death domain-containing protein 1

Overview
Namedeath domain-containing protein 1
Smed IDSMED30002478
Uniprot Best hitDeath domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DTHD1 PE=2 SV=3 (E=3.61837e-09)
Length (bp)1373
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of death domain-containing protein 1 (SMED30002478) t-SNE clustered cells

Violin plots show distribution of expression levels for death domain-containing protein 1 (SMED30002478) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of death domain-containing protein 1 (SMED30002478) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for death domain-containing protein 1 (SMED30002478) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002478

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30002478SMESG000048822.1 SmedASXL_015937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30002478SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30002478SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30002478SMESG000048822.1 dd_Smed_v6_15379_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30002478SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30002478SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30002478SMESG000048822.1 dd_Smed_v4_15379_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of death domain-containing protein 1 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 63.5438 bits (153), Expect = 3.650e-10
Identity = 64/299 (21.40%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  463 FSNL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLK--SGETFLDKLWEIVIFIPKFENERNNSL-----------HKDFDFKPTDT--INKE--------YLHYLSHQIGED-WKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            + +L R   +  +  + +  +   ++ +EE+  +     + + + +N +R+ +L+ P   + ++ K L  + +       S    VRE ++ ++ F GNI + +       +  + ++ Q   RLE  ++E D+F   +   Y+G + V K   G+   +    +VI      NE ++ L           HK    +P  T  ++K+         LH+L+ ++ E+  + L   L +   TI+ I     ++++   ++ L  W K+LP +++K+ L+ + L+ IGR+DL ++L F+
Sbjct:  307 YEHLERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEP-SRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVI------NENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFK 598          
BLAST of death domain-containing protein 1 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 62.7734 bits (151), Expect = 7.535e-10
Identity = 64/299 (21.40%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  463 FSNL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLK--SGETFLDKLWEIVIFIPKFENERNNSL-----------HKDFDFKPTDT--INKE--------YLHYLSHQIGED-WKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            + +L R   +  +  + +  +   ++ +EE+  +     + + + +N +R+ +L+ P   + ++ K L  + +       S    VRE ++ ++ F GNI + +       +  + ++ Q   RLE  ++E D+F   +   Y+G + V K   G+   +    +VI      NE ++ L           HK    +P  T  ++K+         LH+L+ ++ E+  + L   L +   TI+ I     ++++   ++ L  W K+LP +++K+ L+ + L+ IGR+DL ++L F+
Sbjct:  472 YEHLERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEP-SRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVI------NENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFK 763          
BLAST of death domain-containing protein 1 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 62.7734 bits (151), Expect = 8.174e-10
