYGHSNQLRQAKAMGDRLIVGVHTDEEISKHKGPPVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKHSCDFCVHGDDITLTVDGKDTYEEVKRAGRYRECKRTQGVSTTDLVGRMLLMTKAHHSTMVSLGEAWGGPGGHSPWTGVCQFLQTSQKIIQFASG-EEPQPGDTIIYVAGAFDLFHIGHVDFLEMVYKQAERPYVIVGLHFDQEVNRYKRKNYPIMNIHERTLSVLACRYVSEVVIGAPYAVGKDLLDHFKVDLVCHGKTEVFPDKDGSDPYSEPKRRGIFRSIDSGNNLTTDDIVQRIIENRLQFEARNQKKEAKEM 370          

HSP 2 Score: 61.6178 bits (148), Expect = 4.782e-10
Identity = 41/155 (26.45%), Postives = 70/155 (45.16%), Query Frame = 1
Query:  571 PSSLQIAQFQQFIRGP--RAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGK--THCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRI 1023
            P   +  + Q   R P  R  E  ++  G +D+ H GH   L +   +G  +IVGV++DE +    G   P+    ER   V + K+V  +V   PY  T   ++  + D  VHG   T   D +D +E  ++ G++        ++   L+ R+
Sbjct:   10 PRGGEAGKPQSSARSPEKRRREIRVWCDGCYDMVHYGHSNQLRQAKAMGDRLIVGVHTDEEISKHKGP--PVFTQEERYKMVRAIKWVDEIVEGAPYVTTLETLDKHSCDFCVHGDDITLTVDGKDTYEEVKRAGRYRECKRTQGVSTTDLVGRM 162          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: PCYT2 (ethanolamine-phosphate cytidylyltransferase [Source:NCBI gene;Acc:101172414])

HSP 1 Score: 298.13 bits (762), Expect = 3.393e-98
Identity = 155/350 (44.29%), Postives = 222/350 (63.43%), Query Frame = 1
Query:   73 ENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFG-----------FLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLG--TYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSC-KFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEI 1080
              + +RVW DGC+DM+H+GH+N LRQAK +GD LIVGVH+D EI  HKGPPVF++EERYKM+++IKWVDEVVE APYVT +ETL+KYNCDFC HGDDIT+  DG DTY +VK + +++E KRT G+STTDLV R+L ++K +   +++ +        +T  FG           FL +S +I QF    + P+ G+ ++YV G+FDLFH+GH  FLE  +KL    Y+IVG++ D+ +       +P +         +SC  +VS VVI  P+ +T+++++ L                     PR+ G    VDSG++LT ++++QRI  N  ++E R + KEAKEI
Sbjct:   33 RRRKIRVWCDGCYDMVHYGHSNQLRQAKAMGDYLIVGVHTDSEISKHKGPPVFTQEERYKMVRAIKWVDEVVEGAPYVTTLETLDKYNCDFCVHGDDITLTVDGKDTYEEVKKSGRYRECKRTQGVSTTDLVGRMLLMTKAHHSNIDSSD-----YKQHTDNFGKGHSPWTGVSQFLQTSQKIIQFASG-QEPQPGDTIIYVAGAFDLFHIGHVDFLEAVHKLAENPYIIVGLHFDQVI------LFPTLK--------MSCWLYVSEVVIGAPFAVTKDLIDHL-------------------REPRRKGILRMVDSGNSLTTDAIVQRIIKNRLLFETRNQKKEAKEI 343          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 116.701 bits (291), Expect = 4.773e-29
Identity = 64/138 (46.38%), Postives = 83/138 (60.14%), Query Frame = 1
Query:   76 NKPVRVWVDGCFDMLHFGHANALRQAKEL--GDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++PVRV+ DG FD+ H GHA AL QAK L     LIVGV SDD    +KG  V +E+ERY  I   ++VDEVV NAP+    E L K+  DF AH D     A   D Y  +K A  F   +RT GIST+D++ R+++
Sbjct:   53 DRPVRVYADGIFDVFHSGHARALMQAKRLFPNTHLIVGVCSDDLTHKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVR 190          

