TPA_inf: pedal peptide prohormone like-1

Overview
NameTPA_inf: pedal peptide prohormone like-1 (DAA33930.1)
Smed IDSMED30002469
Length (bp)585
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPA_inf: pedal peptide prohormone like-1 (SMED30002469) t-SNE clustered cells

Violin plots show distribution of expression levels for TPA_inf: pedal peptide prohormone like-1 (SMED30002469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPA_inf: pedal peptide prohormone like-1 (SMED30002469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPA_inf: pedal peptide prohormone like-1 (SMED30002469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30002469SMESG000035027.1 SmedASXL_018974SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30002469SMESG000035027.1 dd_Smed_v4_3211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002469SMESG000035027.1 dd_Smed_v4_3211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002469SMESG000035027.1 dd_Smed_v4_3211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002469SMESG000035027.1 dd_Smed_v4_3211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002469SMESG000035027.1 Contig50861newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002469SMESG000035027.1 Contig50861uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30002469SMESG000035027.1 dd_Smed_v6_3211_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30002469SMESG000035027.1 BK007041smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30002469SMESG000035027.1 BK007041smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30002469SMESG000035027.1 BK007041smed_ncbi_20200123PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Match: E3CTL6 (Pedal peptide prohormone like-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 6.874e-97
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 3
Query:   21 MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN 482
            MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN
Sbjct:    1 MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN 154          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Match: A0A193PE73 (Neuropeptide-35 (Fragment) OS=Dugesia japonica OX=6161 GN=DjNp35 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.698e-40
Identity = 80/117 (68.38%), Postives = 94/117 (80.34%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRF---------YNDPLGVALL 452
            ++ S+  G  KRG+YYDPIGGGLLK+ SYYDPIGGGLLK+ S YDPIGGGLLK+RS+YDPIGGGLLK+RS+YDPIGG LLK+RS+YDPIG GLLK+R          Y DP+G  LL
Sbjct:   15 FHYSMREGPFKRGSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGSLLKKRSYYDPIGSGLLKRRSAAYLQKKFNYYDPIGGGLL 131          

HSP 2 Score: 141.739 bits (356), Expect = 9.031e-40
Identity = 80/108 (74.07%), Postives = 90/108 (83.33%), Query Frame = 3
Query:  114 FKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRS---------FYDPIGGGLL 410
            FK+ SYYD IG GLLK+ +YYDPIGGGLLK+ SYYDPIGGGLLK+ S YDPIGGGLLK+RS+YDPIGG LLK+RS+YDPIG GLLKRRS         +YDPIGGGLL
Sbjct:   24 FKRGSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGSLLKKRSYYDPIGSGLLKRRSAAYLQKKFNYYDPIGGGLL 131          

HSP 3 Score: 132.88 bits (333), Expect = 2.602e-36
Identity = 71/90 (78.89%), Postives = 79/90 (87.78%), Query Frame = 3
Query:  192 GLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSR 461
            G  KR SYYDPIGGGLLK+ S YDPIGGGLLK+RS+YDPIGGGLLK+RS+YDPIGGGLLK+RS+YDPIGG LLKKR Y DP+G  LLK R
Sbjct:   22 GPFKRGSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGSLLKKRSYYDPIGSGLLKRR 111          

HSP 4 Score: 114.005 bits (284), Expect = 5.940e-29
Identity = 63/90 (70.00%), Postives = 73/90 (81.11%), Query Frame = 3
Query:  234 GLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN*EFLRTK 503
            G  KR S YDPIGGGLLK+RS+YDPIGGGLLK+RS+YDPIGGGLLK+RS+YDPIGGGLLKKR Y DP+G +LLK R   D I    L+ +
Sbjct:   22 GPFKRGSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGSLLKKRSYYDPIGSGLLKRR 111          