Identity = 64/299 (21.40%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  463 FSNL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLK--SGETFLDKLWEIVIFIPKFENERNNSL-----------HKDFDFKPTDT--INKE--------YLHYLSHQIGED-WKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            + +L R   +  +  + +  +   ++ +EE+  +     + + + +N +R+ +L+ P   + ++ K L  + +       S    VRE ++ ++ F GNI + +       +  + ++ Q   RLE  ++E D+F   +   Y+G + V K   G+   +    +VI      NE ++ L           HK    +P  T  ++K+         LH+L+ ++ E+  + L   L +   TI+ I     ++++   ++ L  W K+LP +++K+ L+ + L+ IGR+DL ++L F+
Sbjct:  512 YEHLERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEP-SRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVI------NENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFK 803          
BLAST of death domain-containing protein 1 vs. Ensembl Human
Match: DTHD1 (death domain containing 1 [Source:HGNC Symbol;Acc:HGNC:37261])

HSP 1 Score: 62.7734 bits (151), Expect = 9.087e-10
Identity = 64/299 (21.40%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  463 FSNL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLK--SGETFLDKLWEIVIFIPKFENERNNSL-----------HKDFDFKPTDT--INKE--------YLHYLSHQIGED-WKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            + +L R   +  +  + +  +   ++ +EE+  +     + + + +N +R+ +L+ P   + ++ K L  + +       S    VRE ++ ++ F GNI + +       +  + ++ Q   RLE  ++E D+F   +   Y+G + V K   G+   +    +VI      NE ++ L           HK    +P  T  ++K+         LH+L+ ++ E+  + L   L +   TI+ I     ++++   ++ L  W K+LP +++K+ L+ + L+ IGR+DL ++L F+
Sbjct:  597 YEHLERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEP-SRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVI------NENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFK 888          
BLAST of death domain-containing protein 1 vs. Ensembl Zebrafish
Match: dthd1 (death domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-140106-180])

HSP 1 Score: 58.5362 bits (140), Expect = 1.178e-8
Identity = 54/216 (25.00%), Postives = 92/216 (42.59%), Query Frame = 1
Query:  703 SSELNVRERDKFIINFRGNI---ESVTRSE---LMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFL----------DKLWE-----IVIFIPKFENERNNSLH-KDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIAN-DTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRSMG 1281
            SSEL++RE ++ ++   GNI   ES+++ +   L++T+++Q  NRL   ++E D F   +   Y+G  S  K  +  L          D L E     + I +PK        +  K      T+ ++ E L +L  ++ ED   L         +  +IA       +S   +  L  W + LP  S K  ++   L   GR DL   L+ +   
Sbjct:  508 SSELSMREGEQLLVRLSGNITCAESISKEQTDSLIITFHNQRRNRLYLTLKEVDTFGNHSSLHYKGVASFFKVSKDHLVWSDDRAYVKDCLLEEPVCRLPITLPKGARTVFQPVRIKLMQPSQTEPLSDELLSWLCEELTEDDAALLVLSLRLRRSSVQIARLRAPHSLSQQAFHILTAWRRGLPSSSLKCPILAHCLTRAGRPDLANQLLLKGAA 723          
BLAST of death domain-containing protein 1 vs. Ensembl Xenopus
Match: skiv2l (Ski2 like RNA helicase [Source:Xenbase;Acc:XB-GENE-486233])

HSP 1 Score: 71.633 bits (174), Expect = 1.090e-12
Identity = 63/281 (22.42%), Postives = 131/281 (46.62%), Query Frame = 1
Query:  490 IRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRSE----LMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSG--------------ETFLDK---LWEIVIFIPKFE-NERNNSLHKDFDFKPTDTINKEYLHYLSHQIGE-DWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            IR +  + +  +   +  +E ++ + +V  I  +K +N  + I+ + P  ++      L E+ Y+      S ++ +RE ++    F GNI +    +      +T+++Q   RL   +   D+F   +   Y+G V+V K G              +T+L +   + ++ + +PK E N    S  K     P D +    L +L+ ++ E D  HL  +L +   T++ +   + + ++   Y+ L  W K+LP  ++K+ L+ + L+  GR+DL++ L
