Ferritin

Overview
NameFerritin
Smed IDSMED30002458
Length (bp)964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ferritin (SMED30002458) t-SNE clustered cells

Violin plots show distribution of expression levels for Ferritin (SMED30002458) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ferritin (SMED30002458) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ferritin (SMED30002458) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002458

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30002458SMESG000076636.1 OX_Smed_1.0.19911ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30002458SMESG000076636.1 dd_Smed_v4_2638_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 189.889 bits (481), Expect = 2.585e-59
Identity = 101/173 (58.38%), Postives = 130/173 (75.14%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTLKD 678
            TSQ+RQN+H D E  IN QIN EL+ASYVY +MS++FDRDDV+L  F+K+F  QS EEREHAEKLMK QN+RGGR+ L+DI KP   +W +  +A E AL LEK VNQ+LL+LHK+A   +DP + DFIE  YL EQV+++K++ D++TN+R+ G    GL  YLFDK TL D
Sbjct:    6 TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGD 178          
BLAST of Ferritin vs. Ensembl Human
Match: FTH1 (ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:3976])

HSP 1 Score: 189.889 bits (481), Expect = 2.585e-59
Identity = 101/173 (58.38%), Postives = 130/173 (75.14%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTLKD 678
            TSQ+RQN+H D E  IN QIN EL+ASYVY +MS++FDRDDV+L  F+K+F  QS EEREHAEKLMK QN+RGGR+ L+DI KP   +W +  +A E AL LEK VNQ+LL+LHK+A   +DP + DFIE  YL EQV+++K++ D++TN+R+ G    GL  YLFDK TL D
Sbjct:    6 TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGD 178          
BLAST of Ferritin vs. Ensembl Human
Match: FTL (ferritin light chain [Source:HGNC Symbol;Acc:HGNC:3999])

HSP 1 Score: 171.4 bits (433), Expect = 3.121e-52
Identity = 88/173 (50.87%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXX-XXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTLK 675
            M+SQIRQN+ +D E  +N  +N  L ASY Y ++ F+FDRDDV+L G S FFRE + E+RE  E+L+K QN+RGGR + +DI KP + EW     A ++A+ LEK +NQALLDLH +    +DP + DF+E  +L+E+V+ +KK+ D+LTN+ R GG   GLG YLF++LTLK
Sbjct:    1 MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLK 173          
BLAST of Ferritin vs. Ensembl Human
Match: FTMT (ferritin mitochondrial [Source:HGNC Symbol;Acc:HGNC:17345])

HSP 1 Score: 170.244 bits (430), Expect = 6.876e-51
Identity = 92/171 (53.80%), Postives = 122/171 (71.35%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
             S++RQNFH D E  IN QIN EL+ASYVY +M+++F RDDV+L+ FS++F  QS EE EHAEKLM+ QN+RGGR+ L+DI KP Q +W +   A E AL LEK VNQ+LL+LH +A    DP + DF+E  YL EQV+S+K++ D++ N+ + G    GL  YLFD  TL
Sbjct:   65 PSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALNNFSRYFLHQSREETEHAEKLMRLQNQRGGRIRLQDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTL 235          
BLAST of Ferritin vs. Ensembl Human
Match: FTHL17 (ferritin heavy chain like 17 [Source:HGNC Symbol;Acc:HGNC:3987])

HSP 1 Score: 147.902 bits (372), Expect = 5.339e-43
Identity = 80/170 (47.06%), Postives = 115/170 (67.65%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            SQ+RQ + ++C+  IN  I  EL+ SY+Y +M+F+F+RDDV+L  F ++F   S ++ EHA+KLM+ QN RGG + L DI KP    W +   A ESA  LEK VNQ+LLDL+++A    DPQ+  F+E  YL EQV+++K++  Y++N+R+      GL  YLFDKLTL
Sbjct:    7 SQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTL 176          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 172.94 bits (437), Expect = 2.819e-53
Identity = 94/169 (55.62%), Postives = 124/169 (73.37%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+HS+ E  +N+QIN EL+ASYVY +MSF+FDRDDV+L   +KFF+EQS EEREHA +LM+ QN RGGRVVL+DI KP   EW TA  AFE+AL LEK  N++LL LH  A  ++D  + DFIE +YL+EQV+S+ + +  + N++R G G+G Y+FDK    D
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDKEHFSD 170          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-2 (Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3])

HSP 1 Score: 172.94 bits (437), Expect = 2.819e-53
Identity = 94/169 (55.62%), Postives = 124/169 (73.37%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+HS+ E  +N+QIN EL+ASYVY +MSF+FDRDDV+L   +KFF+EQS EEREHA +LM+ QN RGGRVVL+DI KP   EW TA  AFE+AL LEK  N++LL LH  A  ++D  + DFIE +YL+EQV+S+ + +  + N++R G G+G Y+FDK    D
Sbjct:    2 SLARQNYHSEVEAAVNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRGGRVVLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGNHNDAHLTDFIEEKYLDEQVKSINEFARMVANLKRVGPGVGEYVFDKEHFSD 170          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 161.384 bits (407), Expect = 6.526e-49
Identity = 87/169 (51.48%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+H + E  +N+QIN EL+ASYVY +MS  FDRDD++L   +KFF+EQS EER HA +LM+ Q  RGGRV +++I KP + EW T   AFE+AL LE+  N +LL LH +AE  +D  + ++I+ +YLEEQV S+ + + Y+ NI+R G GLG YLFDK    D
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDKEEFSD 170          
BLAST of Ferritin vs. Ensembl Celegans
Match: ftn-1 (Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453])

HSP 1 Score: 161.384 bits (407), Expect = 6.526e-49
Identity = 87/169 (51.48%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+H + E  +N+QIN EL+ASYVY +MS  FDRDD++L   +KFF+EQS EER HA +LM+ Q  RGGRV +++I KP + EW T   AFE+AL LE+  N +LL LH +AE  +D  + ++I+ +YLEEQV S+ + + Y+ NI+R G GLG YLFDK    D
Sbjct:    2 SLARQNYHDEVEAAVNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRGGRVAMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQRNDAHLTNYIQEKYLEEQVHSINEFARYIANIKRAGPGLGEYLFDKEEFSD 170          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer3HCH (gene:FBgn0030449 transcript:FBtr0073745)