HSP 5 Score: 70.0922 bits (170), Expect = 6.797e-12
Identity = 44/85 (51.76%), Postives = 54/85 (63.53%), Query Frame = 3
Query:  249 DSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN*EFLRTK 503
            D+ Y P  G     + F+  +  G  KR S+YDPIGGGLLK+RS+YDPIGGGLLKKR Y DP+G  LLK R   D I    L+ +
Sbjct:    4 DNFYSPTLG-----QKFHYSMREGPFKRGSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKRSYYDPIGGGLLKKR 83          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Match: A0A0L8G8C2 (Uncharacterized protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22038148mg PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.738e-13
Identity = 48/120 (40.00%), Postives = 73/120 (60.83%), Query Frame = 3
Query:  108 RRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
            R F      DS+GSGL+K+    D +G GL+KR    D +G GL++R  N+D +G GL+K+    D +G GL++R    D +G GL+KR+   D +G GL+K+ F  D +G  L++ RF+
Sbjct:  322 RNFDTVGNLDSVGSGLIKK--NLDSVGSGLIKR--QLDSVGSGLIRR--NFDTVGSGLIKKN--LDSVGSGLIRRN--LDSVGSGLIKRQ--LDSVGSGLIKRNF--DSVGSGLIRRRFE 427          

HSP 2 Score: 75.0998 bits (183), Expect = 3.013e-12
Identity = 49/112 (43.75%), Postives = 73/112 (65.18%), Query Frame = 3
Query:  132 YDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
             DS+GSGL++R   +D +G GL+K++   D +G GL++R  N+D +G GL+K+    D +G GL++R    D +G GL+ RRSF D IG GL+KK F  D +G  L++  FD
Sbjct:  204 LDSVGSGLIRR--NFDTVGSGLIKKN--LDSVGSGLIRR--NFDTVGSGLIKKN--LDSVGSGLIRRN--LDSVGSGLI-RRSF-DTIGSGLIKKNF--DSVGSGLIRRSFD 301          

HSP 3 Score: 73.559 bits (179), Expect = 8.264e-12
Identity = 48/117 (41.03%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  132 YDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSF-----YDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
            +D+IGSGL+K+   +D +G GL++RS  +D IG GL+K+  N D +G GL+ RR+F      D +G GL+K+    D +G GL+KR+   D +G GL+++ F  D +G  L+K   D
Sbjct:  276 FDTIGSGLIKK--NFDSVGSGLIRRS--FDTIGSGLIKK--NLDSVGSGLI-RRNFDTVGNLDSVGSGLIKKN--LDSVGSGLIKRQ--LDSVGSGLIRRNF--DTVGSGLIKKNLD 379          

HSP 4 Score: 72.7886 bits (177), Expect = 1.513e-11
Identity = 45/113 (39.82%), Postives = 70/113 (61.95%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
              DS+G+GL+KR    D +G GL+K++   D +G GL++R  N+D +G GL+K+    D +G GL++R    D +G GL++R   +D IG GL+KK    D +G  L++  FD
Sbjct:   95 QLDSVGAGLIKR--QLDSVGSGLIKKN--LDSVGSGLIRR--NFDTVGSGLIKKN--LDSVGSGLIRRN--LDSVGSGLIRRN--FDTIGSGLIKKNL--DSVGSGLIRRNFD 193          

HSP 5 Score: 72.4034 bits (176), Expect = 2.264e-11
Identity = 45/116 (38.79%), Postives = 72/116 (62.07%), Query Frame = 3
Query:  132 YDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRD----SNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
            +DS+GSGL++R   +D IG GL+K++   D +G GL++R+     N D +G GL+K+    D +G GL+KR+   D +G GL++R   +D +G GL+KK    D +G  L++   D
Sbjct:  288 FDSVGSGLIRR--SFDTIGSGLIKKN--LDSVGSGLIRRNFDTVGNLDSVGSGLIKKN--LDSVGSGLIKRQ--LDSVGSGLIRRN--FDTVGSGLIKKNL--DSVGSGLIRRNLD 391          

HSP 6 Score: 72.0182 bits (175), Expect = 3.259e-11
Identity = 43/112 (38.39%), Postives = 71/112 (63.39%), Query Frame = 3
Query:  132 YDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
            +D++GSGL+K+    D +G GL++R+   D +G GL++R  N+D IG GL+K+    D +G GL++R   +D +G GL+K+    D +G GL+++ F  D +G  L+K   D
Sbjct:  132 FDTVGSGLIKK--NLDSVGSGLIRRN--LDSVGSGLIRR--NFDTIGSGLIKKN--LDSVGSGLIRRN--FDTVGSGLIKKN--LDSVGSGLIRRNF--DTVGSGLIKKNLD 229          