Sbjct:  332 IRLSSAMDNAHLMSFIHSLEVATHSSMVNVILYRKKDNLQKAIVKVVPSKELTWEVANLREEGYSGPPEP-SEQIQLREGEQIHFRFCGNITASDGKDCGKTFGLTFHAQRKQRLSLHLSVVDEFGNYSCPHYKGTVAVYKLGKEDIAECYKSGQSTDTYLQQRSPVCKLAVTLPKMEKNVSRPSSTKIITSDPGDILWDSLLKWLAQELSEEDASHLVLSLPIRRSTVQLVKLKSPDNLTEQIYEFLSFWKKSLPASADKIRLLARHLRKSGRSDLLEPL 611          
BLAST of death domain-containing protein 1 vs. Ensembl Mouse
Match: Dthd1 (death domain containing 1 [Source:MGI Symbol;Acc:MGI:4937018])

HSP 1 Score: 58.5362 bits (140), Expect = 1.427e-8
Identity = 58/264 (21.97%), Postives = 124/264 (46.97%), Query Frame = 1
Query:  544 IEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSG-------------ETFLD-KLWEIVIFIPKFENERNNSLH-KDFDFKPTDTINKEYLHYLSHQIGEDWKH-LGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            +EE+S +     + + + +N +R+++L+ P  ++  + K L  + +     S   +  VRE ++ ++ F GNI   +       +  + ++ Q   RLE  ++E D+F   +   Y+G ++V K               ETF    + ++ + +PK E   N     K     P   +    LH+L+ ++ E+    L  +L +   T++ I     ++ +   ++ L  W ++LP  ++K+ L+ + L+ +GR DL ++L F+
Sbjct:  626 LEEASLSTTACIVLSHQKDNPHRVVILVVPSKELSLVLKSLRSEGFGGPESS--RQFQVREGEQLLLRFTGNIFGSSNGKDYEKDYKLIFHLQRKPRLELHIKEVDEFGNYSCPHYKGTITVYKVPREKIVPNLDQTLHETFYQFPVCKLPLKLPKHEKVINRPQSTKRVSTDPLVALWDNLLHWLAEELAEEGAEVLAASLPLRRSTVQLIKLKHPDDPTEQIHELLCFWKRSLPTSTDKIRLLARHLRKMGRGDLTEELKFK 887          
BLAST of death domain-containing protein 1 vs. Ensembl Mouse
Match: Dthd1 (death domain containing 1 [Source:MGI Symbol;Acc:MGI:4937018])

HSP 1 Score: 58.151 bits (139), Expect = 1.597e-8
Identity = 58/264 (21.97%), Postives = 124/264 (46.97%), Query Frame = 1
Query:  544 IEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSG-------------ETFLD-KLWEIVIFIPKFENERNNSLH-KDFDFKPTDTINKEYLHYLSHQIGEDWKH-LGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            +EE+S +     + + + +N +R+++L+ P  ++  + K L  + +     S   +  VRE ++ ++ F GNI   +       +  + ++ Q   RLE  ++E D+F   +   Y+G ++V K               ETF    + ++ + +PK E   N     K     P   +    LH+L+ ++ E+    L  +L +   T++ I     ++ +   ++ L  W ++LP  ++K+ L+ + L+ +GR DL ++L F+
Sbjct:  516 LEEASLSTTACIVLSHQKDNPHRVVILVVPSKELSLVLKSLRSEGFGGPESS--RQFQVREGEQLLLRFTGNIFGSSNGKDYEKDYKLIFHLQRKPRLELHIKEVDEFGNYSCPHYKGTITVYKVPREKIVPNLDQTLHETFYQFPVCKLPLKLPKHEKVINRPQSTKRVSTDPLVALWDNLLHWLAEELAEEGAEVLAASLPLRRSTVQLIKLKHPDDPTEQIHELLCFWKRSLPTSTDKIRLLARHLRKMGRGDLTEELKFK 777          
BLAST of death domain-containing protein 1 vs. UniProt
Match: sp|Q6ZMT9|DTHD1_HUMAN (Death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DTHD1 PE=2 SV=3)

HSP 1 Score: 62.7734 bits (151), Expect = 3.618e-9
Identity = 64/299 (21.40%), Postives = 140/299 (46.82%), Query Frame = 1
Query:  463 FSNL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRS-----ELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLK--SGETFLDKLWEIVIFIPKFENERNNSL-----------HKDFDFKPTDT--INKE--------YLHYLSHQIGED-WKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFR 1272
            + +L R   +  +  + +  +   ++ +EE+  +     + + + +N +R+ +L+ P   + ++ K L  + +       S    VRE ++ ++ F GNI + +       +  + ++ Q   RLE  ++E D+F   +   Y+G + V K   G+   +    +VI      NE ++ L           HK    +P  T  ++K+         LH+L+ ++ E+  + L   L +   TI+ I     ++++   ++ L  W K+LP +++K+ L+ + L+ IGR+DL ++L F+
Sbjct:  472 YEHLERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQVLKDLHLEGFGGPPEP-SRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVI------NENHSQLPICKLPLKLPKHKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKNPDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFK 763          