HSP 1 Score: 146.362 bits (368), Expect = 9.683e-43
Identity = 73/165 (44.24%), Postives = 108/165 (65.45%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDK 663
            M   +RQNF   CE  +N+QIN EL AS+ Y AM++ FDR D+S  G  +FF + S+EEREHAEK+M Y NKRGG ++L  + +P     +   A + A+++E  VN+ LLDLH +A   +DP + DFIE  +L+EQV+  K ++DY++ + +    +G +LFDK
Sbjct:   12 MCMLVRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRGGLIILSSVPQPLPCFASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEANFLQEQVDGQKILADYISQLEKAQNQVGEFLFDK 176          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0344763)

HSP 1 Score: 79.7221 bits (195), Expect = 1.043e-17
Identity = 53/163 (32.52%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  205 CENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRV-VLKDITKPPQI---EWTXXXXXXXXXXXXKL-VNQALLDLHKVAETN--SDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDK 663
            C  G+  QI +E++ASY Y AM  +F RD V+  GF++ F + + EEREH  KL++Y + RG     + D+   P +   EWT  +A  S     ++ V +++  L +  E    +   ++D++   YLEEQ+   ++++  LT +++     G LG +LFDK
Sbjct:    5 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 167          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085633)

HSP 1 Score: 79.7221 bits (195), Expect = 1.965e-17
Identity = 53/163 (32.52%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  205 CENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRV-VLKDITKPPQI---EWTXXXXXXXXXXXXKL-VNQALLDLHKVAETN--SDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDK 663
            C  G+  QI +E++ASY Y AM  +F RD V+  GF++ F + + EEREH  KL++Y + RG     + D+   P +   EWT  +A  S     ++ V +++  L +  E    +   ++D++   YLEEQ+   ++++  LT +++     G LG +LFDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085632)

HSP 1 Score: 79.7221 bits (195), Expect = 1.965e-17
Identity = 53/163 (32.52%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  205 CENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRV-VLKDITKPPQI---EWTXXXXXXXXXXXXKL-VNQALLDLHKVAETN--SDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDK 663
            C  G+  QI +E++ASY Y AM  +F RD V+  GF++ F + + EEREH  KL++Y + RG     + D+   P +   EWT  +A  S     ++ V +++  L +  E    +   ++D++   YLEEQ+   ++++  LT +++     G LG +LFDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Fly
Match: Fer1HCH (gene:FBgn0015222 transcript:FBtr0085631)

HSP 1 Score: 79.7221 bits (195), Expect = 1.965e-17
Identity = 53/163 (32.52%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  205 CENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRV-VLKDITKPPQI---EWTXXXXXXXXXXXXKL-VNQALLDLHKVAETN--SDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDK 663
            C  G+  QI +E++ASY Y AM  +F RD V+  GF++ F + + EEREH  KL++Y + RG     + D+   P +   EWT  +A  S     ++ V +++  L +  E    +   ++D++   YLEEQ+   ++++  LT +++     G LG +LFDK
Sbjct:   41 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 203          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 198.364 bits (503), Expect = 6.901e-63
Identity = 101/172 (58.72%), Postives = 133/172 (77.33%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            M+SQ+RQNF   CE  +N QIN EL+ASYVY +MS++FDRDD +L  F+KFFR QS EEREHAEKLMK+QN+RGGR+ L+D+ KP + EW +   A E AL+LEK VN +LL+LHK+A  ++DP M DFIE  YL+EQV+S+K++ D++TN+RR G    G+  Y+FDKLTL
Sbjct:    1 MSSQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1a (ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-000831-2])

HSP 1 Score: 198.364 bits (503), Expect = 6.901e-63
Identity = 101/172 (58.72%), Postives = 133/172 (77.33%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            M+SQ+RQNF   CE  +N QIN EL+ASYVY +MS++FDRDD +L  F+KFFR QS EEREHAEKLMK+QN+RGGR+ L+D+ KP + EW +   A E AL+LEK VN +LL+LHK+A  ++DP M DFIE  YL+EQV+S+K++ D++TN+RR G    G+  Y+FDKLTL
Sbjct:    1 MSSQVRQNFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQRGGRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQHNDPHMCDFIETHYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDKLTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl27 (ferritin, heavy polypeptide-like 27 [Source:ZFIN;Acc:ZDB-GENE-040718-72])

HSP 1 Score: 190.66 bits (483), Expect = 5.243e-60
Identity = 99/172 (57.56%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            M SQ+RQN+  DCE  IN+ IN EL+A Y Y +M+F+FDRDDV+L GF+KFF++ S EEREHAEK M++QNKRGGR+VL+DI KP + EW    +A + AL+LEK VNQALLDLHKVA    DP + DF+E  YL EQVE++KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    1 MDSQVRQNYDRDCEALINKMINLELYAGYTYTSMAFYFDRDDVALPGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPERDEWDNGLTAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLESHYLNEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fthl28 (ferritin, heavy polypeptide-like 28 [Source:ZFIN;Acc:ZDB-GENE-030131-7540])

HSP 1 Score: 186.037 bits (471), Expect = 4.113e-58
Identity = 97/171 (56.73%), Postives = 126/171 (73.68%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            T QIRQN+ SDCE  IN+ IN EL+A Y Y +M+ +F RDDV+L+GF+KFF++ S EEREHAEK M++QNKRGGR+VL+DI KP +  W     A + AL+LEK VNQALLDLHKVA    DP + DF+E  YL+EQVE++KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    3 TCQIRQNYDSDCEASINKMINLELYAGYTYTSMAHYFKRDDVALNGFAKFFKKNSEEEREHAEKFMEFQNKRGGRIVLQDIKKPDRDVWDNGLIAMQCALQLEKNVNQALLDLHKVASQKGDPHLCDFLETHYLDEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Zebrafish
Match: fth1b (ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040912-30])