HSP 7 Score: 69.707 bits (169), Expect = 1.897e-10
Identity = 51/127 (40.16%), Postives = 75/127 (59.06%), Query Frame = 3
Query:  132 YDSIGSGLLKRGA----------YYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSF-----YDPIGGGLLKKRFYNDPLGVALLKSRFD 467
            +D++GSGL+K+              D +G GL++RS  +D IG GL+K+  N+D +G GL+ RRSF D IG GL+K+    D +G GL+ RR+F      D +G GL+KK    D +G  L+K + D
Sbjct:  240 FDTVGSGLIKKNLDSVGSGLIRRNLDSVGSGLIRRS--FDTIGSGLIKK--NFDSVGSGLI-RRSF-DTIGSGLIKKN--LDSVGSGLI-RRNFDTVGNLDSVGSGLIKKNL--DSVGSGLIKRQLD 355          

HSP 8 Score: 67.0106 bits (162), Expect = 1.452e-9
Identity = 49/139 (35.25%), Postives = 71/139 (51.08%), Query Frame = 3
Query:  114 FKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKR---------------------RSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFD 467
             ++    DS+GSGL+KR    D +G GL+KR    D +G GL+KR    D +G GL+KR+   D +G GL+KR                     +   D +G GL+KR+   D +G GL+KK    D +G  L++  FD
Sbjct:    7 CEEKRNLDSVGSGLIKR--NLDSVGSGLIKR--QLDSVGSGLIKR--QLDSVGSGLIKRQ--LDSVGSGLIKRKFEDGSEFEEIPLDNIEEDALKRQLDSVGAGLIKRQ--LDSVGSGLIKKNL--DSVGSGLIRRNFD 133          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Match: A0A267E0Y1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030032g2 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.391e-13
Identity = 52/107 (48.60%), Postives = 79/107 (73.83%), Query Frame = 3
Query:  120 KYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            K +Y+D +GSG  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   55 KRAYFDPMGSGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 154          

HSP 2 Score: 74.7146 bits (182), Expect = 7.231e-13
Identity = 55/140 (39.29%), Postives = 90/140 (64.29%), Query Frame = 3
Query:   33 GLLILTFVLVSVEFGD---FYRVSSSDLR-RFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
             LL+   +  S    D    +  S  +L+ + +K +Y+D +G G   + AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   11 ALLMAALICASSTRADSLHHHGASDQELQDQTEKRAYFDPMGYG---KRAYFDPMGSGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 141          

HSP 3 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   67 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 167          

HSP 4 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   80 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 180          

HSP 5 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   93 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 193          

HSP 6 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  106 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 206          

HSP 7 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  119 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 219          

HSP 8 Score: 73.9442 bits (180), Expect = 1.425e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  132 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 232          

HSP 9 Score: 66.6254 bits (161), Expect = 8.587e-10
Identity = 45/96 (46.88%), Postives = 71/96 (73.96%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGG 404
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G
Sbjct:  145 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG 234          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Match: A0A267EKV3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030032g1 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.660e-13
Identity = 53/108 (49.07%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DPIG G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   67 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPIGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 167          

HSP 2 Score: 75.0998 bits (183), Expect = 6.660e-13
Identity = 53/108 (49.07%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DPIG G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   80 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPIGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 180          

HSP 3 Score: 75.0998 bits (183), Expect = 6.660e-13
Identity = 53/108 (49.07%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DPIG G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:   93 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPIGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 193          

HSP 4 Score: 75.0998 bits (183), Expect = 6.660e-13
Identity = 53/108 (49.07%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DPIG G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  106 KKRAYFDPMGYGKKKR-AYFDPIGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 206          

HSP 5 Score: 75.0998 bits (183), Expect = 6.660e-13
Identity = 53/108 (49.07%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D IG G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  119 KKRAYFDPIGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 219          