BLAST of death domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15747087 (tr|R7VC42|R7VC42_CAPTE Death domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228009 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.327e-19
Identity = 91/291 (31.27%), Postives = 147/291 (50.52%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFLDK------------LWEIV--------IFIPKFENERNNSLHKDFDFKP----TD-TINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIAND--TREEMSSMT--YQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            +   +R    +   + QK  E+IEE    R+VQ I  Q+ ++   + + I P  K EK  K L ++ Y +E      E+++ E D   + FRGNI+S    +  + +NSQL NR  F V E DK+ QKN   Y+G+V  L+  ET   K            L E+V        + IPK ++E+  +L++    +P    TD  IN+++L  LS  +G++W+ L + L V    ++ I  D  +R + +  T  Y+ L+ W+K +P   NKVE+++ AL    R DL  +L
Sbjct:  602 KFIVLRTRTNLDGREAQKIAELIEERLSQRIVQSILKQRADDLCDICMQIVPVAKQEKTIKALEDEGY-EEGPGAGKEVSLHEGDVLEVTFRGNIKSYDNKKREIIFNSQLTNRASFSVVEVDKYLQKNYQVYRGFVQ-LERVETVTHKAKRNDDGTEEEPLVEVVRHLVSDHLVSIPK-DSEQPCTLNR---VQPVLVQTDGPINEQFLRNLSANLGDEWQKLAHYLNVKKVRLQAIIRDANSRNQGNDETCKYEMLMTWVKKVPRGINKVEILQSALSKSCREDLAAEL 886          
BLAST of death domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18222666 (tr|A0A267FL00|A0A267FL00_9PLAT Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021498g3 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.381e-19
Identity = 85/302 (28.15%), Postives = 140/302 (46.36%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYN--------------DETMSISSELNVRERDKFIINFRGNI-----ESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSV------------LKSGE-----TFLDK--LWEIVIFIPKFENER--NNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            R  A R   E + +   +  E IE + E++   F+  QK +N   + L ++   ++++  K L E  Y+                   +S ++ VRER +F + FRGNI     +    SE ++ +NSQ+ NRLE  V E+D+FAQ+  D ++GY+ V             K G      T +++  + +++I +PK E E    +     F FK  D++  EYL  L+  + ++W+ L   L V  +    I   T E   +  Y  L+ W+K LPV  NKV ++ +AL   G   L   L
Sbjct:  621 RFIAFRVKPEFNTDTASRICEAIETNLEDKSACFVLRQKSDNLTEVSLALTASGRLDRTLKQLQEAGYDYDGISGGLGGGGGGSNGPGVSEDIRVRERQQFRLRFRGNIICEDDDPDRPSEFVLHFNSQMKNRLELSVTERDRFAQRALDQFRGYIEVTTDMAVQKPVKDAKKGNPHQTVTVMEEAVVAKMLICVPKSEEELRVKSPRATPFVFKSKDSVTMEYLRDLAELVCDNWELLADKLEVSKKRCSVIKK-TSESQETQAYDMLITWVKKLPVLKNKVLILCRALNASGYPHLAASL 921          
BLAST of death domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15792925 (tr|A0A1I8J6D8|A0A1I8J6D8_9PLAT Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021498g2 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.250e-19
Identity = 84/302 (27.81%), Postives = 139/302 (46.03%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYN--------------DETMSISSELNVRERDKFIINFRGNI-----ESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSV------------LKSGE-----TFLDK--LWEIVIFIPKFENER--NNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            R  A R   E + +   +  E IE + E++   F+  QK +N   + L ++   ++++  K L E  Y                    +S ++ VRER +F + FRGNI     +    SE ++ +NSQ+ NRLE  V E+D+FAQ+  D ++GY+ V             K G      T +++  + +++I +PK E E    +     F FK  D++  EYL  L+  + ++W+ L   L V  +    +   T E   +  Y  L+ W+K LPV  NKV ++ +AL   G   L   L
