Choline-phosphate cytidylyltransferase

Overview
NameCholine-phosphate cytidylyltransferase
Smed IDSMED30002502
Length (bp)733
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Choline-phosphate cytidylyltransferase (SMED30002502) t-SNE clustered cells

Violin plots show distribution of expression levels for Choline-phosphate cytidylyltransferase (SMED30002502) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Choline-phosphate cytidylyltransferase (SMED30002502) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Choline-phosphate cytidylyltransferase (SMED30002502) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002502

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002502SMESG000081359.1 PL030003A20D04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002502SMESG000081359.1 dd_Smed_v4_5385_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 137.117 bits (344), Expect = 1.284e-39
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:    9 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 148          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 137.502 bits (345), Expect = 9.236e-39
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1B (phosphate cytidylyltransferase 1, choline, beta [Source:HGNC Symbol;Acc:HGNC:8755])

HSP 1 Score: 137.117 bits (344), Expect = 3.288e-38
Identity = 63/142 (44.37%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++DLFH GHA  L QAK  FP   +++ GV ++    K+K   +M   ER  ++RHCR+VDEVI + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   74 DRPVRVYADGIFDLFHSGHARALMQAKTLFPN-SYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 137.502 bits (345), Expect = 4.744e-38
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:HGNC Symbol;Acc:HGNC:8754])

HSP 1 Score: 137.502 bits (345), Expect = 4.744e-38
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:680408:683257:1 gene:WBGene00021215.1 transcript:Y18H1A.11b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 144.821 bits (364), Expect = 4.351e-43
Identity = 74/174 (42.53%), Postives = 103/174 (59.20%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D EV   RE +   + I  + A  GN  RP+R+Y +GVYD+FHYGHAN   Q K   P  V+++ GV ++ E  K K + +   +ER  ++RHCR+VDEV +  PW   I FL E K+DFM HDA  Y      D+YE+ +  G F+ ++RTE  ST++ I  IIR Y+
Sbjct:   12 APFSDDVEVIKQREAIDYSTQITLEDAISGNVTRPVRVYADGVYDMFHYGHANQFLQIKQTLPN-VYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIRDYD 184          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:680408:683472:1 gene:WBGene00021215.1 transcript:Y18H1A.11a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 144.436 bits (363), Expect = 4.821e-42
Identity = 74/174 (42.53%), Postives = 103/174 (59.20%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D EV   RE +   + I  + A  GN  RP+R+Y +GVYD+FHYGHAN   Q K   P  V+++ GV ++ E  K K + +   +ER  ++RHCR+VDEV +  PW   I FL E K+DFM HDA  Y      D+YE+ +  G F+ ++RTE  ST++ I  IIR Y+
Sbjct:   12 APFSDDVEVIKQREAIDYSTQITLEDAISGNVTRPVRVYADGVYDMFHYGHANQFLQIKQTLPN-VYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIRDYD 184          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-1 (Putative choline-phosphate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P49583])

HSP 1 Score: 144.821 bits (364), Expect = 2.171e-41
Identity = 69/163 (42.33%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  153 REKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            RE +     I   +AE     RP+RIY +G+YDLFH+GHAN L Q K  FP  V+++ GV  + +  KYK + +   +ER   VRHCR+VDEV    PW  T+ FL   K+DF+ HDA  Y +    D+YE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   50 REAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFPN-VYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIRDYDK 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: pcyt-1 (Putative choline-phosphate cytidylyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P49583])

HSP 1 Score: 144.821 bits (364), Expect = 2.826e-41
Identity = 69/163 (42.33%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  153 REKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            RE +     I   +AE     RP+RIY +G+YDLFH+GHAN L Q K  FP  V+++ GV  + +  KYK + +   +ER   VRHCR+VDEV    PW  T+ FL   K+DF+ HDA  Y +    D+YE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   58 REAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFPN-VYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIRDYDK 219          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Match: Y18H1A.11 (pep chromosome:WBcel235:I:681355:683257:1 gene:WBGene00021215.1 transcript:Y18H1A.11d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y18H1A.11)

HSP 1 Score: 112.464 bits (280), Expect = 3.169e-31
Identity = 55/129 (42.64%), Postives = 78/129 (60.47%), Query Frame = 3
Query:  252 LFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +FHYGHAN   Q K   P  V+++ GV ++ E  K K + +   +ER  ++RHCR+VDEV +  PW   I FL E K+DFM HDA  Y      D+YE+ +  G F+ ++RTE  ST++ I  IIR Y+
Sbjct:    1 MFHYGHANQFLQIKQTLPN-VYLIVGVCSDEETMKNKGRTVQGEEERYEAIRHCRYVDEVYKASPWTCPIPFLKELKVDFMSHDALPYQGPAGEDIYEKHRTAGMFLETQRTEGISTSDSICRIIRDYD 128          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt2 (gene:FBgn0035231 transcript:FBtr0072742)

HSP 1 Score: 145.206 bits (365), Expect = 4.317e-41
Identity = 69/174 (39.66%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D++  +  E+      I + +A  G   R +R+Y +G+YDLFH GHA  L QAKN FP  V+++ GV N+    + K + +M   ER  +VRHCR+VDE++ N PW     F+ E+K+DF+ HD   Y +G V D+Y   KA G F+ ++RTE  ST++I+  I++ Y+
Sbjct:   44 APFSYDDKAMLELERCDYTQRITYHMARAGKTTRRVRVYADGIYDLFHQGHARQLMQAKNVFPN-VYLIVGVCNDELTLRMKGRTVMNGFERYEAVRHCRYVDEIVPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPLKAKGMFVATERTEGVSTSDIVARIVKDYD 216          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0072741)

HSP 1 Score: 147.517 bits (371), Expect = 6.253e-41
Identity = 68/174 (39.08%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D E  + R++      I + +A  G   R +R+Y +G+YDLFH GHA  L QAKN FP  V+++ GV N+    + K + +M   ER   VRHCR+VDE+++N PW  +  F+ +NK+DF+ HD   Y +  + D+Y   KA G F+ ++RTE  ST++I+  I++ Y+
Sbjct:  171 APYSHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARIVKDYD 343          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0072738)

