SMED30002481

Overview
NameSMED30002481
Smed IDSMED30002481
Length (bp)1051
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30002481 (SMED30002481) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30002481 (SMED30002481) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30002481 (SMED30002481) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30002481 (SMED30002481) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002481

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002481SMESG000059949.1 SMESG000059950.1 dd_Smed_v4_3563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002481SMESG000059949.1 SMESG000059950.1 dd_Smed_v4_3563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002481SMESG000059949.1 SMESG000059950.1 dd_Smed_v4_3563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002481SMESG000059949.1 SMESG000059950.1 dd_Smed_v4_3563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30002481 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.034123:2750..3749 -3184
v31.004339:43971..44952 -3092
Homology
BLAST of SMED30002481 vs. Ensembl Human
Match: FAM210A (family with sequence similarity 210 member A [Source:HGNC Symbol;Acc:HGNC:28346])

HSP 1 Score: 87.0409 bits (214), Expect = 4.898e-19
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. Ensembl Human
Match: FAM210A (family with sequence similarity 210 member A [Source:HGNC Symbol;Acc:HGNC:28346])

HSP 1 Score: 87.0409 bits (214), Expect = 5.997e-19
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. Ensembl Human
Match: FAM210A (family with sequence similarity 210 member A [Source:HGNC Symbol;Acc:HGNC:28346])

HSP 1 Score: 87.0409 bits (214), Expect = 5.997e-19
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. Ensembl Human
Match: FAM210A (family with sequence similarity 210 member A [Source:HGNC Symbol;Acc:HGNC:28346])

HSP 1 Score: 87.0409 bits (214), Expect = 5.997e-19
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. Ensembl Human
Match: FAM210A (family with sequence similarity 210 member A [Source:HGNC Symbol;Acc:HGNC:28346])

HSP 1 Score: 56.9954 bits (136), Expect = 3.837e-9
Identity = 29/88 (32.95%), Postives = 45/88 (51.14%), Query Frame = -1
Query:  539 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNL 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + ++
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSI 178          
BLAST of SMED30002481 vs. Ensembl Celegans
Match: Y56A3A.22 (pep chromosome:WBcel235:III:11921692:11923825:1 gene:WBGene00013239.1 transcript:Y56A3A.22.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y56A3A.22)

HSP 1 Score: 60.4622 bits (145), Expect = 3.006e-10
Identity = 39/116 (33.62%), Postives = 56/116 (48.28%), Query Frame = -1
Query:  392 KIEEQP-TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIG--KPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKE 730
            K EE P T+F + K  +  Y  + +  H  +   WF   Y +V SGVDV ++   LH P+ I   +       G V  + +L KI M FRY  T+ L +     LRRLG +   +E
Sbjct:   72 KAEEAPKTLFAKVKYYFKRYWYIAVPAHAASCTAWFIALYLVVKSGVDVISLLEWLHMPDAIVEKVKNTPETAGVVVVSLILYKIAMPFRYMTTLLLIQATFWTLRRLGKLKTARE 187          
BLAST of SMED30002481 vs. Ensembl Fly
Match: CG14613 (gene:FBgn0031188 transcript:FBtr0335047)

HSP 1 Score: 77.0258 bits (188), Expect = 4.857e-16
Identity = 42/135 (31.11%), Postives = 67/135 (49.63%), Query Frame = -1
Query:  305 IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 709
            +F +FK  Y  Y  + I VH++T  GWFG FY+L  SGVDV A+   +H    I   +     G  A AY+  K+    RY LT+  T     +L + GY+ P+  ++ ++ +  + K        +K E+  +E
Sbjct:  107 LFAKFKHMYKQYWYVLIPVHVLTSVGWFGGFYYLSKSGVDVPALLQYIHLSENIIEKVQGSDMGHYAIAYLCYKVATPLRYALTLGCTTVSIKYLVQHGYIKPMPTKSELIKMYEDKKATRASAKADKAEKDERE 241          
BLAST of SMED30002481 vs. Ensembl Fly
Match: CG14613 (gene:FBgn0031188 transcript:FBtr0077367)

HSP 1 Score: 77.0258 bits (188), Expect = 4.857e-16
Identity = 42/135 (31.11%), Postives = 67/135 (49.63%), Query Frame = -1
Query:  305 IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 709
            +F +FK  Y  Y  + I VH++T  GWFG FY+L  SGVDV A+   +H    I   +     G  A AY+  K+    RY LT+  T     +L + GY+ P+  ++ ++ +  + K        +K E+  +E
Sbjct:  107 LFAKFKHMYKQYWYVLIPVHVLTSVGWFGGFYYLSKSGVDVPALLQYIHLSENIIEKVQGSDMGHYAIAYLCYKVATPLRYALTLGCTTVSIKYLVQHGYIKPMPTKSELIKMYEDKKATRASAKADKAEKDERE 241          
BLAST of SMED30002481 vs. Ensembl Zebrafish
Match: fam210ab (family with sequence similarity 210 member Ab [Source:NCBI gene;Acc:503762])