HSP 1 Score: 185.652 bits (470), Expect = 6.264e-58
Identity = 98/172 (56.98%), Postives = 129/172 (75.00%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            M+SQ+RQNFH +CE  IN QI  EL+ASYVY +M ++FDRDD SL  F+KFFR+QS EEREHAEKLM  QN+RGGR+ L+DI KP + EW +   A E AL LEK VN +LL+LHKVA  ++DP + DF+E  YL+EQV+S+K++SD++ ++RR G     +  YLFD+ TL
Sbjct:    1 MSSQVRQNFHQECEAAINRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFRDQSKEEREHAEKLMSLQNQRGGRIFLQDIKKPDRDEWGSGLEALECALALEKSVNLSLLELHKVATQHNDPHVCDFLETHYLDEQVKSIKELSDWVGSLRRMGAPQNNMAEYLFDRHTL 172          
BLAST of Ferritin vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:NCBI gene;Acc:394604])

HSP 1 Score: 209.534 bits (532), Expect = 3.779e-67
Identity = 107/172 (62.21%), Postives = 135/172 (78.49%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            M SQ+RQNF+SDCE  IN  +N EL+ASYVY +MS++FDRDDV+L   +KFF+EQS EEREHAEK +KYQNKRGGR VL+DI KP + EW     A ++AL+LEK VNQALLDLHK+A   +DP + DF+E EYLEEQV++MK++ DY+TN++R G    G+G YLFDK TL
Sbjct:    1 MQSQVRQNFNSDCEAAINRMVNMELYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRAVLQDIKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKLASDKTDPHLCDFLESEYLEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Xenopus
Match: nop53 (NOP53 ribosome biogenesis factor [Source:Xenbase;Acc:XB-GENE-853827])

HSP 1 Score: 195.282 bits (495), Expect = 1.430e-61
Identity = 98/172 (56.98%), Postives = 132/172 (76.74%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTX-XXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            M SQ+RQN+H +CE  IN Q+N EL+ASYVY +M+++FDRDDV+L  FSK+F  QS EEREHAEKLMK QN+RGGR+ L+D+ KP + EW     A E +L+LEK VNQ+LL+LHK++  ++DP + DF+E  YL+EQV+SMK++ D++TN+RR G    G+  YLFDK TL
Sbjct:    1 MNSQVRQNYHQECEAAINRQVNMELYASYVYLSMAYYFDRDDVALKNFSKYFLHQSHEEREHAEKLMKMQNQRGGRIFLQDVKKPDRDEWANGLEALECSLQLEKSVNQSLLELHKLSTDHNDPHLCDFLESHYLDEQVKSMKELGDHITNLRRMGAPSNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC75752 (uncharacterized protein MGC75752 [Source:NCBI gene;Acc:394820])

HSP 1 Score: 189.119 bits (479), Expect = 4.171e-59
Identity = 100/176 (56.82%), Postives = 131/176 (74.43%), Query Frame = 1
Query:  163 ITMTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTLKD 678
            ++  SQIRQN+H + E GIN   N EL  SYVY ++ ++FDRDDV+LS FSK++RE S ++R+HAE L+K+QNKRGGRVVL+DI KP   EW     A E AL LEK VNQALLDLHK+A  ++DP M D++E E+LEE+V+ +KK+ D+LTN++R      G+G YLFDKLTL D
Sbjct:    1 MSAQSQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTLGD 176          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 185.267 bits (469), Expect = 9.446e-58
Identity = 97/172 (56.40%), Postives = 128/172 (74.42%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            M SQ+RQN+  DCE  +N  +N E++ASY Y +MS +FDRDDV+L   ++FF+EQS EERE AEKLMK QNKRGGR+VL+DI KP + EW +   A ++AL+LEK VNQALLDLH +A    DP + DF+E E+L+EQV+ MKK  D++TN++R G    G+G YLFDK +L
Sbjct:    1 MISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHSL 172          
BLAST of Ferritin vs. Ensembl Xenopus
Match: MGC79725 (MGC79725 protein [Source:NCBI gene;Acc:448524])

HSP 1 Score: 184.882 bits (468), Expect = 1.454e-57
Identity = 97/171 (56.73%), Postives = 127/171 (74.27%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLT 669
            M SQ+RQN+  DCE  +N  +N E++ASY Y +MS +FDRDDV+L   ++FF+EQS EERE AEKLMK QNKRGGR+VL+DI KP + EW +   A ++AL+LEK VNQALLDLH +A    DP + DF+E E+L+EQV+ MKK  D++TN++R G    G+G YLFDK T
Sbjct:    1 MISQVRQNYSHDCEAAVNRMVNLEMYASYTYLSMSHYFDRDDVALHHVAEFFKEQSKEERECAEKLMKCQNKRGGRIVLQDIKKPERDEWGSTLDAMQTALDLEKHVNQALLDLHNLATERKDPHICDFLESEHLDEQVKHMKKFGDHITNLKRLGVPQNGMGEYLFDKHT 171          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 185.652 bits (470), Expect = 7.754e-58
Identity = 99/170 (58.24%), Postives = 128/170 (75.29%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            SQ+RQN+H D E  IN QIN EL+ASYVY +MS +FDRDDV+L  F+K+F  QS EEREHAEKLMK QN+RGGR+ L+DI KP + +W +  +A E AL LEK VNQ+LL+LHK+A   +DP + DFIE  YL EQV+S+K++ D++TN+R+ G    G+  YLFDK TL
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Mouse
Match: Fth1 (ferritin heavy polypeptide 1 [Source:MGI Symbol;Acc:MGI:95588])