HSP 1 Score: 147.517 bits (371), Expect = 6.253e-41
Identity = 68/174 (39.08%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D E  + R++      I + +A  G   R +R+Y +G+YDLFH GHA  L QAKN FP  V+++ GV N+    + K + +M   ER   VRHCR+VDE+++N PW  +  F+ +NK+DF+ HD   Y +  + D+Y   KA G F+ ++RTE  ST++I+  I++ Y+
Sbjct:  171 APYSHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARIVKDYD 343          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0333396)

HSP 1 Score: 147.517 bits (371), Expect = 6.253e-41
Identity = 68/174 (39.08%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D E  + R++      I + +A  G   R +R+Y +G+YDLFH GHA  L QAKN FP  V+++ GV N+    + K + +M   ER   VRHCR+VDE+++N PW  +  F+ +NK+DF+ HD   Y +  + D+Y   KA G F+ ++RTE  ST++I+  I++ Y+
Sbjct:  171 APYSHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARIVKDYD 343          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Match: Pcyt1 (gene:FBgn0041342 transcript:FBtr0345365)

HSP 1 Score: 147.517 bits (371), Expect = 6.253e-41
Identity = 68/174 (39.08%), Postives = 105/174 (60.34%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A  S D E  + R++      I + +A  G   R +R+Y +G+YDLFH GHA  L QAKN FP  V+++ GV N+    + K + +M   ER   VRHCR+VDE+++N PW  +  F+ +NK+DF+ HD   Y +  + D+Y   KA G F+ ++RTE  ST++I+  I++ Y+
Sbjct:  171 APYSHDEEAMLERDRCDYTQRITYQMARSGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPN-VYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARIVKDYD 343          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta a [Source:ZFIN;Acc:ZDB-GENE-061220-4])

HSP 1 Score: 146.362 bits (368), Expect = 7.418e-42
Identity = 74/171 (43.27%), Postives = 104/171 (60.82%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            T  E +   EKLT       D A  G   +RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++    KYK   +M  DER  ++RHCR+VDEV+ + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P+KRTE  ST+++I  I+R Y+
Sbjct:   25 TSCECRAPHEKLT------VDQASHGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHKYKGFTVMTEDERYEALRHCRYVDEVLRDAPWTLTQDFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTKRTEGISTSDLITRIVRDYD 188          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1bb (phosphate cytidylyltransferase 1, choline, beta b [Source:ZFIN;Acc:ZDB-GENE-051120-48])

HSP 1 Score: 137.117 bits (344), Expect = 4.507e-38
Identity = 63/142 (44.37%), Postives = 90/142 (63.38%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
             RP+R+Y +G++DLFH GHA  L QAKN FP    +V GV ++    KYK   +M  DER  ++ HCR+VDEV+ + PW  T  FL ++++DF+ HD   Y S    DVY+  K  G F+ ++RTE  ST++II  I+R Y+
Sbjct:   69 QRPVRVYADGIFDLFHSGHARALMQAKNLFPNTQLIV-GVCSDALTHKYKGYTVMTEDERYEALIHCRYVDEVVRDAPWTLTSEFLKKHRIDFVAHDDIPYTSAGSEDVYKHIKEAGMFVATQRTEGISTSDIITRIVRDYD 209          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 135.576 bits (340), Expect = 1.913e-37
Identity = 63/142 (44.37%), Postives = 90/142 (63.38%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    K K   +M  DER  +V HCR+VDEV+ N PW  T  FL ++++DF+ HD   Y S D  DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   71 DRPVRVYADGIFDMFHSGHARALMQAKCLFPN-THLIVGVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha a [Source:ZFIN;Acc:ZDB-GENE-050417-108])

HSP 1 Score: 135.576 bits (340), Expect = 1.913e-37
Identity = 63/142 (44.37%), Postives = 90/142 (63.38%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    K K   +M  DER  +V HCR+VDEV+ N PW  T  FL ++++DF+ HD   Y S D  DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   71 DRPVRVYADGIFDMFHSGHARALMQAKCLFPN-THLIVGVCSDDLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRNAPWTLTPEFLTKHRIDFVAHDDIPYSSADSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Match: pcyt1ab (phosphate cytidylyltransferase 1, choline, alpha b [Source:ZFIN;Acc:ZDB-GENE-050522-114])

HSP 1 Score: 130.568 bits (327), Expect = 1.088e-35
Identity = 61/143 (42.66%), Postives = 88/143 (61.54%), Query Frame = 3
Query:  210 QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            + RP+R+Y +G++D+FH GHA  L QAK  FP    +V G + ++   K+    +M  DER  +V HCR+VDEV+ N PW  +  FL E+++DF+ HD   Y S    DVY   K  G F P++RTE  ST++II  I+R Y+
Sbjct:   70 EERPVRVYADGIFDMFHSGHARALMQAKCLFPNTYLIVGGCTFKI-VFKFDGFXVMNEDERYDAVCHCRYVDEVVRNAPWTLSPEFLAEHRIDFVAHDDIPYISAGTDDVYRHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 211          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: cmtm3 (CKLF-like MARVEL transmembrane domain containing 3 [Source:Xenbase;Acc:XB-GENE-1011270])

HSP 1 Score: 140.584 bits (353), Expect = 3.258e-39
Identity = 65/142 (45.77%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+   KYK   +M   ER  ++RHCR+VDE+I + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   74 DRPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLLVGVCSDEL-THKYKGFTVMNETERYEALRHCRYVDEIITDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 132.88 bits (333), Expect = 3.543e-36
Identity = 68/169 (40.24%), Postives = 101/169 (59.76%), Query Frame = 3
Query:  135 NEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +E+K+ R K   +  +  + A+ G    RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+     K   +M   ER  +V+HCR+VDEV+ N PW  +  FL ++++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   61 DELKVDRSK--TYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 226          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 132.88 bits (333), Expect = 5.428e-36
Identity = 68/169 (40.24%), Postives = 101/169 (59.76%), Query Frame = 3
Query:  135 NEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +E+K+ R K   +  +  + A+ G    RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+     K   +M   ER  +V+HCR+VDEV+ N PW  +  FL ++++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   82 DELKVDRSK--TYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 247          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: PCYT1A (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:100496938])