Sbjct:  621 RFIAFRVKPEFNADTASRICEAIETNLEDKSACFVLRQKSDNLTEVSLALTASGRLDRTLKQLQEAGYGYDGISGGLGGGGGGSNGPGVSEDIRVRERQQFRLRFRGNIICEDDDPDRPSEFVLHFNSQMKNRLELSVTERDRFAQRALDQFRGYIEVTTDMAVQKPVKDAKKGNPHQTVTVMEEAVVAKMLICVPKSEEELRVKSPRATPFVFKSKDSVTMEYLRDLAELVCDNWELLADKLEVSKKRC-SVIKKTSESQETQAYDMLITWVKKLPVLKNKVLILCRALNASGYPHLAASL 921          
BLAST of death domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18234946 (tr|A0A1I8HKK8|A0A1I8HKK8_9PLAT Death domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.888e-18
Identity = 85/302 (28.15%), Postives = 139/302 (46.03%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYN--------------DETMSISSELNVRERDKFIINFRGNI-----ESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSV------------LKSGE-----TFLDK--LWEIVIFIPKFENER--NNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            R  A R   E + +   +  E IE + E++   F+  QK +N   + L +    ++++  K L E  Y+                   +S ++ VRER +F + FRGNI     +    SE ++ +NSQ+ NRLE  V E+D+FAQ+  D ++GY+ V             K G      T +++  + +++I +PK E E    +     F FK  D++  EYL  L+  + ++W+ L   L V  +    I   T E   +  Y  L+ W+K LPV  NKV ++ +AL   G   L   L
Sbjct:  449 RFIAFRVKPEFNTDTASRICEAIETNLEDKSACFVLRQKSDNLTEVSLALIASGRLDRTLKQLQEAGYDYDGISGGLGGGGGGSNGPGVSEDIRVRERQQFRLRFRGNIICEDDDPDRPSEFVLHFNSQMKNRLELSVTERDRFAQRALDQFRGYIEVTTDMAVQKPVKDAKKGNPHQTVTVMEEAVVAKMLICVPKSEEELRVKSPRATPFVFKSKDSVTMEYLRDLAELVCDNWELLADKLEVSKKRCSVIKK-TSESQETQAYDMLITWVKKLPVLKNKVLILCRALNASGYPHLAASL 749          
BLAST of death domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18308451 (tr|A0A267E228|A0A267E228_9PLAT Death domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021498g1 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.009e-18
Identity = 85/302 (28.15%), Postives = 139/302 (46.03%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYN--------------DETMSISSELNVRERDKFIINFRGNI-----ESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSV------------LKSGE-----TFLDK--LWEIVIFIPKFENER--NNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDL 1263
            R  A R   E + +   +  E IE + E++   F+  QK +N   + L +    ++++  K L E  Y+                   +S ++ VRER +F + FRGNI     +    SE ++ +NSQ+ NRLE  V E+D+FAQ+  D ++GY+ V             K G      T +++  + +++I +PK E E    +     F FK  D++  EYL  L+  + ++W+ L   L V  +    I   T E   +  Y  L+ W+K LPV  NKV ++ +AL   G   L   L
Sbjct:  619 RFIAFRVKPEFNTDTASRICEAIETNLEDKSACFVLRQKSDNLTEVSLALIASGRLDRTLKQLQEAGYDYDGISGGLGGGGGGSNGPGVSEDIRVRERQQFRLRFRGNIICEDDDPDRPSEFVLHFNSQMKNRLELSVTERDRFAQRALDQFRGYIEVTTDMAVQKPVKDAKKGNPHQTVTVMEEAVVAKMLICVPKSEEELRVKSPRATPFVFKSKDSVTMEYLRDLAELVCDNWELLADKLEVSKKRCSVIKK-TSESQETQAYDMLITWVKKLPVLKNKVLILCRALNASGYPHLAASL 919          
BLAST of death domain-containing protein 1 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 63.929 bits (154), Expect = 1.758e-10
Identity = 64/274 (23.36%), Postives = 111/274 (40.51%), Query Frame = 1
Query:  469 NL*RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVT----RSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLHYLSHQIGE-DWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRS 1275
            N  RL  +R    +    +    + +EES     V  +   K E+ +  IL   P   +         Q Y       S+E ++RE D+ ++ F GNI S       +   VT + Q  N L   ++E+D F   +   Y+G +        FL     I+  +    +   +  H        + +  E L +LS ++ E D   L   LR+   T++       + +S  T+  L  W ++LP  + K  L+ + L +IGR +L  +L+ R 
Sbjct:  444 NCERLIVLRLLSSIRPPCLTFFAQDLEESVRTCAVTVVLHTKREDPSNAILAAHPSRDLSWALNEFRAQAYFGPPEP-STEFSMREGDQLLLKFSGNITSAAGDQGTAPHTVTLHIQRRNWLCLKLKEQDPFGNYSSPHYKGTLGFSSPFCLFLISCLYILFLVFFLSSLALSLSHDPEPLCSPELLCDELLAWLSGELSEEDAALLVMCLRLRRSTVQLARLRAPDSLSLQTFNILSTWRRSLPSSTPKRPLLARCLTHIGRPELAAELLRRG 716          