HSP 1 Score: 84.7297 bits (208), Expect = 2.767e-18
Identity = 50/140 (35.71%), Postives = 73/140 (52.14%), Query Frame = -1
Query:  320 IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIK-------EENRILNLANEGKEQTKQKLKNKFE 709
            IFQRFK+T+  YGK+ + VHIVT   WFG FY+    GV++      +  P+WI  ++     G   TAY + K+    RY +T+  T     +LR+ GY++   P+K       EE R   L  E  E+TK++   K E
Sbjct:  101 IFQRFKKTFKQYGKVMVPVHIVTSTVWFGSFYYAAMKGVNLVPFLEFIGLPDWIVGILRDSQGGYALTAYAMYKLATPARYTVTMGGTSLSVQYLRKHGYLSTPPPVKEFLQDKMEETR--ELLTEKMEETKERFSEKME 238          
BLAST of SMED30002481 vs. Ensembl Zebrafish
Match: fam210aa (family with sequence similarity 210 member Aa [Source:NCBI gene;Acc:562734])

HSP 1 Score: 83.1889 bits (204), Expect = 5.533e-18
Identity = 54/177 (30.51%), Postives = 88/177 (49.72%), Query Frame = -1
Query:  305 SFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE---------ENRILNLANEGKEQTKQKL---KNKFERKVKE 772
            + CS  S+  + + + E  P       + QRFK+T+  YGK+ I VH++T   WFG FY+    GV++      + FP+ +  L+     G   TAY + KI    RY +T+  T     +LR+ GYM+   P+KE         + RI     E K++  +++   K+KF  K++E
Sbjct:   54 ALCSPTSQKTSASGQEEPDPLHDKSSGLIQRFKKTFKQYGKVMIPVHLLTSTMWFGTFYYAAMKGVNLVPFLEYVGFPDKVVKLLENSQSGYALTAYAMYKIATPARYTVTLGGTSLSVKYLRKHGYMSTPPPVKEYLQEKMEETKERISGKMEETKDRFSERMEETKDKFNEKLQE 230          
BLAST of SMED30002481 vs. Ensembl Zebrafish
Match: fam210aa (family with sequence similarity 210 member Aa [Source:NCBI gene;Acc:562734])

HSP 1 Score: 83.1889 bits (204), Expect = 5.533e-18
Identity = 54/177 (30.51%), Postives = 88/177 (49.72%), Query Frame = -1
Query:  305 SFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE---------ENRILNLANEGKEQTKQKL---KNKFERKVKE 772
            + CS  S+  + + + E  P       + QRFK+T+  YGK+ I VH++T   WFG FY+    GV++      + FP+ +  L+     G   TAY + KI    RY +T+  T     +LR+ GYM+   P+KE         + RI     E K++  +++   K+KF  K++E
Sbjct:   54 ALCSPTSQKTSASGQEEPDPLHDKSSGLIQRFKKTFKQYGKVMIPVHLLTSTMWFGTFYYAAMKGVNLVPFLEYVGFPDKVVKLLENSQSGYALTAYAMYKIATPARYTVTLGGTSLSVKYLRKHGYMSTPPPVKEYLQEKMEETKERISGKMEETKDRFSERMEETKDKFNEKLQE 230          
BLAST of SMED30002481 vs. Ensembl Zebrafish
Match: fam210b (family with sequence similarity 210 member B [Source:ZFIN;Acc:ZDB-GENE-050913-122])

HSP 1 Score: 50.8322 bits (120), Expect = 6.169e-7
Identity = 30/116 (25.86%), Postives = 50/116 (43.10%), Query Frame = -1
Query:  413 QKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLG 760
            +   V++     E + +  Q+ ++ +  YG + +  HI       G+FY  V SG+DV ++   L F   +       G      AY + K+F   R  +T+     I  HLRR G
Sbjct:   99 RSDGVSSAADGSELKASKVQQLRQVFQQYGAVGVSFHICISLISLGIFYLAVSSGLDVASLLCKLGFSEAVVQSRLAAGTSVFVLAYAVHKLFAPLRISITLVCVPLIVRHLRRTG 214          
BLAST of SMED30002481 vs. Ensembl Xenopus
Match: mical3 (microtubule associated monooxygenase, calponin and LIM domain containing 3 [Source:Xenbase;Acc:XB-GENE-996271])

HSP 1 Score: 70.8626 bits (172), Expect = 2.357e-13
Identity = 38/113 (33.63%), Postives = 61/113 (53.98%), Query Frame = -1
Query:  404 NTSKIEEQPT-IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA 739
             T  +++Q   + +RFK+T+  +GK+ I VH+VT   WFG FY+    GV+V      +  P+ I N++     G   TAY + KI    RY +T+  T     +LR+ GY++
Sbjct:   99 ETDPLQDQSIGLLKRFKKTFKQHGKVLIPVHLVTSSFWFGSFYYAAMKGVNVVPFLEFIGLPDVIVNILKNSQGGNALTAYAMYKIATPARYTVTLGGTSLSVKYLRKYGYLS 211          
BLAST of SMED30002481 vs. Ensembl Mouse
Match: Fam210a (family with sequence similarity 210, member A [Source:MGI Symbol;Acc:MGI:1914000])