HSP 2 Score: 70.0922 bits (170), Expect = 6.943e-13
Identity = 46/157 (29.30%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  637 LYVPGSFDLFHVGHCMFLEECYKL--GTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDA--EDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIR--KKNKEAKEINYS 1089
            +Y  G FD+FH GH   L +  +L   T++IVGV SD+      G  + +MN  ER  ++  C++V  VV   P+ +T   +    ID V H       A  +D+++  +  G F+       ++   +I RI  ++ +Y  R  ++   AKE+N S
Sbjct:   58 VYADGIFDVFHSGHARALMQAKRLFPNTHLIVGVCSDDLTHKYKG--FTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYDVYVRRNLQRGYTAKELNVS 212          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000017201.1 (SMESG000017201.1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 347/348 (99.71%), Postives = 348/348 (100.00%), Query Frame = 1
Query:   67 MSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRIIS 1110
            MSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSA+KFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRIIS
Sbjct:    1 MSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSADKFKEFKRTHGISTTDLVDRLLQVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQFSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRIIS 348          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055914.1 (SMESG000055914.1)

HSP 1 Score: 102.064 bits (253), Expect = 3.168e-25
Identity = 49/139 (35.25%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRL 477
            S  +P+R++V+G FD+ H+GHAN   QAK        ++ GV  + + + +K  P+   EER   ++  + VDEV+ NAP++T VE L+++  DF  H        D  D Y ++K  N+F   KRT   STT ++D +
Sbjct:   46 SHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAI 184          

HSP 2 Score: 61.6178 bits (148), Expect = 6.362e-11
Identity = 51/152 (33.55%), Postives = 71/152 (46.71%), Query Frame = 1
Query:  526 ATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHC-MFLE-ECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKT--HCKDAEDIFEVPRQLGQF 969
            A M I  +  G  F P  L IA+     +G       +YV G FDLFH GH  +FL+ + Y  G   +V   SDE     Y  K PIM   ER+LSV  C+ V  V+   P+  T   ++   ID  +H  +     D  DI+E  ++  +F
Sbjct:   22 AEMGILRHQMGH-FKPIPLHIAE-----KGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRK-PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRF 166          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055917.1 (SMESG000055917.1)

HSP 1 Score: 101.679 bits (252), Expect = 3.880e-25
Identity = 49/139 (35.25%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRL 477
            S  +P+R++V+G FD+ H+GHAN   QAK        ++ GV  + + + +K  P+   EER   ++  + VDEV+ NAP++T VE L+++  DF  H        D  D Y ++K  N+F   KRT   STT ++D +
Sbjct:   46 SHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGKIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAI 184          

HSP 2 Score: 61.6178 bits (148), Expect = 5.568e-11
Identity = 51/152 (33.55%), Postives = 71/152 (46.71%), Query Frame = 1
Query:  526 ATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHC-MFLE-ECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKT--HCKDAEDIFEVPRQLGQF 969
            A M I  +  G  F P  L IA+     +G       +YV G FDLFH GH  +FL+ + Y  G   +V   SDE     Y  K PIM   ER+LSV  C+ V  V+   P+  T   ++   ID  +H  +     D  DI+E  ++  +F
Sbjct:   22 AEMGILRHQMGH-FKPIPLHIAE-----KGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGKIWVVAGVSDEKDCMKYKRK-PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRF 166          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055388.1 (SMESG000055388.1)

HSP 1 Score: 100.523 bits (249), Expect = 1.145e-24
Identity = 48/139 (34.53%), Postives = 78/139 (56.12%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRL 477
            S ++P+R++++G FDM H+GHAN   QAK        ++ GV  + + + +K  P+   EER   ++  + VDEV+ NAP++T VE L++Y  DF           D  D Y ++K  N+F   KRT   STT +++ +
Sbjct:   46 SHDRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGKIRVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEYRIDFAMIDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIINAI 184          