HSP 1 Score: 132.109 bits (331), Expect = 6.307e-36
Identity = 68/169 (40.24%), Postives = 101/169 (59.76%), Query Frame = 3
Query:  135 NEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +E+K+ R K   +  +  + A+ G    RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+     K   +M   ER  +V+HCR+VDEV+ N PW  +  FL ++++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   49 DELKVDRSK--TYRRVSMEEAKLGTPIERPVRVYADGIFDLFHSGHARALMQAKNLFPNTHLIVGVCSDEL-THNLKGFTVMNEAERYDAVQHCRYVDEVVRNAPWTLSPEFLEKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Match: pcyt2 (phosphate cytidylyltransferase 2, ethanolamine [Source:NCBI gene;Acc:496753])

HSP 1 Score: 92.8189 bits (229), Expect = 2.489e-21
Identity = 43/135 (31.85%), Postives = 78/135 (57.78%), Query Frame = 3
Query:  222 IRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHII 626
            +R++ +G YD+ HYGH+N L QA+       +++ GV  + E  ++K  P+   +ER   V+  + VDE++   P++TT+  L++   DF +H   +  + D  D YEE K  GR+   +RT+  STT+++  ++
Sbjct:   19 VRVWCDGCYDMVHYGHSNQLRQARAMGG---YLIVGVHTDEEISQHKGPPVFTQEERYKMVKAIKWVDEIVPGAPYVTTLETLDKYNCDFCVHGNDITLTVDGKDTYEEVKNAGRYRECQRTQGVSTTDLVGRML 150          

HSP 2 Score: 77.0258 bits (188), Expect = 9.832e-16
Identity = 48/138 (34.78%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  228 IYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRK--PIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHD-AKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRS 632
            IYV G +DLFH GH + L +  +    P +V+ G+  + E   YKRK  PIM   ER LSV  CR+V EV+   P+  +   L+  K+D + H    + P  D +D Y E K    F       + +T +I+  II++
Sbjct:  211 IYVAGAFDLFHIGHIDFLEKVYSLAEKP-YVIVGLHFDQEVNHYKRKNYPIMNIHERTLSVLACRYVAEVVIGAPYSVSADLLDHFKVDIVCHGKTDVLPDRDGSDPYAEPKRRAIFRVVDSGNSLTTDDIVQRIIKN 347          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 137.502 bits (345), Expect = 2.032e-38
Identity = 63/142 (44.37%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++DLFH GHA  L QAK  FP   +++ GV ++    K+K   +M   ER  ++RHCR+VDEVI + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   44 DRPVRVYADGIFDLFHSGHARALMQAKTLFPNS-YLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 184          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 137.117 bits (344), Expect = 4.419e-38
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 137.117 bits (344), Expect = 4.419e-38
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1a (phosphate cytidylyltransferase 1, choline, alpha isoform [Source:MGI Symbol;Acc:MGI:88557])

HSP 1 Score: 137.117 bits (344), Expect = 4.419e-38
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Match: Pcyt1b (phosphate cytidylyltransferase 1, choline, beta isoform [Source:MGI Symbol;Acc:MGI:2147987])

HSP 1 Score: 137.117 bits (344), Expect = 4.451e-38
Identity = 63/142 (44.37%), Postives = 92/142 (64.79%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +RP+R+Y +G++DLFH GHA  L QAK  FP   +++ GV ++    K+K   +M   ER  ++RHCR+VDEVI + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   74 DRPVRVYADGIFDLFHSGHARALMQAKTLFPN-SYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P49583|PCY1_CAEEL (Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans OX=6239 GN=F08C6.2 PE=3 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.595e-40
Identity = 69/163 (42.33%), Postives = 99/163 (60.74%), Query Frame = 3
Query:  153 REKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            RE +     I   +AE     RP+RIY +G+YDLFH+GHAN L Q K  FP  V+++ GV  + +  KYK + +   +ER   VRHCR+VDEV    PW  T+ FL   K+DF+ HDA  Y +    D+YE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   58 REAVDYSKKITLAMAEANEAGRPVRIYADGIYDLFHHGHANQLRQVKKMFPN-VYLIVGVCGDRDTHKYKGRTVTSEEERYDGVRHCRYVDEVYREAPWFCTVEFLKNLKVDFIAHDAIPYVAPGEEDLYEKFRREGMFLETERTEGVSTSDVVCRIIRDYDK 219          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|O74975|PCY1_SCHPO (Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1827.02c PE=1 SV=3)