HSP 6 Score: 74.3294 bits (181), Expect = 1.026e-12
Identity = 56/140 (40.00%), Postives = 90/140 (64.29%), Query Frame = 3
Query:   33 GLLILTFVLVSVEFGD---FYRVSSSDLR-RFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
             LL+   +  S    D    +  S  +L+ + +K +Y+D +G G   + AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DPIG G  KKR Y DP+G
Sbjct:   11 ALLMAALICASSTRADSLHHHGASDQELQDQTEKRAYFDPMGYG---KRAYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPIGYG-KKKRAYFDPMG 141          

HSP 7 Score: 73.9442 bits (180), Expect = 1.611e-12
Identity = 52/108 (48.15%), Postives = 79/108 (73.15%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLG 440
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G  KKR Y DP+G
Sbjct:  132 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG-KKKRAYFDPMG 232          

HSP 8 Score: 66.2402 bits (160), Expect = 9.597e-10
Identity = 45/96 (46.88%), Postives = 71/96 (73.96%), Query Frame = 3
Query:  117 KKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGG 404
            KK +Y+D +G G  KR AY+DP+G G  KR+ Y+DP+G G  KR + +DP+G G  K+R+++DP+G G  K+R+++DP+G G  K+R+++DP+G G
Sbjct:  145 KKRAYFDPMGYGKKKR-AYFDPMGYGKKKRA-YFDPMGYGKKKR-AYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYGK-KKRAYFDPMGYG 234          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Nematostella
Match: EDO40019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S884])

HSP 1 Score: 60.8474 bits (146), Expect = 1.254e-11
Identity = 41/131 (31.30%), Postives = 54/131 (41.22%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN*EFLRTKYKIRNI 521
            Y  S  SGLL +  Y  P   GLL ++ Y  P   GLL +     PI   LL +  +  P   GLL +  +  P   GLL +  +  P   GLL + FY  P    LL   F   S     L   + +R  
Sbjct:   32 YLTSFTSGLLPQAFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPITSRLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPF 162          

HSP 2 Score: 55.4546 bits (132), Expect = 1.063e-9
Identity = 35/112 (31.25%), Postives = 47/112 (41.96%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRF 464
            Y     SG L +  Y  P   GLL ++ Y      GLL +     P   GLL +  +  P   GLL +  +  PI   LL +  +  P   GLL + FY  P  + LL   F
Sbjct:    4 YLRPFTSGFLPQAFYLRPFTSGLLPQAFYLTSFTSGLLPQAFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPITSRLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAF 115          

HSP 3 Score: 55.4546 bits (132), Expect = 1.244e-9
Identity = 37/119 (31.09%), Postives = 50/119 (42.02%), Query Frame = 3
Query:  108 RRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRF 464
            R   +  Y     SGLL +  Y  P   GLL ++ Y  P   GLL +     P   GLL +  +      GLL +  +  P   GLL +  +  P   GLL + FY  P   +LL   F
Sbjct:   81 RLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPEAFYLRPFTSSLLPQAF 199          

HSP 4 Score: 54.6842 bits (130), Expect = 2.424e-9
Identity = 36/112 (32.14%), Postives = 47/112 (41.96%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRF 464
            Y     SGLL +  Y      GLL ++ Y  P   GLL +     P   GLL +  +  PI   LL +  +  P   GLL +  +  P   GLL + FY  P    LL   F
Sbjct:   18 YLRPFTSGLLPQAFYLTSFTSGLLPQAFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPITSRLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAFYLRPFTSGLLPQAF 129          

HSP 5 Score: 53.9138 bits (128), Expect = 4.194e-9
Identity = 35/112 (31.25%), Postives = 45/112 (40.18%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRF 464
            Y     SGLL +  Y  P   GLL ++ Y      GLL +     P   GLL +  +  P   GLL    +  P    LL +  +  P   GLL + FY  P    LL   F
Sbjct:  116 YLRPFTSGLLPQAFYLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPEAFYLRPFTSSLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAF 227          