HSP 1 Score: 81.6481 bits (200), Expect = 3.267e-17
Identity = 53/165 (32.12%), Postives = 87/165 (52.73%), Query Frame = -1
Query:  320 FNRSFCSQK--SKVNNNTSKIEEQP-TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 781
             + S  SQ+  S+    T  ++++  +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ I +++     G   TAY + KI    RY +T+  T +   +LR  GYM+   P+KE  + R+     L  E  E+TK +L  K +
Sbjct:   96 LSSSSTSQETPSEKKEETDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGIWFGTFYYATIKGVNVIPFLEVIGLPDSIVDILKNSQSGNALTAYAMFKIATPARYTVTLGGTSFTVKYLRSHGYMSTPPPVKEYLQGRMEETKELITEKMEETKDRLTEKLQ 260          
BLAST of SMED30002481 vs. Ensembl Mouse
Match: Fam210b (family with sequence similarity 210, member B [Source:MGI Symbol;Acc:MGI:1914267])

HSP 1 Score: 50.447 bits (119), Expect = 5.537e-7
Identity = 29/130 (22.31%), Postives = 59/130 (45.38%), Query Frame = -1
Query:  401 GNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAP 790
            G+  +R   ++  +   + +  E++ +  Q+ K+ +  YG + + +HI       G+FY +V SG+D+ A+   L F   +       G      AY + K+F   R  +T+    ++  + R +G   P
Sbjct:   56 GDCLSRQEPNRTPEPGGSVTGTEKKLSRTQQLKKVFQEYGAVGVSMHIGISLVSLGIFYTVVSSGIDMSAILLKLGFKESLVQSKMAAGTSTFVVAYAIHKLFAPVRISITLVSVPFVVRYFRSVGLFKP 185          
BLAST of SMED30002481 vs. UniProt/SwissProt
Match: sp|Q96ND0|F210A_HUMAN (Protein FAM210A OS=Homo sapiens OX=9606 GN=FAM210A PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.880e-18
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. UniProt/SwissProt
Match: sp|Q5RE99|F210A_PONAB (Protein FAM210A OS=Pongo abelii OX=9601 GN=FAM210A PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.179e-18
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = -1
Query:  320 SFNRSFCSQKSKVNNNTSKIEEQP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 784
            SF R F S  +       K E  P      +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ + +++     G   TAY L KI    RY +T+  T     +LR  GYM+   P+KE  ++R+     L  E  E+TK +L  K +
Sbjct:   91 SFRRVFSSNATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFGTFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQ 259          
BLAST of SMED30002481 vs. UniProt/SwissProt
Match: sp|Q5ZML6|F210A_CHICK (Protein FAM210A OS=Gallus gallus OX=9031 GN=FAM210A PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.846e-18
Identity = 50/140 (35.71%), Postives = 75/140 (53.57%), Query Frame = -1
Query:  317 TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRILNLAN---EGKEQTKQKLKNKFER 712
            ++ QRFK+T+  YGK+ I VH+VT   WFG FY+    GV+V      +  P+ I +++     G   TAY L KI    RY +T+  T     +LR+ GYM+   P+KE  ++R+    +   E  E+TK K+  K E 
Sbjct:  113 SLVQRFKKTFKQYGKVMIPVHLVTSTVWFGSFYYAAMKGVNVVPFLELIGLPDSIVDILKNSQSGNALTAYALYKIATPARYTVTLGGTSITVKYLRKNGYMSTPPPVKEYLQDRMEETKDKITEKMEETKDKITEKMEE 252          
BLAST of SMED30002481 vs. UniProt/SwissProt
Match: sp|Q05B67|F210A_BOVIN (Protein FAM210A OS=Bos taurus OX=9913 GN=FAM210A PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.739e-18
Identity = 49/139 (35.25%), Postives = 76/139 (54.68%), Query Frame = -1
Query:  320 TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE--ENRIL---NLANEGKEQTKQKLKNKFE 712
            +++QRFK+T+  YGK+ I VH++T   WFG FY+    GV+V      +  P+ I N++     G   TAY L KI    RY +T+  T +   +LR  GYM+   P+KE  ++++     L  E  E+TK +L  K +
Sbjct:  122 SLYQRFKKTFRQYGKVLIPVHLITSAVWFGTFYYAAMKGVNVVPFLELIGLPDSIVNILKNSQSGNALTAYALFKIATPARYTVTLGGTSFTVKYLRSRGYMSTPPPVKEYLQDKMEETKELLTEKMEETKDRLTEKLQ 260          
BLAST of SMED30002481 vs. UniProt/SwissProt
Match: sp|Q5CZQ0|CR19B_DANRE (Uncharacterized protein C18orf19 homolog B OS=Danio rerio OX=7955 GN=zgc:113036 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.259e-17
Identity = 50/140 (35.71%), Postives = 73/140 (52.14%), Query Frame = -1
Query:  320 IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIK-------EENRILNLANEGKEQTKQKLKNKFE 709
            IFQRFK+T+  YGK+ + VHIVT   WFG FY+    GV++      +  P+WI  ++     G   TAY + K+    RY +T+  T     +LR+ GY++   P+K       EE R   L  E  E+TK++   K E
Sbjct:  101 IFQRFKKTFKQYGKVMVPVHIVTSTVWFGSFYYAAMKGVNLVPFLEFIGLPDWIVGILRDSQGGYALTAYAMYKLATPARYTVTMGGTSLSVQYLRKHGYLSTPPPVKEFLQDKMEETR--ELLTEKMEETKERFSEKME 238          