HSP 1 Score: 142.124 bits (357), Expect = 3.415e-39
Identity = 66/144 (45.83%), Postives = 93/144 (64.58%), Query Frame = 3
Query:  210 QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            + RP+R+Y +GV+DLFH GH   L QAK  FP  V ++ G+ N+    + K   +M   ER  ++RHC+ VDEV+EN PW+ T  FL E+K+DF+ HD   Y S D  D+Y   K  G+FIP+KRTE  ST+++I  IIR Y++
Sbjct:   98 EGRPVRVYADGVFDLFHIGHMRQLEQAKKVFPN-VHLIVGLPNDQLTHRLKGLTVMNDKERAEALRHCKWVDEVLENAPWVITPEFLEEHKIDFVAHDDIPYASDDSGDIYLPVKKVGKFIPTKRTEGVSTSDLITRIIRDYDQ 240          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|Q9ZV56|CCT1_ARATH (Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CCT1 PE=1 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 2.373e-38
Identity = 64/145 (44.14%), Postives = 97/145 (66.90%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYP--SGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            +RP+R+Y +G+YDLFH+GHA  L QAK  FP   +++ G  N+    KYK + +M ++ER  S+RHC+ VDEVI + PW+    FL+++++D++ HD+  Y   SG   DVYE  K  GRF  ++RTE  ST++II  I++ YN+
Sbjct:   32 DRPVRVYADGIYDLFHFGHARSLEQAKLAFPNNTYLLVGCCNDETTHKYKGRTVMTAEERYESLRHCKWVDEVIPDAPWVVNQEFLDKHQIDYVAHDSLPYADSSGAGKDVYEFVKKVGRFKETQRTEGISTSDIIMRIVKDYNQ 176          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|F4JJE0|CCT2_ARATH (Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CCT2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.807e-37
Identity = 65/144 (45.14%), Postives = 96/144 (66.67%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYP--SGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            RP+R+Y +G++DLFH+GHA  + QAK  FP   +++ G  N+    K+K K +M   ER  S+RHC+ VDEVI + PW+ T  FL+++K+D++ HDA  Y   SG   DVYE  K+ G+F  +KRTE  ST++II  I++ YN+
Sbjct:   19 RPVRVYADGIFDLFHFGHARAIEQAKKSFPN-TYLLVGCCNDEITNKFKGKTVMTESERYESLRHCKWVDEVIPDAPWVLTTEFLDKHKIDYVAHDALPYADTSGAGNDVYEFVKSIGKFKETKRTEGISTSDIIMRIVKDYNQ 161          
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Match: sp|P19836|PCY1A_RAT (Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus OX=10116 GN=Pcyt1a PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 2.231e-37
Identity = 63/141 (44.68%), Postives = 91/141 (64.54%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++     +K   +M  +ER  +V+HCR+VDEV+ N PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   75 RPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLIVGVCSDELTHNFKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 214          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A2B4S9R8 (Choline-phosphate cytidylyltransferase B OS=Stylophora pistillata OX=50429 GN=Pcyt1b PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.351e-43
Identity = 70/157 (44.59%), Postives = 102/157 (64.97%), Query Frame = 3
Query:  168 NFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            N  PI    A+ G   RPIR+Y +GVYD++H+GHA  L QAK  FP  V+++ GVSN+    KYK   +M  DER  S+RHCR+VDEVI + PW  T  F+  +K+DF+ HD   Y S    D+Y++ KA G+F+ ++RTE  ST+++I  +++ Y+
Sbjct:   66 NLEPISLQDAKDGKATRPIRVYADGVYDVYHFGHARALMQAKQAFPTEVYLMVGVSNDDLTHKYKGFTVMTEDERYESLRHCRYVDEVICDAPWEVTPDFIELHKIDFVAHDDLPYKSAGADDIYKQVKAMGKFVATQRTEGISTSDLIARVVKDYD 222          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A0N5AN37 (CTP_transf_like domain-containing protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.756e-43
Identity = 78/177 (44.07%), Postives = 108/177 (61.02%), Query Frame = 3
Query:  111 CLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            C A  S +      RE++     I    A++    RP+RIY +GVYDLFHYGHAN L QAKN FP  V+++ GV  +    KYK + +   DER  +VRHCR+VDEV ++ PW  TI FL   K+DF+ HDA  Y +    D+YE+ +  G FI ++RTE  ST++++  IIR Y+K
Sbjct:   46 CAAPYSDEPAAIAERERVDYSKKITIQCAKENKAGRPVRIYADGVYDLFHYGHANQLRQAKNMFPN-VYLIVGVCGDASTHKYKGRTVTSEDERYEAVRHCRYVDEVYKDAPWYCTIEFLKSLKVDFIAHDALPYKAEGEHDLYEKFRNEGMFIETERTEGVSTSDVVCRIIRDYDK 221          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A0N4V1W6 (CTP_transf_like domain-containing protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS3675 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.177e-43
Identity = 73/163 (44.79%), Postives = 105/163 (64.42%), Query Frame = 3
Query:  153 REKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            RE++     I   +A++    RP+RIY +G+YDLFHYGHAN L QAKN FP  V+++ GV  +    KYK + +   DER  +VRHCR+VDEV  + PW  T+ FL E K+DF+ HDA  Y +    D+YE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   44 RERVDYSKKITIQMAKENRAGRPVRIYADGIYDLFHYGHANQLRQAKNMFPN-VYLIVGVCGDANTHKYKGRTVTSEDERYEAVRHCRYVDEVYRDAPWYCTLEFLKELKVDFIAHDAIPYQAEGETDLYEKFRKEGMFVETERTEGVSTSDVVCRIIRDYDK 205          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A0N5CZ83 (CTP_transf_like domain-containing protein OS=Thelazia callipaeda OX=103827 GN=TCLT_LOCUS5779 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.426e-43
Identity = 78/175 (44.57%), Postives = 109/175 (62.29%), Query Frame = 3
Query:  117 AKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            A  S D ++   RE +     +  ++A+ G   RPIRIY +GVYDLFHYGHAN L QAK+ F   V+++ GV  + +  KYK + +   DER   VRHCR+VDEV +N PW  T+ FL   K+DF+ HDA  Y     ADVYE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   29 APYSDDPDIIAQRELIDYSVKVTLEMAKSGKVGRPIRIYADGVYDLFHYGHANQLQQAKSAFQN-VYLIVGVCGDADTLKYKGRTVTSEDERYEGVRHCRYVDEVYKNAPWCCTVEFLKSLKIDFVAHDAIPYAIPGDADVYEKFRREGMFLETQRTEGVSTSDVVCRIIRDYDK 202          
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Match: A0A158Q5Q5 (CTP_transf_like domain-containing protein OS=Dracunculus medinensis OX=318479 GN=DME_LOCUS2097 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 8.003e-43
Identity = 73/172 (42.44%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSP-IPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            +D+E+ I R    ++S  +  ++A+ G   R IR+Y +G+YDLFHYGHAN L QAKN FP  V+++ GV  +    KYK + +   DER  +VRHCR+VDEV  + PW  ++ FL   K+DF+ HDA  Y +    D+YE+ +  G F+ ++RTE  ST++++  IIR Y+K
Sbjct:   33 SDDEIAISRRNRIDYSKKVTMEMAKSGKAGREIRVYADGIYDLFHYGHANQLRQAKNAFPN-VYLIVGVCGDANTHKYKGRTVTSEDERYEAVRHCRYVDEVYRDAPWYCSVEFLKNLKVDFIAHDALPYVAPGEEDLYEKFRREGMFVETQRTEGVSTSDVVCRIIRDYDK 203          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:103043836])

HSP 1 Score: 144.436 bits (363), Expect = 3.828e-41
Identity = 74/171 (43.27%), Postives = 103/171 (60.23%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            T  E +   EKLT       D A  G   +RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+   KYK   +M  DER  ++RHCR+VDEV+ + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST+++I  I+R Y+
Sbjct:   31 TSCECRAPHEKLT------VDQARLGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDEL-THKYKGFTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVRDYD 194          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:103043836])