HSP 1 Score: 185.652 bits (470), Expect = 7.754e-58
Identity = 99/170 (58.24%), Postives = 128/170 (75.29%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            SQ+RQN+H D E  IN QIN EL+ASYVY +MS +FDRDDV+L  F+K+F  QS EEREHAEKLMK QN+RGGR+ L+DI KP + +W +  +A E AL LEK VNQ+LL+LHK+A   +DP + DFIE  YL EQV+S+K++ D++TN+R+ G    G+  YLFDK TL
Sbjct:    7 SQVRQNYHQDAEAAINRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDPHLCDFIETYYLSEQVKSIKELGDHVTNLRKMGAPEAGMAEYLFDKHTL 176          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftmt (ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:1914884])

HSP 1 Score: 181.8 bits (460), Expect = 1.156e-55
Identity = 98/173 (56.65%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  166 TMTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            T  S++RQNFH D E  IN QIN EL+ASYVY +M+++F RDDV+L  FSK+F  QSLEEREHAEKLMK QN+RGGR+ L+DI KP + +W     A E AL LEK VNQ+LLDLH +A    DP + DF+E  YL EQV+S+K++ D++ N+   G    GL  YLFDK TL
Sbjct:   59 TRPSRVRQNFHPDSEAAINRQINLELYASYVYLSMAYYFSRDDVALYNFSKYFLRQSLEEREHAEKLMKLQNQRGGRICLQDIKKPDKDDWECGLRAMECALLLEKNVNQSLLDLHTLASEKGDPHLCDFLETHYLHEQVKSIKELGDHVHNLVTMGAPAAGLAEYLFDKHTL 231          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1 (ferritin light polypeptide 1 [Source:MGI Symbol;Acc:MGI:95589])

HSP 1 Score: 166.777 bits (421), Expect = 1.566e-50
Identity = 84/181 (46.41%), Postives = 118/181 (65.19%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXX-XXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG-----------GGLGVYLFDKLTLK 675
            MTSQIRQN+ ++ E  +N  +N  L ASY Y ++ FFFDRDDV+L G   FFRE + E+RE AE+L+++QN RGGR + +D+ KP Q EW        A   +EK +NQALLDLH +    +DP + DF+E  YL+++V+ +KK+ ++LTN+RR             G LG YLF++LTLK
Sbjct:    1 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLK 181          
BLAST of Ferritin vs. Ensembl Mouse
Match: Ftl1-ps1 (ferritin light polypeptide 1, pseudogene 1 [Source:MGI Symbol;Acc:MGI:3779109])

HSP 1 Score: 166.777 bits (421), Expect = 1.566e-50
Identity = 84/181 (46.41%), Postives = 118/181 (65.19%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXX-XXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG-----------GGLGVYLFDKLTLK 675
            MTSQIRQN+ ++ E  +N  +N  L ASY Y ++ FFFDRDDV+L G   FFRE + E+RE AE+L+++QN RGGR + +D+ KP Q EW        A   +EK +NQALLDLH +    +DP + DF+E  YL+++V+ +KK+ ++LTN+RR             G LG YLF++LTLK
Sbjct:    1 MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFERLTLK 181          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P42577|FRIS_LYMST (Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV=2)

HSP 1 Score: 214.927 bits (546), Expect = 1.125e-68
Identity = 108/168 (64.29%), Postives = 137/168 (81.55%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
             SQ RQN+H++ E GIN QIN EL+ASY YQ+M+++FDRDDV+L GF KFF+ QS EEREHAEKLMKYQNKRGGR+VL+DI KP + EW T   A + AL+LEK VNQ+LLDLHK+  ++ D QM DF+E E+LEEQV+S+K++SDY+TN++R G GLG Y+FDK TL
Sbjct:    3 VSQARQNYHAESEAGINRQINMELYASYSYQSMAYYFDRDDVALPGFHKFFKHQSEEEREHAEKLMKYQNKRGGRIVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKLCTSHDDAQMADFLESEFLEEQVKSIKELSDYITNLKRVGPGLGEYIFDKETL 170          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P17663|FRIHB_XENLA (Ferritin heavy chain B OS=Xenopus laevis OX=8355 GN=fth1-b PE=2 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 3.410e-67
Identity = 108/172 (62.79%), Postives = 137/172 (79.65%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXX-XXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            M SQ+RQNF+SDCE  IN  +N E++ASYVY +MS++FDRDDV+L   +KFF+EQS EEREHAEK +KYQNKRGGRVVL+DI KP + EW+    A ++AL+LEK VNQALLDLHK+A    DPQ+ DF+E EYLEEQV++MK++ DY+TN++R G    G+G YLFDK TL
Sbjct:    1 MQSQVRQNFNSDCEAAINRMVNLEMYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRVVLQDIKKPERDEWSNTLEAMQAALQLEKTVNQALLDLHKLASDKVDPQLCDFLESEYLEEQVKAMKELGDYITNLKRLGVPQNGMGEYLFDKHTL 172          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P49948|FRIHA_XENLA (Ferritin heavy chain A OS=Xenopus laevis OX=8355 GN=fth1-a PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.960e-66
Identity = 107/172 (62.21%), Postives = 134/172 (77.91%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            M SQ+RQNFHSDCE  IN  +N E++ASYVY +MS++FDRDDV+L   +KFF+EQS EEREHAEK +KYQNKRGGRVVL+DI KP + EW     A ++AL+LEK VNQALLDLHK+A    D  + DF+E EYLEEQV++MK++ DY+TN++R G    G+G YLFDK TL
Sbjct:    1 MQSQVRQNFHSDCEAAINRMVNMEMYASYVYLSMSYYFDRDDVALHHVAKFFKEQSHEEREHAEKFLKYQNKRGGRVVLQDIKKPERDEWGNTLEATQAALQLEKTVNQALLDLHKLASDKVDAHLCDFLESEYLEEQVKAMKQLGDYITNLKRLGVPQNGMGEYLFDKHTL 172          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P07229|FRI1_LITCT (Ferritin, higher subunit OS=Lithobates catesbeianus OX=8400 PE=1 SV=3)