BLAST of SMED30002481 vs. TrEMBL
Match: A0A183QYR3 (DUF1279 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.865e-28
Identity = 71/215 (33.02%), Postives = 116/215 (53.95%), Query Frame = -1
Query:  317 YKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNL--IGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFER 955
            ++  ++PI  N      ++   + Y S  S  P    R+ K +K  ++   F  F      +     ++ NN     + + ++ +RFK+ YA YGK+ +V H VT C WFGLFY L  +GV++  +  SL+ P+W+T    +G      +ATA V  K+ + FRYGLT+ LTRY+  +LR  G    ++E +R+ NLA EG E ++++LK +  R
Sbjct:   26 HRTTLSPICRNDSKFPPVRCSQIQY-SLFSKDP----RSPKFLKIPISLTTFAQFSTESKNNIPPDVNE-NNENDLDKRKSSLVKRFKDAYAIYGKVVLVTHGVTSCLWFGLFYSLACTGVNLLDILQSLNAPDWLTKPLHLGGGTVNTLATAIVFYKLMVPFRYGLTLILTRYLVRYLRLKGKAPQVQENDRLRNLAKEGAEISRERLKARMAR 234          
BLAST of SMED30002481 vs. TrEMBL
Match: G4VKZ8 (DUF1279 domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_016890 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.235e-27
Identity = 61/150 (40.67%), Postives = 96/150 (64.00%), Query Frame = -1
Query:  317 SKVN-NNTSKIEEQ-PTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNL--IGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFER 754
            S VN NN + +E++  ++ +RFK+ YA YGK+ +V+H VT C WFGLFY L  +G+++  +  SL+ P W++    +G      +ATA V  K+ + FRYGLT+ LTRY+  +LR  G    ++E +R+ NLA EG E ++++LK +  R
Sbjct:   84 SNVNENNENDLEKRKSSLIKRFKDAYAIYGKVVLVIHGVTSCLWFGLFYSLACTGINLLDILQSLNAPEWLSKPLHLGGGTVNTLATAIVFYKLMVPFRYGLTLILTRYLVRYLRLKGKAPQVQENDRLRNLAKEGAEISRERLKARMAR 233          
BLAST of SMED30002481 vs. TrEMBL
Match: A0A5K3FB12 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.605e-27
Identity = 63/169 (37.28%), Postives = 91/169 (53.85%), Query Frame = -1
Query:  308 FCSQKSKVNNNTSKIEEQP--------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPG--YGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKN-----KFERKVK 769
            F S K++     + +  +P        T+ QRFK+ Y  YGK+ IVVH VT   W G+FY +  SG++V  +  +LH P+W+       G   G  A+AY+L K+    RYGLT++LT  I   LR  G + P+ E +R+ NL  EG  +TK KL+      K +R VK
Sbjct:   72 FLSVKARKPEPDAPLANEPAIKPPQKLTLLQRFKDAYKVYGKVLIVVHGVTSAAWLGVFYLIAFSGLNVAELLQNLHVPDWVLKPFNAAGGSVGLFASAYILYKVAAPIRYGLTLWLTPIIVHRLRAAGRLPPLAESDRLRNLVREGVTETKIKLRRTRRSWKSKRPVK 240          
BLAST of SMED30002481 vs. TrEMBL
Match: A0A0X3PKE0 (Protein FAM210A OS=Schistocephalus solidus OX=70667 GN=F210A PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.557e-26
Identity = 72/219 (32.88%), Postives = 112/219 (51.14%), Query Frame = -1
Query:  278 KNMKLCHVFYTSQ------LSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITN--LIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE*IFTHLINL 910
            K   L   F+ +Q      L++YP  Y  +    + IVN+        S ++    Q+ K  N  +   E+PT+ QRFK+ Y  YGK+ IVVH +T   W G FY +  +G +  A+  SL  P+W+     +     G  A+AY++ K+F   RY  T++LTR I  +LR  G + P+ E++R+ NLA EG   T+ +L  +F R  ++     L NL
Sbjct:   26 KARALTSSFFLAQGQKNPTLNAYPSFYQPSFIPRRCIVNS-------TSEDKPNSPQEQK--NQDAPSAEKPTLVQRFKQAYKVYGKVLIVVHGITSAAWLGAFYCVALTGFNAGALLESLQAPDWMLRPFRLAGGAVGTWASAYLIYKVFTPLRYFCTLWLTRTIVHYLRAKGRIPPLAEKDRLRNLAREGTALTRSRLNGRF-RASRQRAVNSLRNL 234          
BLAST of SMED30002481 vs. TrEMBL
Match: A0A183TNX5 (DUF1279 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18173 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 3.547e-26
Identity = 68/192 (35.42%), Postives = 99/192 (51.56%), Query Frame = -1
Query:  359 KNMKLCHVFYTSQ------LSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPG--YGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEG 910
            K   L   F+ +Q      L++YP  Y  +    + IVN+        S ++    Q+ K  N  +   E+PT+ QRFK+ Y  YGK+ IVVH +T   W G FY +  +G ++  V  +LH P+W+   +   G   G  ATA VL KI    RYGLT++LT      LR  G + P+ EE+R+ NLA +G
Sbjct:   26 KARALTSSFFLAQGQKNPTLNAYPSFYQPSFIPRRCIVNS-------TSEDKPNSPQEQK--NQDAPSAEKPTLVQRFKQAYKVYGKVLIVVHSITSAAWLGAFYCVALTGFNILEVLMALHAPDWMLQPLRSAGETVGLWATALVLYKIAAPLRYGLTVWLTPVTVRALRARGKVPPLAEEDRLRNLARQG 208          
BLAST of SMED30002481 vs. Ensembl Cavefish
Match: fam210aa (family with sequence similarity 210 member A [Source:NCBI gene;Acc:103021547])