BLAST of death domain-containing protein 1 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 55.8398 bits (133), Expect = 7.531e-8
Identity = 50/213 (23.47%), Postives = 91/213 (42.72%), Query Frame = 1
Query:  703 SSELNVRERDKFIINFRGNIESVT----RSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYV----------------SVLKSGETFLDKLWEIVIFIPKFENERNNSLH-KDFDFKPTDTINKEYLHYLSHQIGE-DWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRS 1275
            S+E ++RE D+ ++ F GNI S       +   VT + Q  N L   ++E+D F   +   Y+G                  +V+         + ++ + +PK     N  +  K       + +  E L +LS ++ E D   L   LR+   T++       + +S  T+  L  W ++LP  + K  L+ + L +IGR +L  +L+ R 
Sbjct:  597 STEFSMREGDQLLLKFSGNITSAAGDQGTAPHTVTLHIQRRNWLCLKLKEQDPFGNYSSPHYKGTAILFRIPRDQLVWRGDQAVISEDYKLEAPVCKLSLTLPKTVKTLNRPMSAKVLRHDQRELLCDELLAWLSGELSEEDAALLVMCLRLRRSTVQLARLRAPDSLSLQTFNILSTWRRSLPSSTPKRPLLARCLTHIGRPELAAELLRRG 809          
BLAST of death domain-containing protein 1 vs. Ensembl Cavefish
Match: dthd1 (death domain containing 1 [Source:NCBI gene;Acc:103040305])

HSP 1 Score: 55.4546 bits (132), Expect = 8.680e-8
Identity = 61/266 (22.93%), Postives = 107/266 (40.23%), Query Frame = 1
Query:  544 IEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVT----RSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYV----------------SVLKSGETFLDKLWEIVIFIPKFENERNNSLH-KDFDFKPTDTINKEYLHYLSHQIGE-DWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRS 1275
            +EES     V  +   K E+ +  IL   P   +         Q Y       S+E ++RE D+ ++ F GNI S       +   VT + Q  N L   ++E+D F   +   Y+G                  +V+         + ++ + +PK     N  +  K       + +  E L +LS ++ E D   L   LR+   T++       + +S  T+  L  W ++LP  + K  L+ + L +IGR +L  +L+ R 
Sbjct:  632 LEESVRTCAVTVVLHTKREDPSNAILAAHPSRDLSWALNEFRAQAYFGPPEP-STEFSMREGDQLLLKFSGNITSAAGDQGTAPHTVTLHIQRRNWLCLKLKEQDPFGNYSSPHYKGTAILFRIPRDQLVWRGDQAVISEDYKLEAPVCKLSLTLPKTVKTLNRPMSAKVLRHDQRELLCDELLAWLSGELSEEDAALLVMCLRLRRSTVQLARLRAPDSLSLQTFNILSTWRRSLPSSTPKRPLLARCLTHIGRPELAAELLRRG 896          
BLAST of death domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000048822.1 (SMESG000048822.1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 268/269 (99.63%), Postives = 269/269 (100.00%), Query Frame = 1
Query:  478 RLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRSMGH 1284
            +LAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVEKLQKLLLEQNYNDETMSISSELNVRERDKFIINFRGNIESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRSMGH
Sbjct:  549 KLAAIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVEKLQKLLLEQNYNDETMSISSELNVRERDKFIINFRGNIESVTRSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKSGETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRSMGH 817          
BLAST of death domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000008533.1 (SMESG000008533.1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.691e-11
Identity = 41/142 (28.87%), Postives = 82/142 (57.75%), Query Frame = 1
Query:  487 AIRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVTRSELMV---TYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVLKS 903
             +R   + S E++ K +EII    + R ++ I +   E+ N + + +   ++++K  + L E+ ++D+   IS EL ++ER+   + FRGNI+    +E  V    Y++QL N+++  ++  DK+AQ+ K  Y+G++S+  S