HSP 1 Score: 204.527 bits (519), Expect = 1.426e-64
Identity = 104/172 (60.47%), Postives = 132/172 (76.74%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            M SQ+RQNFH DCE  IN  +N EL+ASY Y +M+F+FDRDD++L   +KFF+EQS EEREHAEKLMK QNKRGGR+VL+D+ KP + EW     A ++AL+LEK VNQALLDLHKV     DP + DF+E EYLEEQV+S+K++ DY+TN++R G    G+G YLFDK T+
Sbjct:    1 MDSQVRQNFHRDCEAAINRMVNMELYASYTYLSMAFYFDRDDIALHNVAKFFKEQSHEEREHAEKLMKDQNKRGGRIVLQDVKKPERDEWGNTLEAMQAALQLEKTVNQALLDLHKVGSDKVDPHLCDFLETEYLEEQVKSIKQLGDYITNLKRLGLPQNGMGEYLFDKHTM 172          
BLAST of Ferritin vs. UniProt/SwissProt
Match: sp|P49946|FRIH_SALSA (Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 4.654e-64
Identity = 105/172 (61.05%), Postives = 134/172 (77.91%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            MTSQ+RQNFH DCE  IN QIN EL+ASYVY +M+++FDRDD +L  F+KFF+ QS EEREHAEKLMK QN+RGGR+ L+D+ KP + EW +   A ES+L+LEK VNQ+LLDLHKV   ++DP M DFIE  YL+EQV+S+K++ D++TN+RR G    G+  YLFDK TL
Sbjct:    1 MTSQVRQNFHQDCEAAINRQINLELYASYVYLSMAYYFDRDDQALHNFAKFFKNQSHEEREHAEKLMKVQNQRGGRIFLQDVKKPEKDEWGSGVEALESSLQLEKSVNQSLLDLHKVCSEHNDPHMCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. TrEMBL
Match: A0A2C9JSJ7 (Ferritin OS=Biomphalaria glabrata OX=6526 GN=106066392 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 5.646e-72
Identity = 116/168 (69.05%), Postives = 138/168 (82.14%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
             SQ RQN+H+DCE GIN QIN EL+ASY YQ+M+F+F+RDDV+L GF KFF++QS EEREHAEKLMKYQNKRGGRVVL+DI KP + EW T   A + AL+LEK VNQ+LLDLHKV   + DPQM DF+E EYLEEQVES+K+I DY+TN++R G GLG YLFDK TL
Sbjct:    3 VSQCRQNYHADCEAGINRQINMELYASYTYQSMAFYFERDDVALPGFHKFFKKQSEEEREHAEKLMKYQNKRGGRVVLQDIKKPDRDEWGTGLEAMQVALQLEKSVNQSLLDLHKVCTDHEDPQMADFLESEYLEEQVESIKQIGDYITNLKRVGSGLGEYLFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: A0A2R4PCX0 (Ferritin OS=Sinanodonta woodiana OX=1069815 GN=Fer1 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.130e-70
Identity = 113/167 (67.66%), Postives = 143/167 (85.63%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
            ++ RQN+H++ E GIN+QIN EL+ASYVYQ+MS++FDRDDV+L GF+KFF++ S EEREHAEKLMKYQNKRGGR+VL++I KP + EW T   A E AL+LEK VNQALLDLHKVA+++ DPQMMDFIEHEYLEEQV S+K++ D++TN++R G GLG Y+FDK TL
Sbjct:    4 TRPRQNYHAESEAGINKQINMELYASYVYQSMSYYFDRDDVALKGFAKFFKKSSEEEREHAEKLMKYQNKRGGRIVLQNIKKPDRDEWGTGLDATEVALDLEKSVNQALLDLHKVADSHGDPQMMDFIEHEYLEEQVSSIKQLCDHITNLKRVGTGLGEYMFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: Q6WNW7 (Ferritin OS=Branchiostoma belcheri tsingtauense OX=155462 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.034e-69
Identity = 115/170 (67.65%), Postives = 138/170 (81.18%), Query Frame = 1
Query:  172 TSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
             SQ+RQNFH D E GIN+QIN EL+ASYVY +M+ +FDRDDV+L GF+KFFR QS EEREHAEKLMKYQN RGGRVVL+ I KP   EW T   A ++AL LEK VNQ+LLDLHK A+T SDPQMMDF+E EYL+EQVES+K+I+D++TN++R G GLG Y+FD  TL D
Sbjct:    3 VSQVRQNFHEDSEAGINKQINLELYASYVYHSMATYFDRDDVALKGFAKFFRHQSDEEREHAEKLMKYQNMRGGRVVLQHIQKPDHDEWGTGLDAMQAALALEKSVNQSLLDLHKTADTCSDPQMMDFLEGEYLKEQVESIKEIADHVTNLKRVGSGLGEYMFDHETLGD 172          
BLAST of Ferritin vs. TrEMBL
Match: G0YWG0 (Ferritin OS=Hyriopsis schlegelii OX=319528 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.315e-69
Identity = 113/167 (67.66%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
            ++ RQN+H++ E GIN+QIN EL+A YVYQ+MS++FDRDDV+L GF+KFF++ S EEREHAEK MKYQNKRGGR+VL+DI KP + EW T   A E AL+LEK VNQALLDLHKVAE++ DPQMMDFIEHE+LEEQV S+K+I D++TN++R G GLG Y+FDK TL
Sbjct:    4 TRPRQNYHAESEAGINKQINMELYACYVYQSMSYYFDRDDVALKGFAKFFKKSSEEEREHAEKFMKYQNKRGGRIVLQDIKKPDRDEWGTGLDAMEVALDLEKSVNQALLDLHKVAESHGDPQMMDFIEHEFLEEQVNSIKEICDHITNLKRVGTGLGEYMFDKETL 170          
BLAST of Ferritin vs. TrEMBL
Match: H6TG56 (Ferritin OS=Hyriopsis cumingii OX=165450 PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 2.696e-69
Identity = 113/167 (67.66%), Postives = 141/167 (84.43%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
            ++ RQN+H++ E GIN+QIN EL+A YVYQ+MS++FDRDDV+L GF+KFF++ S EEREHAEK MKYQNKRGGR+VL+DI KP + EW T   A E AL+LEK VNQALLDLHKVAE++ DPQMMDFIEHE+LEEQV S+K+I D++TN++R G GLG Y+FDK TL
Sbjct:    4 TRPRQNYHAENEAGINKQINMELYACYVYQSMSYYFDRDDVALKGFAKFFKKSSEEEREHAEKFMKYQNKRGGRIVLQDIKKPDRDEWGTGLDAMEVALDLEKSVNQALLDLHKVAESHGDPQMMDFIEHEFLEEQVNSIKEICDHITNLKRVGTGLGEYMFDKETL 170          
BLAST of Ferritin vs. Ensembl Cavefish
Match: fth1b (ferritin, heavy subunit [Source:NCBI gene;Acc:103039853])