HSP 1 Score: 75.485 bits (184), Expect = 3.422e-15
Identity = 56/201 (27.86%), Postives = 90/201 (44.78%), Query Frame = -1
Query:  317 YTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE---------ENRILNLANEGKEQTKQKLKNKFER 883
            Y  QLSS P      S ++         +  G+       +  S +      ++    + QR+K+T+  YGK+ I VH+VT    FG+FY+    GV++      + FP+ +  L+     G   TAY + KI    RY +T+  T     +LR+ GYM+   P+KE         + RI     E KE+  +K++   ER
Sbjct:   35 YLKQLSSSPRWI---STSVPACSTAPRKDPSGHGQQSPDSAGPSDLKEPDPLMDHSIGLVQRYKKTFKQYGKVMIPVHLVTSSLCFGVFYYSAMKGVNLVPFLEYIGFPDRLVKLLENSQSGYALTAYAMYKIATPARYTITLGGTSLSVKYLRKHGYMSTPPPVKEYFQEKMEETKERISEKMEETKERISEKMEETKER 232          
BLAST of SMED30002481 vs. Ensembl Cavefish
Match: fam210aa (family with sequence similarity 210 member A [Source:NCBI gene;Acc:103021547])

HSP 1 Score: 75.485 bits (184), Expect = 3.723e-15
Identity = 56/201 (27.86%), Postives = 90/201 (44.78%), Query Frame = -1
Query:  317 YTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA---PIKE---------ENRILNLANEGKEQTKQKLKNKFER 883
            Y  QLSS P      S ++         +  G+       +  S +      ++    + QR+K+T+  YGK+ I VH+VT    FG+FY+    GV++      + FP+ +  L+     G   TAY + KI    RY +T+  T     +LR+ GYM+   P+KE         + RI     E KE+  +K++   ER
Sbjct:   45 YLKQLSSSPRWI---STSVPACSTAPRKDPSGHGQQSPDSAGPSDLKEPDPLMDHSIGLVQRYKKTFKQYGKVMIPVHLVTSSLCFGVFYYSAMKGVNLVPFLEYIGFPDRLVKLLENSQSGYALTAYAMYKIATPARYTITLGGTSLSVKYLRKHGYMSTPPPVKEYFQEKMEETKERISEKMEETKERISEKMEETKER 242          
BLAST of SMED30002481 vs. Ensembl Cavefish
Match: fam210ab (uncharacterized protein C18orf19 homolog B-like [Source:NCBI gene;Acc:103035108])