HSP 2 Score: 55.4546 bits (132), Expect = 7.491e-9
Identity = 50/167 (29.94%), Postives = 73/167 (43.71%), Query Frame = 1
Query:  481 QVSKENGCAVENGECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHC-MFLE-ECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNID--LVVHGKTHCKDAEDIFEVPRQLGQF 969
             ++  N         A M I  Y  G  F P  L +A+     R  R     +Y+ G FD+FH GH  +FL+ + Y  G   +V   SDE     Y  K PIM   ER+LSV  C+ V  V+   P+  T   ++   ID  ++        D  DI+E  ++  +F
Sbjct:    7 NITNRNSPLAYMSTDAEMGILRYQMGH-FKPIPLYVAEKGSHDRPIR-----IYIEGVFDMFHYGHANLFLQAKSYFPGKIRVVAGVSDEKDCMKYKRK-PIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEYRIDFAMIDPSPYPSGDVADIYEELKKQNRF 166          
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000081359.1 (SMESG000081359.1)

HSP 1 Score: 98.2117 bits (243), Expect = 8.908e-24
Identity = 46/141 (32.62%), Postives = 81/141 (57.45%), Query Frame = 1
Query:   70 SENKPVRVWVDGCFDMLHFGHANALRQAKELGDA---LIVGVHSDDEILFHKGPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDITVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQ 483
            ++N+P+R++V+G +D+ H+GHAN L QAK        ++ GV ++ E   +K  P+   +ER   ++  + VDEV+EN P++T +  L +   DF  H   +    D  D Y + K+  +F   KRT   STT+++D +++
Sbjct:   46 NQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIR 186          