Sbjct:  536 GVRAKVDASLEQIAKGMEIIMNHFKLRQIKVIVSHHNEDPNVISVSLCSSSRLDKQLRSLKEEGFDDKNCQISQELEIKEREILTVRFRGNIKLKKENECQVEEFMYSTQLKNKIKIPLEVVDKYAQRAKSKYEGFLSLTTS 677          
BLAST of death domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000031073.1 (SMESG000031073.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.002e-7
Identity = 68/289 (23.53%), Postives = 124/289 (42.91%), Query Frame = 1
Query:  490 IRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVT--RSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVL----------------KSG--------ETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLH-------YLSHQIGEDWKHLGYALRVPDETIRRIA-NDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLV 1254
            +R    ++ E + K +++IE     R    I  +  +N    ILL    ++ EK+     +  YN E  +    + ++ER     +F GNI++V   ++ +   Y S   N   F  +  D +AQ+  D Y+GY+ V                 + G        E F+  + +++I IPK    +    HK     P    N+E L         ++  IG  WK LG +L++ +  ++ +  ++   +   +  Q LL W K L +  +K E++ ++L  + RNDL 
Sbjct: 3121 LRANRTITFENLTKGVKLIETEFSLRNSLIILLKSAKNPYEFILLTCLKSRSEKIISQFKDDGYNVEPQNTPVSIELKERQILRTSFSGNIQNVNPDKNTMFFAYQSLFLNLQIFRTKPIDTYAQRAIDHYRGYIMVFTKKLMKKPIESADKKARKGHVQYQMVEEDFM--ICQLLISIPK----KGLIAHKPLRNIP---FNREILEDFLCMFTRIADGIGISWKELGTSLKISESRLQMLKHHNPGNQPGKIVIQMLLFWFKGLELMDDKTEMLRQSLLEVNRNDLA 3400          
BLAST of death domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000031073.1 (SMESG000031073.1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.231e-7
Identity = 68/289 (23.53%), Postives = 124/289 (42.91%), Query Frame = 1
Query:  490 IRCTEEVSDEKVQKALEIIEESSENRLVQFICAQKIENANRLILLISPPNKVXXXXXXXXXXNYNDETMSISSELNVRERDKFIINFRGNIESVT--RSELMVTYNSQLPNRLEFFVQEKDKFAQKNKDSYQGYVSVL----------------KSG--------ETFLDKLWEIVIFIPKFENERNNSLHKDFDFKPTDTINKEYLH-------YLSHQIGEDWKHLGYALRVPDETIRRIA-NDTREEMSSMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLV 1254
            +R    ++ E + K +++IE     R    I  +  +N    ILL    ++ EK+     +  YN E  +    + ++ER     +F GNI++V   ++ +   Y S   N   F  +  D +AQ+  D Y+GY+ V                 + G        E F+  + +++I IPK    +    HK     P    N+E L         ++  IG  WK LG +L++ +  ++ +  ++   +   +  Q LL W K L +  +K E++ ++L  + RNDL 
Sbjct: 3089 LRANRTITFENLTKGVKLIETEFSLRNSLIILLKSAKNPYEFILLTCLKSRSEKIISQFKDDGYNVEPQNTPVSIELKERQILRTSFSGNIQNVNPDKNTMFFAYQSLFLNLQIFRTKPIDTYAQRAIDHYRGYIMVFTKKLMKKPIESADKKARKGHVQYQMVEEDFM--ICQLLISIPK----KGLIAHKPLRNIP---FNREILEDFLCMFTRIADGIGISWKELGTSLKISESRLQMLKHHNPGNQPGKIVIQMLLFWFKGLELMDDKTEMLRQSLLEVNRNDLA 3368          
The following BLAST results are available for this feature:
BLAST of death domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DTHD13.650e-1021.40death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD17.535e-1021.40death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD18.174e-1021.40death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
DTHD19.087e-1021.40death domain containing 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dthd11.178e-825.00death domain containing 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
skiv2l1.090e-1222.42Ski2 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dthd11.427e-821.97death domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Dthd11.597e-821.97death domain containing 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of death domain-containing protein 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q6ZMT9|DTHD1_HUMAN3.618e-921.40Death domain-containing protein 1 OS=Homo sapiens ... [more]