HSP 6 Score: 52.7582 bits (125), Expect = 1.030e-8
Identity = 36/112 (32.14%), Postives = 46/112 (41.07%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRF 464
            Y     SGLL +  Y  PI   LL +  Y  P   GLL +     P   GLL +  +  P   GLL +  +  P   GLL +  +      GLL + FY  P    LL   F
Sbjct:   60 YLRPFTSGLLPQAFYLRPITSRLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPFTSGLLPQAF 171          

HSP 7 Score: 52.7582 bits (125), Expect = 1.146e-8
Identity = 38/131 (29.01%), Postives = 50/131 (38.17%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN*EFLRTKYKIRNI 521
            Y   I S LL +  Y  P   GLL +  Y  P   GLL +     P   GLL +  +  P   GLL +  +      GLL +  +  P   GLL + FY  P    LL   F         L   + +R  
Sbjct:   74 YLRPITSRLLPQVFYLRPFTSGLLPQVFYLRPFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPEAFYLRPFTSSLLPQAFYLRPF 204          

HSP 8 Score: 50.0618 bits (118), Expect = 9.500e-8
Identity = 31/99 (31.31%), Postives = 41/99 (41.41%), Query Frame = 3
Query:  129 YYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFY 425
            Y     SGLL +  Y      GLL ++ Y  P   GLL +     P   GLL    +  P    LL +  +  P   GLL +  +  P   GLL + FY
Sbjct:  130 YLRPFTSGLLPQAFYLRSFTLGLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPEAFYLRPFTSSLLPQAFYLRPFTSGLLPQAFYLRPFTSGLLPQAFY 228          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Nematostella
Match: EDO39805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8X1])

HSP 1 Score: 57.7658 bits (138), Expect = 3.005e-10
Identity = 44/118 (37.29%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  126 SYYDSIGSGLLKR-GAYYD-PIGGGLLKRSSYYDPIGGGLLKR-DSNYD-PIGGGLLKRRSFYDPIGGGLLKR-RSFYDPIGGGLLKR--RSFYDPIGGGLLKKR-FYNDPLGVALLK 455
            S+YD    G  +R G++YD P GG   +  S+YD + GG  +R  S YD P GG     RS+YD + GG  +   S+YD   GG  +R    +Y P GG   + R +Y+ P G A  +
Sbjct:  224 SWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRVTGGATRRVGSWYDRPTGGATRSVRSWYDRVTGGATRSGGSWYDRATGGATRRVGSWYYGPTGGATRRVRSWYDRPTGGATRR 341          

HSP 2 Score: 57.3806 bits (137), Expect = 4.107e-10
Identity = 46/118 (38.98%), Postives = 62/118 (52.54%), Query Frame = 3
Query:  126 SYYDSIGSGLLKR-GAYYD-PIGGGLLKRSSYYD-PIGGGLLKRDSNYD-PIGGGLLKRRSFYDPIGGGLLKRR-SFYD-PIGGGLLKRRSFYD-PIGGGLLKKR-FYNDPLGVALLK 455
            S+YD    G  +R  ++YD P GG   +  S+YD P GG   +  S YD P GG     RS+YD   GG  +R  S+YD P GG   +  S+YD P GG   + R +Y+ P G A  +
Sbjct:   89 SWYDRPTGGATRRVESWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRSVRSWYDRATGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRRVRSWYDRPTGGATRR 206          

HSP 3 Score: 55.0694 bits (131), Expect = 2.827e-9
Identity = 48/148 (32.43%), Postives = 74/148 (50.00%), Query Frame = 3
Query:   60 VSVEFGDFY-RVSSSDLRRFKKYSYYDSIGSGLLKR-GAYYDPIGGGLLKRS-SYYDPIGGGLLKRDSN--YDPIGGGLLKRRSFYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYDPIGGGLLKK--RFYNDPLGVAL--LKSRFDK 470
             +   G +Y RV+    RR    S+YD    G  +   ++YD + GG  +   S+YD   GG  +R  +  Y P GG   + RS+YD P GG   +  S+YD P GG   +  S+YD   GG  ++   +Y+ P G A   ++S +D+
Sbjct:  248 ATRRVGSWYDRVTGGATRRVG--SWYDRPTGGATRSVRSWYDRVTGGATRSGGSWYDRATGGATRRVGSWYYGPTGGATRRVRSWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRATGGATRRVGSWYDRPTGGATRRVRSWYDR 393          