HSP 2 Score: 55.4546 bits (132), Expect = 7.051e-9
Identity = 46/160 (28.75%), Postives = 73/160 (45.62%), Query Frame = 1
Query:  562 GFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLFHVGHC--MFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLSCKFVSNVVICPPYKITENMMEMLNIDLVVHGKT--HCKDAEDIFEVPRQLGQF----STVDSGSTLTFESLIQ 1017
             F P    IA+     +G +     +YV G +DLFH GH   +F  + Y  G   +V   S+E     Y  K PIM   ERVLSV  C+ V  V+   P+  T + +    +D ++H        D  D++E  +  G+F     T ++ +T   + +I+
Sbjct:   33 NFSPIPFDIAE-----KGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRK-PIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIR 186          
The following BLAST results are available for this feature:
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCYT21.357e-12150.14phosphate cytidylyltransferase 2, ethanolamine [So... [more]
PCYT23.121e-11847.33phosphate cytidylyltransferase 2, ethanolamine [So... [more]
PCYT26.817e-11449.71phosphate cytidylyltransferase 2, ethanolamine [So... [more]
PCYT23.457e-11248.29phosphate cytidylyltransferase 2, ethanolamine [So... [more]
PCYT21.531e-10154.28phosphate cytidylyltransferase 2, ethanolamine [So... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt-2.14.854e-11447.77Phosphocholine CYtidylylTransferase [Source:UniPr... [more]
pcyt-2.11.134e-11247.12Phosphocholine CYtidylylTransferase [Source:UniPr... [more]
pcyt-2.18.328e-11145.12Phosphocholine CYtidylylTransferase [Source:UniPr... [more]
pcyt-2.14.176e-7843.23Phosphocholine CYtidylylTransferase [Source:UniPr... [more]
pcyt-2.17.062e-7541.14Phosphocholine CYtidylylTransferase [Source:UniPr... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pect1.321e-12453.62gene:FBgn0032482 transcript:FBtr0080440[more]
Pect3.626e-12453.80gene:FBgn0032482 transcript:FBtr0334752[more]
Pect6.222e-12452.86gene:FBgn0032482 transcript:FBtr0080441[more]
Pect9.216e-12251.24gene:FBgn0032482 transcript:FBtr0080439[more]
Pcyt21.154e-2342.65gene:FBgn0035231 transcript:FBtr0072742[more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt24.897e-11848.84phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt22.108e-3543.06phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt1aa1.921e-2942.86phosphate cytidylyltransferase 1, choline, alpha a... [more]
pcyt1aa1.921e-2942.86phosphate cytidylyltransferase 1, choline, alpha a... [more]
pcyt1ba1.362e-2844.93phosphate cytidylyltransferase 1, choline, beta a ... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt25.449e-11548.55phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt21.230e-11048.94phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt23.887e-11048.65phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt24.636e-11047.79phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt27.396e-11047.93phosphate cytidylyltransferase 2, ethanolamine [So... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcyt21.767e-12150.42phosphate cytidylyltransferase 2, ethanolamine [So... [more]
Pcyt22.336e-11948.25phosphate cytidylyltransferase 2, ethanolamine [So... [more]
Pcyt1b1.014e-2744.20phosphate cytidylyltransferase 1, choline, beta is... [more]
Pcyt1b1.123e-2744.20phosphate cytidylyltransferase 1, choline, beta is... [more]
Pcyt1a7.510e-2744.53phosphate cytidylyltransferase 1, choline, alpha i... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5EA75|PCY2_BOVIN1.825e-12150.84Ethanolamine-phosphate cytidylyltransferase OS=Bos... [more]
sp|Q99447|PCY2_HUMAN6.515e-12150.14Ethanolamine-phosphate cytidylyltransferase OS=Hom... [more]
sp|O88637|PCY2_RAT3.530e-11948.65Ethanolamine-phosphate cytidylyltransferase OS=Rat... [more]
sp|Q922E4|PCY2_MOUSE1.634e-11848.25Ethanolamine-phosphate cytidylyltransferase OS=Mus... [more]
sp|Q55BZ4|PCY2_DICDI9.418e-11747.47Ethanolamine-phosphate cytidylyltransferase OS=Dic... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GA916.108e-13354.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GNV39.062e-13052.65Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JD441.608e-12852.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
C3XXM71.617e-12753.18Uncharacterized protein OS=Branchiostoma floridae ... [more]
N6T3N71.763e-12751.85Uncharacterized protein (Fragment) OS=Dendroctonus... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt23.201e-11747.99ethanolamine-phosphate cytidylyltransferase [Sourc... [more]
pcyt21.095e-11148.07ethanolamine-phosphate cytidylyltransferase [Sourc... [more]
ENSAMXT00000043395.14.604e-11047.29ethanolamine-phosphate cytidylyltransferase-like [... [more]
ENSAMXT00000039747.13.005e-9644.73ethanolamine-phosphate cytidylyltransferase-like [... [more]
pcyt1ba3.873e-2945.65phosphate cytidylyltransferase 1, choline, beta [S... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ECT11.732e-4933.24Ethanolamine-phosphate cytidylyltransferase; catal... [more]
PCT13.376e-2337.68Cholinephosphate cytidylyltransferase; a rate-dete... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO313202.571e-12450.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393722.796e-2539.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCYT23.548e-12350.14ethanolamine-phosphate cytidylyltransferase [Sourc... [more]
pcyt25.001e-12049.57phosphate cytidylyltransferase 2, ethanolamine [So... [more]
pcyt27.012e-11950.44phosphate cytidylyltransferase 2, ethanolamine [So... [more]
PCYT23.393e-9844.29ethanolamine-phosphate cytidylyltransferase [Sourc... [more]
pcyt1aa4.773e-2946.38phosphate cytidylyltransferase 1, choline, alpha [... [more]
back to top
BLAST of Ethanolamine-phosphate cytidylyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017201.10.000e+099.71SMESG000017201.1[more]
SMESG000055914.13.168e-2535.25SMESG000055914.1[more]
SMESG000055917.13.880e-2535.25SMESG000055917.1[more]
SMESG000055388.11.145e-2434.53SMESG000055388.1[more]
SMESG000081359.18.908e-2432.62SMESG000081359.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002505 ID=SMED30002505|Name=Ethanolamine-phosphate cytidylyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1238bp
CTTCTACTTCAAAATTTAAAATTCAAATATTATTGAACATTTGATTTAGA
ATAAAATTTGACTAGAATGAGTGAAAATAAACCTGTACGAGTTTGGGTTG
ACGGATGTTTCGATATGCTGCATTTCGGGCACGCCAATGCACTGAGACAG
GCAAAAGAATTGGGCGATGCTTTGATCGTAGGCGTTCATTCAGATGACGA
AATTCTATTCCACAAAGGTCCCCCCGTATTCTCAGAAGAAGAGAGATACA
AAATGATCAAGTCAATCAAATGGGTTGATGAGGTTGTTGAGAACGCTCCG
TATGTGACCGAGGTGGAAACTTTGGAGAAATACAATTGTGATTTCTGTGC
TCATGGAGATGACATAACAGTTGGAGCCGACGGACTGGACACATATCATA
AGGTAAAGTCTGCCAATAAATTCAAGGAATTTAAGCGCACTCATGGAATA
TCCACAACAGACCTCGTTGACAGACTGCTACAAGTATCGAAAGAAAACGG
CTGCGCAGTTGAGAACGGAGAATGTGCTACAATGAAGATTAGCAGTTACA
CAAAAGGTTTTGGATTTCTTCCAAGCTCACTTCAAATTGCTCAGTTCCAG
CAATTTATCAGAGGACCTCGAGCTGGAGAAAAAGTTTTATATGTGCCAGG
ATCCTTTGATCTCTTTCATGTTGGCCATTGCATGTTCCTAGAGGAGTGTT
ACAAACTTGGAACGTATGTGATCGTAGGAGTGTATTCAGATGAGACAGTC
AAGAGCATCTATGGATTGAAATATCCCATCATGAATCTCTATGAACGAGT
ATTATCAGTACTCAGTTGCAAGTTTGTATCGAACGTTGTGATTTGTCCAC
CCTACAAAATTACAGAAAACATGATGGAAATGTTGAATATTGATCTCGTT
GTACACGGAAAAACCCATTGCAAAGATGCCGAAGATATTTTCGAGGTGCC
GCGACAGCTGGGCCAATTCTCCACTGTTGACAGTGGCAGCACTTTGACTT
TTGAGTCGCTGATCCAACGCATCAAGGACAATTGGCAAATGTATGAGATT
AGAAAGAAAAATAAAGAAGCAAAAGAAATAAATTATTCCATATCTGATCG
AATCATATCCTGAATGGGGAGAAATCTCTCATTTCACTCTCTTTGACTCT
CCCATCGTAGCGGTGGTTTCCTGTGCAACTATCAGATAAATTGTGATTTT
TTCCTATTCAAATATATGCGAATCAATCTTAAAAAAAA
back to top