HSP 1 Score: 144.436 bits (363), Expect = 3.859e-41
Identity = 74/171 (43.27%), Postives = 103/171 (60.23%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            T  E +   EKLT       D A  G   +RP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+   KYK   +M  DER  ++RHCR+VDEV+ + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST+++I  I+R Y+
Sbjct:   25 TSCECRAPHEKLT------VDQARLGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPNSYLIVGVCSDEL-THKYKGFTVMTEDERYEALRHCRYVDEVVRDAPWTLTQEFLEKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDLITRIVRDYD 188          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ab (choline-phosphate cytidylyltransferase A-like [Source:NCBI gene;Acc:103031553])

HSP 1 Score: 140.198 bits (352), Expect = 2.119e-39
Identity = 69/169 (40.83%), Postives = 103/169 (60.95%), Query Frame = 3
Query:  135 NEVKIIREKLTNFSPIPFDIAEKGN-QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            ++++++R K T  S    + A +G   NRP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    K K   +M  DER  +V HCR+VDEV+ + PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   46 DQLEVVRAKYTRVS---LEEARRGTPANRPVRVYADGIFDMFHSGHARALMQAKRLFPN-THLIVGVCSDGLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRDAPWTLTAEFLTEHRIDFVAHDDIPYVSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 210          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1ab (choline-phosphate cytidylyltransferase A-like [Source:NCBI gene;Acc:103031553])

HSP 1 Score: 140.198 bits (352), Expect = 2.119e-39
Identity = 69/169 (40.83%), Postives = 103/169 (60.95%), Query Frame = 3
Query:  135 NEVKIIREKLTNFSPIPFDIAEKGN-QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            ++++++R K T  S    + A +G   NRP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    K K   +M  DER  +V HCR+VDEV+ + PW  T  FL E+++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   46 DQLEVVRAKYTRVS---LEEARRGTPANRPVRVYADGIFDMFHSGHARALMQAKRLFPN-THLIVGVCSDGLTHKLKGFTVMNEDERYDAVSHCRYVDEVVRDAPWTLTAEFLTEHRIDFVAHDDIPYVSAGSDDVYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYD 210          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Match: pcyt1bb (choline-phosphate cytidylyltransferase B-like [Source:NCBI gene;Acc:103029238])

HSP 1 Score: 138.658 bits (348), Expect = 4.543e-39
Identity = 66/149 (44.30%), Postives = 95/149 (63.76%), Query Frame = 3
Query:  195 AEKGN-QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A +G   +RP+R+Y +G++DLFH GHA  L QAKN FP    ++ GV N+    KYK   +M  DER  ++ HCR+VDEV+ N PW  T  FL ++++DF+ HD   Y S    DVY+  KA G F+ ++RTE  ST+++I  I+R Y+
Sbjct:   51 ARRGTPAHRPVRVYADGIFDLFHSGHARALMQAKNLFPN-THLIVGVCNDELTHKYKGYTVMTEDERYEALIHCRYVDEVVRNAPWSLTPEFLKKHRIDFVAHDDIPYTSAGSDDVYKHIKAAGMFVATQRTEGISTSDLITRIVRDYD 198          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: PCT1 (Cholinephosphate cytidylyltransferase; a rate-determining enzyme of the CDP-choline pathway for phosphatidylcholine synthesis, inhibited by Sec14p, activated upon lipid-binding; contains an element within the regulatory domain involved in both silencing and activation of enzymatic activity [Source:SGD;Acc:S000003434])

HSP 1 Score: 126.331 bits (316), Expect = 1.733e-34
Identity = 62/143 (43.36%), Postives = 88/143 (61.54%), Query Frame = 3
Query:  213 NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNK 641
            +RPIRIY +GV+DLFH GH   L Q K  FP  V ++ GV ++    K K   ++   +R  ++ HCR VDEV+ N PW  T  FL E+K+D++ HD   Y S D  D+Y+  K  G+F+ ++RT   ST++II  IIR Y+K
Sbjct:  101 DRPIRIYADGVFDLFHLGHMKQLEQCKKAFPN-VTLIVGVPSDKITHKLKGLTVLTDKQRCETLTHCRWVDEVVPNAPWCVTPEFLLEHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTNGVSTSDIITKIIRDYDK 242          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Match: ECT1 (Ethanolamine-phosphate cytidylyltransferase; catalyzes the second step of phosphatidylethanolamine biosynthesis; involved in the maintenance of plasma membrane; similar to mammalian CTP: phosphocholine cytidylyl-transferases; inability of the null mutant to synthesize phosphatidylethanolamine and phosphatidylcholine from ethanolamine is functionally complemented by human PCYT2 [Source:SGD;Acc:S000003239])

HSP 1 Score: 76.2554 bits (186), Expect = 7.530e-17
Identity = 42/139 (30.22%), Postives = 73/139 (52.52%), Query Frame = 3
Query:  219 PIRIYVEGVYDLFHYGHANLLFQAKNYFP---GPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHII 626
            P +++++G +D  H+GHA  + QA+       G ++   GV  + + +  K  P+M S ER    R  R   EV+E  P++T  +++++ +  +++H   +    +  D Y+  K  GRF   KRT   STTEII  I+
Sbjct:    7 PDKVWIDGCFDFTHHGHAGAILQARRTVSKENGKLF--CGVHTDEDIQHNKGTPVMNSSERYEHTRSNRWCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANGEDCYKLVKEMGRFKVVKRTYGVSTTEIIHRIL 143          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO39372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC0])

HSP 1 Score: 134.42 bits (337), Expect = 1.141e-39
Identity = 61/143 (42.66%), Postives = 95/143 (66.43%), Query Frame = 3
Query:  216 RPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVA--DVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            RPIR+Y +G+YD FH+GHA  L QAK  FP  V+++ GV ++    K K   +M  DER +S+ H R+VDEVI + PWI +  F++ +K+DF+ HD   Y +  +   DVY++ KA G+F+ ++RTE  ST++II  +++ Y+
Sbjct:    1 RPIRVYADGIYDCFHFGHARSLMQAKRAFPTEVYLMVGVCSDELTHKLKGFTVMTEDERYMSLLHSRYVDEVIRDAPWIVSPDFIDIHKIDFVAHDDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDIIARVVKDYD 143          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO31320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY83])