HSP 4 Score: 54.6842 bits (130), Expect = 3.613e-9
Identity = 47/135 (34.81%), Postives = 67/135 (49.63%), Query Frame = 3
Query:   75 GDFY-RVSSSDLRRFKKYSYYDSIGSGLLKRGAYYD-PIGGGLLKRSSYYDPIGGGLLKR-DSNYDPIGGGLLKRR-SFYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYDPIGGGLLKK--RFYNDPLGVALLK 455
            G +Y R +    RR   + YY   G    +  ++YD P GG   +  S+YD   GG  +R  S YD   GG  +R  S+YD P GG   + RS+YD P GG   +  S+YD   GG  ++   +Y+ P G A  +
Sbjct:  298 GSWYDRATGGATRRVGSW-YYGPTGGATRRVRSWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRATGGATRRVGSWYDRPTGGATRRVRSWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRR 431          

HSP 5 Score: 51.6026 bits (122), Expect = 3.638e-8
Identity = 45/133 (33.83%), Postives = 62/133 (46.62%), Query Frame = 3
Query:  126 SYYDSIGSGLLKR-GAYYD-PIGGGLLKRSSYYD----------------PIGGGLLKRDSNYD-PIGGGLLKRRSFYDPIGGGLLKRR-SFYD-PIGGGLLKRRSFYDPIGGGLLKK--RFYNDPLGVALLK 455
            S+YD    G  +R G++YD P GG      S+YD                P GG   +  S YD P GG   + RS+YD   GG  +R  S+YD P GG   +  S+YD   GG  ++   +Y+ P G A  +
Sbjct:  119 SWYDRPTGGATRRVGSWYDRPTGGATRSVRSWYDRATGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRRVRSWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRR 251          

HSP 6 Score: 50.0618 bits (118), Expect = 1.504e-7
Identity = 39/103 (37.86%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  168 AYYD-PIGGGLLKRSSYYDPIGGGLLKR-DSNYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYD-PIGGGLLK-KRFYNDPLGVALLK 455
            ++YD P GG   +  S+YD   GG  +R  S YD P GG      S+YD P GG   +  S+YD P GG   +  S+YD P GG   + + +Y+ P G A  +
Sbjct:   14 SWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRSVESWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRRVESWYDRPTGGATRR 116          

HSP 7 Score: 48.1358 bits (113), Expect = 7.005e-7
Identity = 38/105 (36.19%), Postives = 53/105 (50.48%), Query Frame = 3
Query:  180 PIGGGLLKRSSYYDPIGGGLLKR-DSNYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYD-PIGGGLLKRRSFYDPIGGGLLKK--RFYNDPLGVAL--LKSRFDK 470
            P GG      S+YD   GG  +R  S YD P GG   +  S+YD P GG      S+YD P GG   +  S+YD   GG  ++   +Y+ P G A   ++S +D+
Sbjct:    4 PTGGATRSVESWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRSVESWYDRPTGGATRRVGSWYDRPTGGATRRVGSWYDRPTGGATRRVESWYDR 108          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Nematostella
Match: EDO46823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNZ3])

HSP 1 Score: 53.5286 bits (127), Expect = 3.026e-9
Identity = 45/112 (40.18%), Postives = 59/112 (52.68%), Query Frame = -3
Query:  143 SLSNRLLSKATPSGSL*NRFFNNPPPIGS*KERLFNNPPPIGS*KERLFNSPPPIGS*KDRLFNNPPPIGS*FESLFSKP-PPIGS*YELRLSNP-PPIGS**APRLSNPLP 472
            S  +R  ++  P  S  +R  N  PPI S + R  N  PPI S + R  N  PPI S + R  N  PPI S  +S  + P PPI S ++ R +NP PPI S  + R +NP P
Sbjct:    2 SHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIQS-HQSRATNPEPPIQS-HQSRATNPEPPIQSHQS-RATNPEP 110          