HSP 1 Score: 203.371 bits (516), Expect = 5.339e-65
Identity = 106/172 (61.63%), Postives = 134/172 (77.91%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            M+SQ+RQNFH DCE  IN QIN EL+ASYVY +MS++FDRDD +L  F+KFF +QS EEREHAEKLMK QN+RGGR+ L+DI KP + EW +   A E AL+LEK VNQ+LLDLHKVA   +DP M DFIE  YL+EQV+S+K+++D+++N+RR G    G+  YLFDK TL
Sbjct:    1 MSSQVRQNFHQDCEAAINRQINLELYASYVYLSMSYYFDRDDQALPNFAKFFHKQSHEEREHAEKLMKLQNQRGGRIFLQDIRKPERDEWGSGVEALECALQLEKSVNQSLLDLHKVASERNDPHMCDFIETHYLDEQVKSIKELADWVSNLRRMGAPQNGMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000033875.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029096])

HSP 1 Score: 194.126 bits (492), Expect = 2.092e-61
Identity = 99/172 (57.56%), Postives = 126/172 (73.26%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            MTSQIRQN+HSDCE  IN  +N E +ASY Y +M+++F RDDV+L GF+ FF+E S EEREHAEK +++QNKRGGRV L+DI KP + EW T   A + AL+LEK VNQALLDLHK+A    DP + DF+E  YL EQVE +KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    1 MTSQIRQNYHSDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHKIASEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000048516.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 189.119 bits (479), Expect = 2.000e-59
Identity = 96/172 (55.81%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            M SQ+RQN+H DCE  IN  +N EL ASY Y +M+++F RDDV+L GF+ FF+E S EE+EHAEKL+ +QNKRGGR+ L+DI KP + EW T   A + AL+LEK VNQALLDLHK+A    DP + DF+E  YL EQVE++KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    1 MNSQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000042393.1 (ferritin, middle subunit [Source:NCBI gene;Acc:103038450])

HSP 1 Score: 186.808 bits (473), Expect = 1.546e-58
Identity = 95/170 (55.88%), Postives = 124/170 (72.94%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            SQ+RQN+H DCE  IN  +N EL ASY Y +M+++F RDDV+L GF+ FF+E S EE+EHAEKL+ +QNKRGGR+ L+DI KP + EW T   A + AL+LEK VNQALLDLHK+A    DP + DF+E  YL EQVE++KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    4 SQVRQNYHRDCEAAINRMVNMELFASYTYTSMAYYFSRDDVALEGFAHFFKENSHEEQEHAEKLLSFQNKRGGRIFLQDIKKPERDEWGTGLEAMQCALQLEKNVNQALLDLHKIASEKGDPHLCDFLETHYLNEQVEAIKKLGDHITNLTKMDAGNNRMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Cavefish
Match: ENSAMXT00000052792.1 (ferritin, middle subunit-like [Source:NCBI gene;Acc:103029400])