HSP 1 Score: 95.5153 bits (236), Expect = 4.273e-23
Identity = 47/139 (33.81%), Postives = 76/139 (54.68%), Query Frame = 3
Query:  210 QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHII 626
            + + IR++ +G +D+ H+GHAN L QAK       W+  GV ++ E    K  P+   +ER   VR  + VDEVIEN P+ TT+  ++++  +F +H   +  + D  D Y   K  GR+   KRT   STT ++  ++
Sbjct:    9 KKKQIRVWTDGCFDMVHFGHANALRQAKAMGD---WLCVGVHSDAEIAHNKGPPVFNEEERYKMVRAIKWVDEVIENAPYTTTLETMDDHGCEFCVHGDDITLTADGTDTYHIVKDAGRYKECKRTAGVSTTNLVGRML 144          

HSP 2 Score: 63.1586 bits (152), Expect = 1.223e-11
Identity = 42/137 (30.66%), Postives = 68/137 (49.64%), Query Frame = 3
Query:  228 IYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRK--PIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMH-DAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIR 629
            IY  G +DLFH G  + L +AK       +++ G+  +    +YK    PIM   ERVLSV  CR+VD+VI   P+  +   +++ K+D ++H +  +    +  D Y   +  G F         +T +I+  IIR
Sbjct:  207 IYTAGAFDLFHVGFLDFLEKAKALGD---YLIVGLHTDQIVNRYKGSNYPIMNLHERVLSVLACRYVDQVIIGAPYSVSQELIDQFKVDLVVHGNTPVMNDVNGEDPYRIPRKLGIFKTINSESTITTADIVARIIR 340          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Match: EDO25505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWA4])

HSP 1 Score: 44.669 bits (104), Expect = 1.286e-6
Identity = 20/54 (37.04%), Postives = 36/54 (66.67%), Query Frame = 3
Query:  483 LDFMMHDAKLYPSGDVA--DVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            +DF+ HD   Y +  +   DVY++ KA G+F+ ++RTE  ST++II  +++ Y+
Sbjct:    1 IDFVAHDDIPYKTAGMQTDDVYKDIKAMGKFVATERTEGISTSDIIARVVKDYD 54          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:101166014])

HSP 1 Score: 142.51 bits (358), Expect = 4.703e-41
Identity = 71/171 (41.52%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            T  + +   EKLT       + A +G   +RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++    KYK   +M   ER  ++RHCR+VDEV+ + PW  T  FL+++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   25 TSCDCRAPHEKLT------IEQARRGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLLVGVCSDELTHKYKGFTVMTEQERYEALRHCRYVDEVLRDAPWTLTPKFLDKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 188          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1ba (phosphate cytidylyltransferase 1, choline, beta [Source:NCBI gene;Acc:101166014])

HSP 1 Score: 141.739 bits (356), Expect = 4.255e-40
Identity = 71/171 (41.52%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  129 TDNEVKIIREKLTNFSPIPFDIAEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            T  + +   EKLT       + A +G   +RP+R+Y +G++DLFH GHA  L QAKN FP   +++ GV ++    KYK   +M   ER  ++RHCR+VDEV+ + PW  T  FL+++K+DF+ HD   Y S    DVY+  K  G F+P++RTE  ST++II  I+R Y+
Sbjct:   25 TSCDCRAPHEKLT------IEQARRGTPVDRPVRVYADGIFDLFHSGHARALMQAKNLFPN-TYLLVGVCSDELTHKYKGFTVMTEQERYEALRHCRYVDEVLRDAPWTLTPKFLDKHKIDFVAHDDIPYSSAGSEDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYD 188          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1bb (choline-phosphate cytidylyltransferase B [Source:NCBI gene;Acc:101162151])

HSP 1 Score: 136.732 bits (343), Expect = 4.445e-38
Identity = 66/149 (44.30%), Postives = 94/149 (63.09%), Query Frame = 3
Query:  195 AEKGN-QNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A KG   NRP+R+Y +G++DLFH GHA  L QAKN FP    +V   S+E+   K K   +M  +ER  ++RHCR+VDEV+ + PW  T  FL ++K+DF+ HD   Y S    DVY+  K  G F+ ++RTE  ST+++I  I+R Y+
Sbjct:   55 ARKGTPANRPVRVYADGIFDLFHSGHARALMQAKNVFPNTHLIVGVCSDEL-THKLKGYTVMTEEERYDALRHCRYVDEVVRDAPWTLTPEFLKKHKIDFVAHDDIPYTSAGSEDVYKHIKEAGMFVATERTEGISTSDLITRIVRDYD 202          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 134.806 bits (338), Expect = 1.932e-37
Identity = 64/149 (42.95%), Postives = 94/149 (63.09%), Query Frame = 3
Query:  195 AEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A++G   +RP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    KYK   +M  DER  ++ HCR+VDEV+ N PW  T  FL ++++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   46 AKRGTPPDRPVRVYADGIFDVFHSGHARALMQAKRLFPN-THLIVGVCSDDLTHKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 193          
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Match: pcyt1aa (phosphate cytidylyltransferase 1, choline, alpha [Source:NCBI gene;Acc:101157809])

HSP 1 Score: 134.806 bits (338), Expect = 2.930e-37
Identity = 64/149 (42.95%), Postives = 94/149 (63.09%), Query Frame = 3
Query:  195 AEKGNQ-NRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYN 638
            A++G   +RP+R+Y +G++D+FH GHA  L QAK  FP    ++ GV ++    KYK   +M  DER  ++ HCR+VDEV+ N PW  T  FL ++++DF+ HD   Y S    DVY+  K  G F P++RTE  ST++II  I+R Y+
Sbjct:   65 AKRGTPPDRPVRVYADGIFDVFHSGHARALMQAKRLFPN-THLIVGVCSDDLTHKYKGFTVMNEDERYDAITHCRYVDEVVRNAPWTLTPEFLAKHRIDFVAHDDIPYSSAGSDDVYKHIKDAGMFAPTQRTEGISTSDIITRIVRDYD 212          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000081359.1 (SMESG000081359.1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.464e-143
Identity = 191/191 (100.00%), Postives = 191/191 (100.00%), Query Frame = 3
Query:   72 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNKS 644
            MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNKS
Sbjct:    1 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNKS 191          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055917.1 (SMESG000055917.1)