HSP 2 Score: 51.2174 bits (121), Expect = 2.329e-8
Identity = 41/103 (39.81%), Postives = 54/103 (52.43%), Query Frame = -3
Query:  176 MLSLSNRLLSKATPSGSL*NRFFNNPPPIGS*KERLFNNPPPIGS*KERLFNSPPPIGS*KDRLFNNPPPIGS*FESLFSKP-PPIGS*YELRLSNP-PPIGS 478
            + S  +R  ++  P  S  +R  N  PPI S + R  N  PPI S + R  N  PPI S + R  N  PPI S  +S  + P PPI S ++ R +NP PPI S
Sbjct:   14 IKSHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIQSHQSRATNPEPPIQS-HQSRATNPEPPIQS-HQSRATNPEPPIKS 114          

HSP 3 Score: 48.9062 bits (115), Expect = 1.224e-7
Identity = 39/102 (38.24%), Postives = 52/102 (50.98%), Query Frame = -3
Query:  176 MLSLSNRLLSKATPSGSL*NRFFNNPPPIGS*KERLFNNPPPIGS*KERLFNSPPPIGS*KDRLFNNPPPIGS*FESLFSKPPPIGS*YELRLSNP-PPIGS 478
            + S  +R  ++  P  S  +R  N  PPI S + R  N  PPI S + R  N  PPI S + R  N  PPI S      ++ PPI S ++ R +NP PPI S
Sbjct:   56 IKSHQSRATNQEPPIQSHQSRATNPEPPIQSHQSRATNPEPPIQSHQSRATNPEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIKS-HQSRATNPEPPIKS 156          

HSP 4 Score: 46.595 bits (109), Expect = 8.209e-7
Identity = 40/103 (38.83%), Postives = 53/103 (51.46%), Query Frame = -3
Query:  176 MLSLSNRLLSKATPSGSL*NRFFNNPPPIGS*KERLFNNPPPIGS*KERLFNSPPPIGS*KDRLFNNPPPIGS*FESLFSKP-PPIGS*YELRLSN-PPPIGS 478
            + S  +R  ++  P  S  +R  N  PPI S + R  N  PPI S + R  N  PPI S + R  N  PPI S  +S  + P PPI S ++ R +N  PPI S
Sbjct:   28 IKSHQSRATNQEPPIKSHQSRATNQEPPIKSHQSRATNQEPPIQSHQSRATNPEPPIQSHQSRATNPEPPIQS-HQSRATNPEPPIKS-HQSRATNQEPPIKS 128          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Planmine SMEST
Match: SMESG000035027.1 (SMESG000035027.1)

HSP 1 Score: 286.96 bits (733), Expect = 1.912e-100
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 3
Query:   21 MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN 482
            MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN
Sbjct:    1 MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDKDSIN 154          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Planmine SMEST
Match: SMESG000059588.1 (SMESG000059588.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.314e-13
Identity = 47/106 (44.34%), Postives = 61/106 (57.55%), Query Frame = 3
Query:   21 MKSTGLLI----LTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLL 326
            M   G+LI    +T +L +V+        S +    K++ Y+D IGS LLKR +Y+D IG  LLKR SY D IG  LLKR   +D IG  +LK RS+ D IG  LL
Sbjct:    1 MTVNGILISSMMITIILSTVDLS-----KSREHGEIKRFRYFDKIGSDLLKR-SYFDKIGNDLLKR-SYMDKIGSDLLKR-RYFDKIGSEMLK-RSYMDKIGSDLL 97          

HSP 2 Score: 60.4622 bits (145), Expect = 3.311e-12
Identity = 40/73 (54.79%), Postives = 48/73 (65.75%), Query Frame = 3
Query:  192 GLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLL 410
            G +KR  Y+D IG  LLKR S +D IG  LLKR S+ D IG  LLKRR ++D IG  +LK RS+ D IG  LL
Sbjct:   29 GEIKRFRYFDKIGSDLLKR-SYFDKIGNDLLKR-SYMDKIGSDLLKRR-YFDKIGSEMLK-RSYMDKIGSDLL 97          