HSP 1 Score: 75.0998 bits (183), Expect = 4.820e-15
Identity = 49/183 (26.78%), Postives = 95/183 (51.91%), Query Frame = -1
Query:  305 KCFNTFGNS----FNRSFCSQKSKVNNNTSKIEE-QP------TIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMA-PIKEENRILNLANEGKEQTKQKL---KNKFERKVKE 808
            +CF++   +     +++    KS V ++T++  E  P      +++QRFK+T+  YGK+ + VH+VT   WFG FY+    GV++      +  P+ +  ++     G   TAY + K+    RY +T+  T     +LR+ GY++ P   ++ + +   E +E+  +K+   K +F  K++E
Sbjct:   39 RCFSSSATARASGSHKTPPEAKSDVPSDTTQQHEVDPLQDKSISLYQRFKKTFKQYGKVMVPVHLVTSSVWFGAFYYSAMKGVNLVPFLEFIGLPDKVVGILRDSQGGYALTAYAMYKLATPARYTVTLGGTSLSVQYLRKHGYLSTPPPVKDFLQDKMEETRERFSEKMEETKGRFSEKMEE 221          
BLAST of SMED30002481 vs. Ensembl Cavefish
Match: FAM210B (family with sequence similarity 210 member B [Source:NCBI gene;Acc:103031910])

HSP 1 Score: 47.3654 bits (111), Expect = 9.980e-6
Identity = 28/100 (28.00%), Postives = 43/100 (43.00%), Query Frame = -1
Query:  401 RFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAP 700
            + K+ +  YG + +  HI       G+FY  V SG+++ A+   L F   +       G      AY + K+F   R  +T+     I  HLRR G   P
Sbjct:  181 QLKKVFKEYGAVGVSFHIGISLISLGIFYLAVSSGINMTALLCKLGFSESVVQSKLAAGTSTFVLAYAVHKLFAPLRISITLVSVPLIVRHLRRTGLFKP 280          
BLAST of SMED30002481 vs. Ensembl Sea Lamprey
Match: fam210ab (family with sequence similarity 210 member Ab [Source:NCBI gene;Acc:503762])

HSP 1 Score: 74.3294 bits (181), Expect = 2.688e-15
Identity = 44/134 (32.84%), Postives = 69/134 (51.49%), Query Frame = -1
Query:  317 IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYM---APIKEENRILNLANEGKEQTKQKLKNKFER 709
            +  RFK+T   YGK+ I VH+VT   WFG FY+    GV+V  +  +L FP     L+     G + TAY L KI    RY +T+  T Y   +LR+ G +    P   +  + +  +E +E+  +K+ +  E+
Sbjct:  161 LISRFKKTLKQYGKVMIPVHLVTSAVWFGSFYYAAMRGVNVLPMLEALGFPEKFIKLLHSSQGGNLLTAYALYKIATPARYTVTLGGTSYTVKYLRKRGILNTPPPPNVKQFLQDKMDETREKISEKVSDTREK 294          
BLAST of SMED30002481 vs. Ensembl Sea Lamprey
Match: fam210b (family with sequence similarity 210 member B [Source:ZFIN;Acc:ZDB-GENE-050913-122])

HSP 1 Score: 44.2838 bits (103), Expect = 4.633e-6
Identity = 28/105 (26.67%), Postives = 45/105 (42.86%), Query Frame = -1
Query:  401 PTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAP 715
            P+  Q+ K  +  YG + +V HI       G+ Y  V SG+DV+A+   L       +     G      AY + K+    R  +T+     +  +LRR+G   P
Sbjct:   14 PSKAQQLKRVFKEYGAVGVVFHISISLVSLGICYLAVSSGLDVEALLRKLGVGEAFLSSRAATGTSTFVLAYAMHKVMAPARISITLVSVPLLVRYLRRVGLFRP 118          
BLAST of SMED30002481 vs. Ensembl Nematostella
Match: EDO35452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.028e-8
Identity = 31/106 (29.25%), Postives = 51/106 (48.11%), Query Frame = -1
Query:  389 QRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYM-APIKEE 703
            QR ++ +A YG + +V H+       G+ Y  V SG+DV  +  S+     +++     G      AY   K+F+  R  LTI  T  I   LR +G++ AP+  +
Sbjct:   72 QRLRKIFAEYGSIAVVFHVSISLTSLGICYTAVSSGLDVPGLLQSVGLSKGLSDSALTTGASTFVIAYACHKVFVPVRMFLTITCTPLIVHRLRAMGFLKAPVTRQ 177          
BLAST of SMED30002481 vs. Ensembl Medaka
Match: fam210ab (family with sequence similarity 210 member A [Source:NCBI gene;Acc:101168396])

HSP 1 Score: 76.2554 bits (186), Expect = 1.604e-15
Identity = 48/161 (29.81%), Postives = 74/161 (45.96%), Query Frame = -1
Query:  320 SQKSKVNNNTSKIEEQPT-------------IFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFE 763
            S  +    +  K E +PT             +FQRFK+T+  YGK+ I VH++T   W G FY+    GV+V      +  P  +  L+     G   TAY + KI    RY +T+  T     +LR+ GY++     +  L    +  E+T++KL  K E
Sbjct:   68 SAPTPAPQDVQKREAEPTPVDVDPLQDNTIGLFQRFKKTFKQYGKVMIPVHLLTSSFWLGTFYYAAMKGVNVVPFLEMIGLPESLVGLLRDSSSGYALTAYAMYKIATPARYAVTLGGTSLSVQYLRKHGYLSTPPPYSEYL---QDKMEETREKLSEKME 225          
BLAST of SMED30002481 vs. Ensembl Medaka
Match: fam210b (family with sequence similarity 210 member B [Source:NCBI gene;Acc:101164883])