HSP 1 Score: 280.026 bits (715), Expect = 2.399e-96
Identity = 128/187 (68.45%), Postives = 153/187 (81.82%), Query Frame = 3
Query:   72 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRS 632
            MTFN + I   NS LA +STD E+ I+R ++ +F PIP  IAEKG+  RPIRIYVEGV+DLFHYGHANL  QAK+YFPG +WVVAGVS+E +C KYKRKPIM+++ER+LSVRHCRHVDEVI N PWITT+ FL+E+++DF MHD   YPSGDVAD+YEE K   RFIPSKRTENTSTT+IID I R+
Sbjct:    1 MTFNIENITNRNSPLAYMSTDAEMGILRHQMGHFKPIPLHIAEKGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGKIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAIGRT 187          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055914.1 (SMESG000055914.1)

HSP 1 Score: 279.256 bits (713), Expect = 6.283e-96
Identity = 128/187 (68.45%), Postives = 153/187 (81.82%), Query Frame = 3
Query:   72 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRS 632
            MTFN + I   NS LA +STD E+ I+R ++ +F PIP  IAEKG+  RPIRIYVEGV+DLFHYGHANL  QAK+YFPG +WVVAGVS+E +C KYKRKPIM+++ER+LSVRHCRHVDEVI N PWITT+ FL+E+++DF MHD   YPSGDVAD+YEE K   RFIPSKRTENTSTT+IID I R+
Sbjct:    1 MTFNIENITNLNSPLAYMSTDAEMGILRHQMGHFKPIPLHIAEKGSHGRPIRIYVEGVFDLFHYGHANLFLQAKSYFPGQIWVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEHRIDFAMHDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIIDAIGRT 187          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000055388.1 (SMESG000055388.1)