HSP 1 Score: 181.8 bits (460), Expect = 1.305e-56
Identity = 93/170 (54.71%), Postives = 121/170 (71.18%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGG---LGVYLFDKLTL 672
            S +RQN+H DCE  IN  +N E +ASY Y +M+++F RDDV+L GF+ FF+E S EEREHAEK +++QNKRGGRV L+DI KP + EW T   A + AL+LEK VNQALLDLH +A    DP + DF+E  YL EQVE +KK+ D++TN+ +   G   +  YLFDK TL
Sbjct:    4 SLVRQNYHRDCEAAINRMVNMEFYASYTYTSMAYYFSRDDVALKGFAHFFKENSHEEREHAEKFLEFQNKRGGRVFLQDIKKPERDEWGTGLEAMQCALQLEKKVNQALLDLHNIATEKGDPHLCDFLESNYLNEQVEMIKKLGDHITNLTKMDAGNNKMAEYLFDKHTL 173          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009440.1 (pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 gene:ENSPMAG00000008472.1 transcript:ENSPMAT00000009440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.608 bits (527), Expect = 2.735e-67
Identity = 107/172 (62.21%), Postives = 134/172 (77.91%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            MTSQ+RQN+  D E  IN QIN EL ASYVY +M+++FDRDDV+L+ F KFF+EQS EEREHAEKLM YQNKRGGRVVLKD+ KP + EW +   A + AL+LEK VNQ+LLDLH +    +DPQ+ DF+E  YLEEQVE++KK+ D++TN++R G    G+G YLFDKLTL
Sbjct:    1 MTSQVRQNYAQDVEAAINRQINMELSASYVYLSMAYYFDRDDVALNNFFKFFKEQSHEEREHAEKLMAYQNKRGGRVVLKDVKKPERDEWGSGLEAVQLALQLEKNVNQSLLDLHALGSKENDPQLCDFLESHYLEEQVEAIKKLGDFVTNLKRLGASQSGMGEYLFDKLTL 172          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006438.1 (pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-1 gene:ENSPMAG00000005680.1 transcript:ENSPMAT00000006438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.445 bits (511), Expect = 5.056e-65
Identity = 104/172 (60.47%), Postives = 135/172 (78.49%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            MTSQIRQNF  + E  IN Q+N+EL+ASYVY +++ +FDRDDV+L  F KFF++ S EEREHAEKL++YQNKRGGR VL+DI KP + EW +   A + AL+LEK VNQALLDLH +A   +DPQ+ DF+E E+LEEQVES+KK+ D++TN++R G    G+G YLFDK+TL
Sbjct:    1 MTSQIRQNFSQEVEAAINRQVNQELYASYVYLSLASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKTDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPQSGMGEYLFDKMTL 172          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009047.1 (pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 gene:ENSPMAG00000008168.1 transcript:ENSPMAT00000009047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 1.932e-63
Identity = 102/173 (58.96%), Postives = 134/173 (77.46%), Query Frame = 1
Query:  166 TMTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            +  S +RQNF  +CE  IN QIN+EL+ASYVY +M+F+FDRDDV+L   SKFFREQSLEER HAEKLM YQN+RGGR+ L+D+ KP + EW  A  A   AL+LEK VNQALL+LH +A  ++DPQ+ DF++  YLEEQVES+K I+D++T++++ G    G+G +LFDKLTL
Sbjct:    4 SAMSLVRQNFSEECEAAINRQINQELYASYVYLSMAFYFDRDDVALKHLSKFFREQSLEERGHAEKLMGYQNRRGGRIFLQDVQKPERDEWGNALEALTLALQLEKNVNQALLELHALATEHNDPQLCDFLDSHYLEEQVESIKNIADHITSLKKMGVPQSGMGEFLFDKLTL 176          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006468.1 (pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1 gene:ENSPMAG00000005828.1 transcript:ENSPMAT00000006468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 6.110e-62
Identity = 105/174 (60.34%), Postives = 132/174 (75.86%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDIT--KPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTL 672
            MTSQIRQNF  + E  IN Q+N+EL+ASYVY +M+ +FDRDDV+L  F KFF++ S EEREHAEKL++YQNKRGGR VL+DI   KP + EW +   A + AL+LEK VNQALLDLH +A    DPQ+ DF+E E+LEEQVES+KK+ D++TN++R G      G YLFDKLTL
Sbjct:    5 MTSQIRQNFSQEVEAAINRQVNQELYASYVYLSMASYFDRDDVALKHFHKFFKDLSHEEREHAEKLLEYQNKRGGRAVLQDIKEQKPERDEWGSGLEAMQLALQLEKTVNQALLDLHALASEKKDPQLCDFLESEFLEEQVESIKKLGDHVTNLKRLGVPHSTTGEYLFDKLTL 178          
BLAST of Ferritin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008696.1 (pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 gene:ENSPMAG00000007869.1 transcript:ENSPMAT00000008696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 3.351e-56
Identity = 93/174 (53.45%), Postives = 131/174 (75.29%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWT-XXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNG---GGLGVYLFDKLTLKD 678
            M SQ+RQN+  D E  IN Q+N  LHASYV+ +++ +FDRDDV+L  F KFF+E S +EREHA+KL+ YQNKRGGRVVL+DI  P + +W     A ++AL+L+K +NQ+LLDLH  A   +DPQ+ +F++ ++LEEQVES+KK+ D++TN++R G    GLG YL+++LTL D
Sbjct:    5 MASQVRQNYSPDVEAAINRQVNMTLHASYVFLSLASYFDRDDVALKNFRKFFKELSDKEREHADKLLAYQNKRGGRVVLRDIKTPERDDWGHILEAMQTALQLQKSINQSLLDLHGQAREKNDPQLCEFLK-DFLEEQVESIKKLGDHITNLKRLGVPQSGLGEYLYERLTLGD 177          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO39948 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6])

HSP 1 Score: 192.971 bits (489), Expect = 1.706e-61
Identity = 99/167 (59.28%), Postives = 129/167 (77.25%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
            S  RQN+H +CE GIN+QIN EL+ASY Y +M+F FDRDDV+L GF K+F + S EEREHAEKLMK+QN+RGGR+VL+DI KP + EW     + + AL+LEK VNQALLDLHK+AE + D QM DFIE  +L EQVE++K+++ +LTN++R G GLG Y +D  T+
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYAYLSMAFHFDRDDVALPGFHKYFLKASHEEREHAEKLMKFQNERGGRIVLQDIKKPEKDEWGCGMDSIQVALDLEKHVNQALLDLHKIAEKHGDAQMTDFIEGNFLTEQVEAIKELAGHLTNLKRVGPGLGEYQYDHETI 168          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO35374 (Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6])

HSP 1 Score: 189.504 bits (480), Expect = 4.078e-60
Identity = 97/167 (58.08%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTL 672
            S  RQN+H +CE GIN+QIN EL+ASYVY +M+ +FDR+DV L GF KFF++Q+ EEREHAEKLMK+QN+RGGR+VL+++ KP + EW +   A ++AL+LEK VNQAL++L K AE N D QM DFIE  +L EQVES++++S Y+  +++ G GLGVY FD  TL
Sbjct:    2 SLCRQNYHEECEAGINKQINLELYASYVYTSMACYFDREDVHLPGFHKFFKKQAHEEREHAEKLMKFQNQRGGRIVLQNVKKPERDEWGSGLEAMQTALDLEKHVNQALIELEKTAEKNGDAQMSDFIEDHFLTEQVESIRELSGYIAVLKKVGPGLGVYQFDHETL 168          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI7])