HSP 1 Score: 48.1358 bits (113), Expect = 4.810e-6
Identity = 28/101 (27.72%), Postives = 45/101 (44.55%), Query Frame = -1
Query:  401 QRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAP 703
            Q+ K+ +  YG + +  HI       G+FY LV SG+D+ A+   + F   +       G      AY + K+F   R  +T+     I  +LR+ G   P
Sbjct:  169 QQLKKVFKEYGAVGVSFHIGMSLMSLGMFYLLVSSGIDMAAILCKVGFSEAVVQSKMAAGTSTFVLAYAIHKLFAPVRISITLVSVPLIVRYLRKTGLFKP 269          
BLAST of SMED30002481 vs. Planmine SMEST
Match: SMESG000059949.1 (SMESG000059949.1)

HSP 1 Score: 450.669 bits (1158), Expect = 1.702e-161
Identity = 218/218 (100.00%), Postives = 218/218 (100.00%), Query Frame = -1
Query:  305 MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 958
            MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE
Sbjct:    1 MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 218          
BLAST of SMED30002481 vs. Planmine SMEST
Match: SMESG000059949.1 (SMESG000059949.1)

HSP 1 Score: 450.669 bits (1158), Expect = 1.702e-161
Identity = 218/218 (100.00%), Postives = 218/218 (100.00%), Query Frame = -1
Query:  305 MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 958
            MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE
Sbjct:    1 MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 218          
BLAST of SMED30002481 vs. Planmine SMEST
Match: SMESG000059949.1 (SMESG000059949.1)

HSP 1 Score: 415.231 bits (1066), Expect = 9.371e-148
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = -1
Query:  305 MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 904
            MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE
Sbjct:    1 MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 200          
BLAST of SMED30002481 vs. Planmine SMEST
Match: SMESG000059949.1 (SMESG000059949.1)