HSP 3 Score: 49.6766 bits (117), Expect = 4.045e-8
Identity = 30/60 (50.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  276 GLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLK 455
            G +KR  ++D IG  LLKR S++D IG  LLKR S+ D IG  LLK+R++ D +G  +LK
Sbjct:   29 GEIKRFRYFDKIGSDLLKR-SYFDKIGNDLLKR-SYMDKIGSDLLKRRYF-DKIGSEMLK 85          
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Planmine SMEST
Match: SMESG000059626.1 (SMESG000059626.1)

HSP 1 Score: 46.2098 bits (108), Expect = 4.632e-7
Identity = 38/89 (42.70%), Postives = 48/89 (53.93%), Query Frame = 3
Query:   24 KSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGAYYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKR 290
            K   L  +T   V+V    F + S+ D+R+ +   Y D +G  LLK    Y  IG  LLKRS Y+D IG  LLKR S  D IG  LL+R
Sbjct:    3 KKIFLFSMTIAFVAVILNSF-KSSAVDIRQSR---YIDKMGDDLLKPSVVY-KIGKELLKRS-YFDKIGSDLLKR-SYIDKIGSDLLRR 84          
The following BLAST results are available for this feature:
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3CTL66.874e-97100.00Pedal peptide prohormone like-1 OS=Schmidtea medit... [more]
A0A193PE733.698e-4068.38Neuropeptide-35 (Fragment) OS=Dugesia japonica OX=... [more]
A0A0L8G8C22.738e-1340.00Uncharacterized protein (Fragment) OS=Octopus bima... [more]
A0A267E0Y16.391e-1348.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EKV36.660e-1349.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO400191.254e-1131.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398053.005e-1037.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468233.026e-940.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPA_inf: pedal peptide prohormone like-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000035027.11.912e-100100.00SMESG000035027.1[more]
SMESG000059588.13.314e-1344.34SMESG000059588.1[more]
SMESG000059626.14.632e-742.70SMESG000059626.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30002469
GenBankDAA33930.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002469 ID=SMED30002469|Name=TPA_inf: pedal peptide prohormone like-1|organism=Schmidtea mediterranea sexual|type=transcript|length=585bp
CAAATATCCCGAACTGATTTATGAAATCTACAGGCTTGCTAATTTTGACA
TTCGTTCTTGTTTCTGTAGAATTTGGTGATTTCTATCGAGTTTCTTCCTC
TGATTTACGACGATTCAAAAAATATTCATATTATGATTCAATAGGAAGTG
GATTACTCAAACGTGGAGCTTACTATGATCCAATTGGTGGAGGGTTACTT
AAACGTAGCTCATATTATGATCCAATCGGAGGTGGTTTGCTGAAAAGGGA
TTCAAATTATGATCCAATTGGTGGCGGGTTATTAAAAAGGCGATCTTTCT
ATGACCCAATCGGCGGTGGGCTATTAAAAAGGCGTTCTTTTTATGACCCA
ATCGGTGGGGGGTTATTAAAGAGGCGTTCTTTCTATGACCCAATTGGTGG
CGGGTTATTAAAGAAACGGTTTTATAATGACCCACTCGGTGTCGCTTTGC
TTAAAAGTCGATTTGACAAAGATAGCATTAATTGAGAATTTTTGCGAACA
AAATATAAAATAAGAAACATTCTGTATTTATATTTTAATAAATTACGATG
AATATCTTTTTTGTTTAAAATATTTAGTATTGTTT
back to top

protein sequence of SMED30002469-orf-1

>SMED30002469-orf-1 ID=SMED30002469-orf-1|Name=SMED30002469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MKSTGLLILTFVLVSVEFGDFYRVSSSDLRRFKKYSYYDSIGSGLLKRGA
YYDPIGGGLLKRSSYYDPIGGGLLKRDSNYDPIGGGLLKRRSFYDPIGGG
LLKRRSFYDPIGGGLLKRRSFYDPIGGGLLKKRFYNDPLGVALLKSRFDK
DSIN*
back to top
Aliases
The feature 'TPA_inf: pedal peptide prohormone like-1' has the following synonyms
Synonym
ppp-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.63