HSP 1 Score: 264.618 bits (675), Expect = 3.642e-90
Identity = 122/187 (65.24%), Postives = 151/187 (80.75%), Query Frame = 3
Query:   72 MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPSGDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRS 632
            MTFN + I   NS LA +STD E+ I+R ++ +F PIP  +AEKG+ +RPIRIY+EGV+D+FHYGHANL  QAK+YFPG + VVAGVS+E +C KYKRKPIM+++ER+LSVRHCRHVDEVI N PWITT+ FL+E ++DF M D   YPSGDVAD+YEE K   RFIPSKRTENTSTT+II+ I R+
Sbjct:    1 MTFNIENITNRNSPLAYMSTDAEMGILRYQMGHFKPIPLYVAEKGSHDRPIRIYIEGVFDMFHYGHANLFLQAKSYFPGKIRVVAGVSDEKDCMKYKRKPIMKTEERILSVRHCRHVDEVIPNAPWITTVEFLDEYRIDFAMIDPSPYPSGDVADIYEELKKQNRFIPSKRTENTSTTQIINAIGRT 187          
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Match: SMESG000047771.1 (SMESG000047771.1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.652e-24
Identity = 49/117 (41.88%), Postives = 66/117 (56.41%), Query Frame = 3
Query:  102 NNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRPIRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKPIMRSDERVLSVRHCRHVDEVIENVPWI 452
            N  C  KL  D    I          I  + A+ G   R IR+Y +GVYD+FH GHA  L QAKN FP  ++++AGV N+ +    K K +M  DER  +VRHCR+VDEV+ + P +
Sbjct:   11 NEECALKLLNDCNYSI---------KISLNQAKSGLAPRQIRVYADGVYDMFHAGHARQLLQAKNAFPN-IYLIAGVCNDADTNYNKGKTVMTEDERYEAVRHCRYVDEVLTDAPGL 117          
The following BLAST results are available for this feature:
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCYT1A1.284e-3944.68phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A9.236e-3944.68phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1B3.288e-3844.37phosphate cytidylyltransferase 1, choline, beta [S... [more]
PCYT1A4.744e-3844.68phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A4.744e-3844.68phosphate cytidylyltransferase 1, choline, alpha [... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y18H1A.114.351e-4342.53pep chromosome:WBcel235:I:680408:683257:1 gene:WBG... [more]
Y18H1A.114.821e-4242.53pep chromosome:WBcel235:I:680408:683472:1 gene:WBG... [more]
pcyt-12.171e-4142.33Putative choline-phosphate cytidylyltransferase [... [more]
pcyt-12.826e-4142.33Putative choline-phosphate cytidylyltransferase [... [more]
Y18H1A.113.169e-3142.64pep chromosome:WBcel235:I:681355:683257:1 gene:WBG... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcyt24.317e-4139.66gene:FBgn0035231 transcript:FBtr0072742[more]
Pcyt16.253e-4139.08gene:FBgn0041342 transcript:FBtr0072741[more]
Pcyt16.253e-4139.08gene:FBgn0041342 transcript:FBtr0072738[more]
Pcyt16.253e-4139.08gene:FBgn0041342 transcript:FBtr0333396[more]
Pcyt16.253e-4139.08gene:FBgn0041342 transcript:FBtr0345365[more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba7.418e-4243.27phosphate cytidylyltransferase 1, choline, beta a ... [more]
pcyt1bb4.507e-3844.37phosphate cytidylyltransferase 1, choline, beta b ... [more]
pcyt1aa1.913e-3744.37phosphate cytidylyltransferase 1, choline, alpha a... [more]
pcyt1aa1.913e-3744.37phosphate cytidylyltransferase 1, choline, alpha a... [more]
pcyt1ab1.088e-3542.66phosphate cytidylyltransferase 1, choline, alpha b... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cmtm33.258e-3945.77CKLF-like MARVEL transmembrane domain containing 3... [more]
PCYT1A3.543e-3640.24phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A5.428e-3640.24phosphate cytidylyltransferase 1, choline, alpha [... [more]
PCYT1A6.307e-3640.24phosphate cytidylyltransferase 1, choline, alpha [... [more]
pcyt22.489e-2131.85phosphate cytidylyltransferase 2, ethanolamine [So... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcyt1b2.032e-3844.37phosphate cytidylyltransferase 1, choline, beta is... [more]
Pcyt1a4.419e-3844.68phosphate cytidylyltransferase 1, choline, alpha i... [more]
Pcyt1a4.419e-3844.68phosphate cytidylyltransferase 1, choline, alpha i... [more]
Pcyt1a4.419e-3844.68phosphate cytidylyltransferase 1, choline, alpha i... [more]
Pcyt1b4.451e-3844.37phosphate cytidylyltransferase 1, choline, beta is... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49583|PCY1_CAEEL3.595e-4042.33Putative choline-phosphate cytidylyltransferase OS... [more]
sp|O74975|PCY1_SCHPO3.415e-3945.83Probable choline-phosphate cytidylyltransferase OS... [more]
sp|Q9ZV56|CCT1_ARATH2.373e-3844.14Choline-phosphate cytidylyltransferase 1 OS=Arabid... [more]
sp|F4JJE0|CCT2_ARATH1.807e-3745.14Choline-phosphate cytidylyltransferase 2 OS=Arabid... [more]
sp|P19836|PCY1A_RAT2.231e-3744.68Choline-phosphate cytidylyltransferase A OS=Rattus... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4S9R81.351e-4344.59Choline-phosphate cytidylyltransferase B OS=Stylop... [more]
A0A0N5AN374.756e-4344.07CTP_transf_like domain-containing protein OS=Sypha... [more]
A0A0N4V1W65.177e-4344.79CTP_transf_like domain-containing protein OS=Enter... [more]
A0A0N5CZ836.426e-4344.57CTP_transf_like domain-containing protein OS=Thela... [more]
A0A158Q5Q58.003e-4342.44CTP_transf_like domain-containing protein OS=Dracu... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba3.828e-4143.27phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1ba3.859e-4143.27phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1ab2.119e-3940.83choline-phosphate cytidylyltransferase A-like [Sou... [more]
pcyt1ab2.119e-3940.83choline-phosphate cytidylyltransferase A-like [Sou... [more]
pcyt1bb4.543e-3944.30choline-phosphate cytidylyltransferase B-like [Sou... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PCT11.733e-3443.36Cholinephosphate cytidylyltransferase; a rate-dete... [more]
ECT17.530e-1730.22Ethanolamine-phosphate cytidylyltransferase; catal... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO393721.141e-3942.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313204.273e-2333.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO255051.286e-637.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcyt1ba4.703e-4141.52phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1ba4.255e-4041.52phosphate cytidylyltransferase 1, choline, beta [S... [more]
pcyt1bb4.445e-3844.30choline-phosphate cytidylyltransferase B [Source:N... [more]
pcyt1aa1.932e-3742.95phosphate cytidylyltransferase 1, choline, alpha [... [more]
pcyt1aa2.930e-3742.95phosphate cytidylyltransferase 1, choline, alpha [... [more]
back to top
BLAST of Choline-phosphate cytidylyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081359.12.464e-143100.00SMESG000081359.1[more]
SMESG000055917.12.399e-9668.45SMESG000055917.1[more]
SMESG000055914.16.283e-9668.45SMESG000055914.1[more]
SMESG000055388.13.642e-9065.24SMESG000055388.1[more]
SMESG000047771.12.652e-2441.88SMESG000047771.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002502 ID=SMED30002502|Name=Choline-phosphate cytidylyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=733bp
CACAACAGTAACAATATAATTCATAAGTTATTTTCTAATTGTTAACTATA
AAATTTTTCTCTGATACCACAATGACATTTAATTTTGACGAAATAAAATA
CAATAATTCTTGTCTGGCTAAATTGTCAACAGATAATGAAGTCAAAATAA
TCAGAGAAAAGCTTACTAATTTTTCCCCAATTCCTTTTGACATTGCTGAA
AAAGGAAATCAAAATCGTCCTATTCGAATTTATGTCGAAGGAGTTTACGA
TTTGTTTCATTATGGTCATGCGAATCTTTTGTTTCAAGCAAAAAATTATT
TCCCAGGACCTGTGTGGGTAGTTGCTGGAGTCTCGAATGAAGTGGAATGT
GAAAAGTACAAACGGAAACCGATTATGAGATCTGACGAACGAGTGTTATC
AGTAAGACATTGCCGTCATGTTGACGAAGTAATCGAGAATGTCCCATGGA
TAACCACAATTTCATTTCTAAATGAGAACAAATTGGATTTCATGATGCAT
GACGCAAAATTATATCCAAGTGGAGATGTAGCAGATGTTTATGAAGAAGC
AAAAGCGAATGGGAGATTTATTCCGAGCAAAAGAACAGAAAATACAAGTA
CAACAGAAATAATTGATCACATTATTAGATCATATAATAAATCATGAACA
ATTAAATTAATATGATGTTAAAATTGTAATTGATTGGGAAAGAATTTTCT
GATACTTAAAATATCTTCAAATGTAAAATGATT
back to top

protein sequence of SMED30002502-orf-1

>SMED30002502-orf-1 ID=SMED30002502-orf-1|Name=SMED30002502-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=192bp
MTFNFDEIKYNNSCLAKLSTDNEVKIIREKLTNFSPIPFDIAEKGNQNRP
IRIYVEGVYDLFHYGHANLLFQAKNYFPGPVWVVAGVSNEVECEKYKRKP
IMRSDERVLSVRHCRHVDEVIENVPWITTISFLNENKLDFMMHDAKLYPS
GDVADVYEEAKANGRFIPSKRTENTSTTEIIDHIIRSYNKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004821Cyt_trans-like
IPR014729Rossmann-like_a/b/a_fold
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004821Cytidyltransferase-like domainTIGRFAMTIGR00125TIGR00125coord: 52..120
e-value: 1.2E-12
score: 45.8
IPR004821Cytidyltransferase-like domainPFAMPF01467CTP_transf_likecoord: 55..181
e-value: 3.5E-21
score: 75.9
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 14..191
e-value: 5.4E-56
score: 191.7
NoneNo IPR availablePANTHERPTHR10739:SF13CTP:PHOSPHOCHOLINE CYTIDYLYLTRANSFERASE 1, ISOFORM A-RELATEDcoord: 28..190
NoneNo IPR availablePANTHERPTHR10739CYTIDYLYLTRANSFERASEcoord: 28..190
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 52..184