HSP 1 Score: 415.231 bits (1066), Expect = 9.371e-148
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = -1
Query:  305 MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 904
            MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE
Sbjct:    1 MKLCHVFYTSQLSSYPMLYTRASKNIKTIVNTKCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCIVVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVATAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEGKEQTKQKLKNKFERKVKE 200          
The following BLAST results are available for this feature:
BLAST of SMED30002481 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM210A4.898e-1933.14family with sequence similarity 210 member A [Sour... [more]
FAM210A5.997e-1933.14family with sequence similarity 210 member A [Sour... [more]
FAM210A5.997e-1933.14family with sequence similarity 210 member A [Sour... [more]
FAM210A5.997e-1933.14family with sequence similarity 210 member A [Sour... [more]
FAM210A3.837e-932.95family with sequence similarity 210 member A [Sour... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y56A3A.223.006e-1033.62pep chromosome:WBcel235:III:11921692:11923825:1 ge... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG146134.857e-1631.11gene:FBgn0031188 transcript:FBtr0335047[more]
CG146134.857e-1631.11gene:FBgn0031188 transcript:FBtr0077367[more]
back to top
BLAST of SMED30002481 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam210ab2.767e-1835.71family with sequence similarity 210 member Ab [Sou... [more]
fam210aa5.533e-1830.51family with sequence similarity 210 member Aa [Sou... [more]
fam210aa5.533e-1830.51family with sequence similarity 210 member Aa [Sou... [more]
fam210b6.169e-725.86family with sequence similarity 210 member B [Sour... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mical32.357e-1333.63microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fam210a3.267e-1732.12family with sequence similarity 210, member A [Sou... [more]
Fam210b5.537e-722.31family with sequence similarity 210, member B [Sou... [more]
back to top
BLAST of SMED30002481 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96ND0|F210A_HUMAN2.880e-1833.14Protein FAM210A OS=Homo sapiens OX=9606 GN=FAM210A... [more]
sp|Q5RE99|F210A_PONAB3.179e-1833.14Protein FAM210A OS=Pongo abelii OX=9601 GN=FAM210A... [more]
sp|Q5ZML6|F210A_CHICK4.846e-1835.71Protein FAM210A OS=Gallus gallus OX=9031 GN=FAM210... [more]
sp|Q05B67|F210A_BOVIN9.739e-1835.25Protein FAM210A OS=Bos taurus OX=9913 GN=FAM210A P... [more]
sp|Q5CZQ0|CR19B_DANRE2.259e-1735.71Uncharacterized protein C18orf19 homolog B OS=Dani... [more]
back to top
BLAST of SMED30002481 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183QYR33.865e-2833.02DUF1279 domain-containing protein OS=Schistosoma r... [more]
G4VKZ82.235e-2740.67DUF1279 domain-containing protein OS=Schistosoma m... [more]
A0A5K3FB123.605e-2737.28Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PKE01.557e-2632.88Protein FAM210A OS=Schistocephalus solidus OX=7066... [more]
A0A183TNX53.547e-2635.42DUF1279 domain-containing protein OS=Schistocephal... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam210aa3.422e-1527.86family with sequence similarity 210 member A [Sour... [more]
fam210aa3.723e-1527.86family with sequence similarity 210 member A [Sour... [more]
fam210ab4.820e-1526.78uncharacterized protein C18orf19 homolog B-like [S... [more]
FAM210B9.980e-628.00family with sequence similarity 210 member B [Sour... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam210ab2.688e-1532.84family with sequence similarity 210 member Ab [Sou... [more]
fam210b4.633e-626.67family with sequence similarity 210 member B [Sour... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30002481 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO354521.028e-829.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30002481 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam210ab1.604e-1529.81family with sequence similarity 210 member A [Sour... [more]
fam210b4.810e-627.72family with sequence similarity 210 member B [Sour... [more]
back to top
BLAST of SMED30002481 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000059949.11.702e-161100.00SMESG000059949.1[more]
SMESG000059949.11.702e-161100.00SMESG000059949.1[more]
SMESG000059949.19.371e-148100.00SMESG000059949.1[more]
SMESG000059949.19.371e-148100.00SMESG000059949.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002481 ID=SMED30002481|Name=SMED30002481|organism=Schmidtea mediterranea sexual|type=transcript|length=1051bp
TCACAGTATCAATTTGACAATATCCCACCAATCCAGCAAATCCTAAATTC
ATTGATTGCATAGCTGCCCGGAAAGTCTGTTTCCTGCTATCAAGATACAT
TCTGCGATCATATAACAAAAATGATAATAATATTAATAATAAGAAACCAA
ATGAGTAAAGAAACCCAAAAATATTTTATTTAAATAATATAAAGAAAATG
CAATGACTACCGAAATAACAAAAATTTATTTAATTTACACCGAAGGTCGA
ATTAAAAAAATCATTATTAAATATGTGTAAATTTATCAAATGAGTAAAAA
TTTATTCTTTGACTTTCCGTTCGAATTTATTCTTGAGTTTCTGTTTGGTT
TGTTCTTTGCCTTCATTTGCGAGATTTAAAATTCTGTTTTCTTCTTTGAT
AGGAGCCATGTAACCGAGGCGGCGTAAATGAGCACCAATATATCTGGTCA
AGTAGATAGTCAAACCATAACGGAAGAACATGAAAATTTTGCACAACACG
TAAGCTGTAGCCACTTCACCATATCCAGGCTTACCGATTAGATTGGTTAT
CCAATTCGGGAAATGCAGTGAAGTAAAAACCGCCTTCACATCGACACCGC
TGTGCACAAGAAAATAAAACAATCCGAACCATCCGCAATATGTCACGATA
TGAACTACAATACAGAGTTTTCCATAAGCTGCATAGGTTTCTTTAAATCT
TTGAAAGATGGTTGGTTGTTCTTCGATTTTAGAAGTATTGTTATTAACTT
TTGATTTTTGAGAACAAAATGAACGATTGAAACTATTTCCAAATGTATTA
AAACATTTTGTATTAACGATTGTTTTAATATTTTTTGAAGCTCGTGTATA
TAACATTGGATAAGATGATAATTGTGAAGTATAGAACACATGGCATAGTT
TCATATTTTTAGAATAACCAGAATTAAAAAGTATCGGTGTTATGATACGT
TTGTACATTTCTAAACAATAAGTTTTAAATGTACAAGTAATGATAAAAAG
TGCAGTTAAAAAAGCATTAATTACAAAATTAAAAAAAAAGCTATTTTAAA
A
back to top

protein sequence of SMED30002481-orf-1

>SMED30002481-orf-1 ID=SMED30002481-orf-1|Name=SMED30002481-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MYKRIITPILFNSGYSKNMKLCHVFYTSQLSSYPMLYTRASKNIKTIVNT
KCFNTFGNSFNRSFCSQKSKVNNNTSKIEEQPTIFQRFKETYAAYGKLCI
VVHIVTYCGWFGLFYFLVHSGVDVKAVFTSLHFPNWITNLIGKPGYGEVA
TAYVLCKIFMFFRYGLTIYLTRYIGAHLRRLGYMAPIKEENRILNLANEG
KEQTKQKLKNKFERKVKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009688DUF1279
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 191..218
NoneNo IPR availablePANTHERPTHR21377UNCHARACTERIZEDcoord: 58..190
NoneNo IPR availablePANTHERPTHR21377:SF1PROTEIN FAM210Acoord: 58..190
NoneNo IPR availableTMHMMTMhelixcoord: 149..171
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
IPR009688Domain of unknown function DUF1279PFAMPF06916DUF1279coord: 86..172
e-value: 1.0E-20
score: 74.0