back to top
BLAST of death domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157470875.327e-1931.27tr|R7VC42|R7VC42_CAPTE Death domain-containing pro... [more]
gnl|BL_ORD_ID|182226665.381e-1928.15tr|A0A267FL00|A0A267FL00_9PLAT Death domain-contai... [more]
gnl|BL_ORD_ID|157929257.250e-1927.81tr|A0A1I8J6D8|A0A1I8J6D8_9PLAT Death domain-contai... [more]
gnl|BL_ORD_ID|182349461.888e-1828.15tr|A0A1I8HKK8|A0A1I8HKK8_9PLAT Death domain-contai... [more]
gnl|BL_ORD_ID|183084512.009e-1828.15tr|A0A267E228|A0A267E228_9PLAT Death domain-contai... [more]
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dthd11.758e-1023.36death domain containing 1 [Source:NCBI gene;Acc:10... [more]
dthd17.531e-823.47death domain containing 1 [Source:NCBI gene;Acc:10... [more]
dthd18.680e-822.93death domain containing 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of death domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000048822.10.000e+099.63SMESG000048822.1[more]
SMESG000008533.14.691e-1128.87SMESG000008533.1[more]
SMESG000031073.11.002e-723.53SMESG000031073.1[more]
SMESG000031073.11.231e-723.53SMESG000031073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002478 ID=SMED30002478|Name=death domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1373bp
AATAAGAAGATAAAAACGAATATACAGAAAATATATAAGCAAATTAATTA
ATTATGTGGAGAGTATAAGCAACATTTTCAGGTTGAAGTAAAAGAAAATA
TTGAAATATTATATTAGGCTGAATGAACTGAAATTGATAGCTATGATGAC
GAATGATAACCAGAAATACGAAAACTAGCTTAGAGCCCAAAAAATCTCCA
GATTTGGTCGAAGAAATGAGAGTGTATTTAGTAAATTTTGTTATCCACTG
ATCAGGTTGAACATAGGAGAGTTACCTAAATCTACTGTAAACCGAAAAAT
GTAACAAATCAACCGCATAAATGCAAATTTGGAATGATGTACGAATTGTA
CAAACTGTCCCCAATGTTAAAGGGGAAATATTCTAGTCATCGCTATATAG
GAAATATTCAATTCTTTATTTATTTTTGCACATTTGTTTGAACTCACAAT
TTGAATTTCTCATTTTCAAATTTATAAAGACTTGCAGCAATCCGATGTAC
AGAAGAGGTAAGCGACGAAAAAGTTCAAAAAGCTCTAGAAATAATAGAAG
AAAGTTCTGAAAATCGACTTGTTCAGTTTATTTGCGCCCAGAAAATAGAA
AATGCAAATAGACTGATTTTGTTAATTTCACCCCCAAATAAAGTTGAGAA
ATTGCAGAAATTACTTTTGGAACAAAACTATAATGATGAAACCATGTCAA
TTAGTTCAGAACTGAATGTACGGGAAAGAGATAAATTTATAATCAACTTC
CGAGGAAATATTGAGTCAGTGACAAGGTCTGAGTTGATGGTAACCTATAA
CTCTCAGCTCCCAAATAGGCTAGAGTTTTTTGTTCAAGAGAAAGATAAGT
TTGCCCAAAAGAATAAAGATTCGTATCAAGGATATGTGTCAGTTTTAAAA
TCTGGTGAAACATTTTTGGATAAGCTGTGGGAAATAGTTATATTTATCCC
AAAGTTTGAGAATGAAAGGAACAATTCACTCCATAAGGATTTTGACTTCA
AGCCTACTGATACAATCAACAAAGAATATCTTCACTATTTATCACACCAA
ATAGGCGAAGATTGGAAACATTTGGGCTACGCTCTGAGAGTACCGGATGA
AACGATACGAAGAATTGCTAATGACACCCGTGAAGAAATGAGTAGCATGA
CCTATCAATGTCTGTTGAAATGGATCAAGAACTTGCCCGTTTATTCAAAT
AAGGTAGAGCTAATGGAAAAGGCGCTCAAATACATTGGAAGAAACGACTT
AGTCAAAGATCTGATATTTAGATCTATGGGACATTAAAAACTTAATCTCA
ATTTAAAATTTAGTAAACATACTATTAGTTTCCAGGTCTTGATTAAAGTC
TCCCCGATTCGGAAGCTGTCAAC
back to top

protein sequence of SMED30002478-orf-1

>SMED30002478-orf-1 ID=SMED30002478-orf-1|Name=SMED30002478-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MSISSELNVRERDKFIINFRGNIESVTRSELMVTYNSQLPNRLEFFVQEK
DKFAQKNKDSYQGYVSVLKSGETFLDKLWEIVIFIPKFENERNNSLHKDF
DFKPTDTINKEYLHYLSHQIGEDWKHLGYALRVPDETIRRIANDTREEMS
SMTYQCLLKWIKNLPVYSNKVELMEKALKYIGRNDLVKDLIFRSMGH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000488Death_domain
IPR011029DEATH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 101..192
e-value: 6.0E-18
score: 66.7
IPR000488Death domainPFAMPF00531Deathcoord: 113..190
e-value: 5.6E-10
score: 39.3
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 109..194
score: 14.976
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 105..191