protein sequence of SMED30002505-orf-1

>SMED30002505-orf-1 ID=SMED30002505-orf-1|Name=SMED30002505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MSENKPVRVWVDGCFDMLHFGHANALRQAKELGDALIVGVHSDDEILFHK
GPPVFSEEERYKMIKSIKWVDEVVENAPYVTEVETLEKYNCDFCAHGDDI
TVGADGLDTYHKVKSANKFKEFKRTHGISTTDLVDRLLQVSKENGCAVEN
GECATMKISSYTKGFGFLPSSLQIAQFQQFIRGPRAGEKVLYVPGSFDLF
HVGHCMFLEECYKLGTYVIVGVYSDETVKSIYGLKYPIMNLYERVLSVLS
CKFVSNVVICPPYKITENMMEMLNIDLVVHGKTHCKDAEDIFEVPRQLGQ
FSTVDSGSTLTFESLIQRIKDNWQMYEIRKKNKEAKEINYSISDRIIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR041723CCT
IPR014729Rossmann-like_a/b/a_fold
IPR004821Cyt_trans-like
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
GO:0006629lipid metabolic process
GO:0006646phosphatidylethanolamine biosynthetic process
GO:0008654phospholipid biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004306ethanolamine-phosphate cytidylyltransferase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004821Cytidyltransferase-like domainTIGRFAMTIGR00125TIGR00125coord: 8..73
e-value: 1.6E-22
score: 77.4
coord: 192..256
e-value: 4.0E-12
score: 44.1
IPR004821Cytidyltransferase-like domainPFAMPF01467CTP_transf_likecoord: 192..288
e-value: 3.6E-13
score: 49.9
coord: 11..134
e-value: 2.6E-29
score: 102.3
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 163..326
e-value: 8.6E-46
score: 157.6
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 1..162
e-value: 3.1E-59
score: 202.3
NoneNo IPR availablePANTHERPTHR45780FAMILY NOT NAMEDcoord: 4..340
NoneNo IPR availablePANTHERPTHR45780:SF2ETHANOLAMINE-PHOSPHATE CYTIDYLYLTRANSFERASEcoord: 4..340
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 8..137
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 189..308
IPR041723CTP:phosphocholine cytidylyltransferase domainCDDcd02174CCTcoord: 5..143
e-value: 4.16416E-87
score: 257.111