HSP 1 Score: 188.734 bits (478), Expect = 9.085e-60
Identity = 98/169 (57.99%), Postives = 132/169 (78.11%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+H + E G+N+QIN EL+ASYVY +M++ FDRDDV+L GF K+F + S EEREHAEKL K+Q +RGGR+VL+DI +P + +W   + A ++AL+LEK VNQALLDLHKVAE + D QM D++E  YL EQVE++K+++ +LTN++R G GLG + FDKLTL D
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAYHFDRDDVALPGFHKYFMKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHLTNLKRVGPGLGEFQFDKLTLDD 172          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO31579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI8])

HSP 1 Score: 187.963 bits (476), Expect = 1.981e-59
Identity = 98/169 (57.99%), Postives = 131/169 (77.51%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+H + E G+N+QIN EL+ASYVY +M+F FDRDDV+L GF K+F E S EEREHAEKL K+Q +RGGR+VL+DI +P + +W   + A ++AL+LEK VNQALLDLHKVAE + D QM D++E  YL EQVE++K+++ ++TN++R G GLG + FDK TL D
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFMEASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALLDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTLDD 172          
BLAST of Ferritin vs. Ensembl Nematostella
Match: EDO32257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVL1])

HSP 1 Score: 183.341 bits (464), Expect = 1.172e-57
Identity = 96/169 (56.80%), Postives = 130/169 (76.92%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            S  RQN+H + E G+N+QIN EL+ASYVY +M+F FDRDDV+L GF K+F + S EEREHAEKL K+Q +RGGR+VL+DI +P + +W   + A ++AL+LEK VNQAL DLHKVAE + D QM D++E  YL EQVE++K+++ ++TN++R G GLG + FDK TL D
Sbjct:    4 SVCRQNYHEESEAGVNKQINLELYASYVYMSMAFHFDRDDVALPGFHKYFIKASHEEREHAEKLAKFQLQRGGRIVLQDIKRPERDDWGCGQDAIQAALDLEKHVNQALHDLHKVAEKHGDSQMQDWLESHYLTEQVEAIKELAGHMTNLKRVGPGLGEFQFDKHTLDD 172          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020971.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 194.126 bits (492), Expect = 1.991e-61
Identity = 100/172 (58.14%), Postives = 127/172 (73.84%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDKLTL 672
            M SQ+RQN+H DCE  IN  +N EL ASY Y +M+F+FDRDDV+L GFS FF+E S EE+EHA+KL+ +QNKRGGR+ L+D+ KP + EW +   A + AL+LEK VNQALLDLHKVA  + DP M DF+E  YL EQVES+KKI D++TN+ R   +   +  YLFDK TL
Sbjct:    1 MESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPERDEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020975.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 194.126 bits (492), Expect = 2.034e-61
Identity = 100/172 (58.14%), Postives = 127/172 (73.84%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDKLTL 672
            M SQ+RQN+H DCE  IN  +N EL ASY Y +M+F+FDRDDV+L GFS FF+E S EE+EHA+KL+ +QNKRGGR+ L+D+ KP + EW +   A + AL+LEK VNQALLDLHKVA  + DP M DF+E  YL EQVES+KKI D++TN+ R   +   +  YLFDK TL
Sbjct:    1 MESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020972.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 194.126 bits (492), Expect = 2.034e-61
Identity = 100/172 (58.14%), Postives = 127/172 (73.84%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDKLTL 672
            M SQ+RQN+H DCE  IN  +N EL ASY Y +M+F+FDRDDV+L GFS FF+E S EE+EHA+KL+ +QNKRGGR+ L+D+ KP + EW +   A + AL+LEK VNQALLDLHKVA  + DP M DF+E  YL EQVES+KKI D++TN+ R   +   +  YLFDK TL
Sbjct:    1 MESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTL 172          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000020974.2 (ferritin, middle subunit [Source:NCBI gene;Acc:101171335])

HSP 1 Score: 194.126 bits (492), Expect = 2.603e-61
Identity = 100/172 (58.14%), Postives = 127/172 (73.84%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRR---NGGGLGVYLFDKLTL 672
            M SQ+RQN+H DCE  IN  +N EL ASY Y +M+F+FDRDDV+L GFS FF+E S EE+EHA+KL+ +QNKRGGR+ L+D+ KP + EW +   A + AL+LEK VNQALLDLHKVA  + DP M DF+E  YL EQVES+KKI D++TN+ R   +   +  YLFDK TL
Sbjct:    8 MESQVRQNYHRDCEAAINRMVNMELFASYTYTSMAFYFDRDDVALPGFSHFFKENSHEEKEHADKLLSFQNKRGGRIFLQDVKKPDRNEWGSGLEAMQCALQLEKNVNQALLDLHKVASDHKDPHMCDFLETHYLNEQVESIKKIGDHITNLTRMDAHTNKMAEYLFDKHTL 179          
BLAST of Ferritin vs. Ensembl Medaka
Match: ENSORLT00000007389.2 (ferritin, heavy subunit [Source:NCBI gene;Acc:101169025])

HSP 1 Score: 190.66 bits (483), Expect = 5.071e-60
Identity = 100/170 (58.82%), Postives = 127/170 (74.71%), Query Frame = 1
Query:  175 SQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEW-TXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGG---GLGVYLFDKLTL 672
            SQ+R NFH DCE  IN QIN EL+ASYVY +M ++FDRDD +L  F+KFFR+QS EE EHAEKLMK QN+RGGR+ L+DI KP + EW     A E AL+LEK VNQ+LLD+HK+    +DP + DFIE  YL+EQV+S+K++ D++TN+RR G    G+  YLFDK TL
Sbjct:    5 SQVRHNFHQDCEAAINRQINLELYASYVYLSMGYYFDRDDQALHNFAKFFRKQSHEEHEHAEKLMKLQNQRGGRIFLQDIKKPDRDEWGNGLEALECALQLEKNVNQSLLDMHKLCSERNDPHLCDFIETHYLDEQVKSIKELGDWVTNLRRMGAPQNGMAEYLFDKHTL 174          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000076636.1 (SMESG000076636.1)

HSP 1 Score: 327.02 bits (837), Expect = 7.192e-114
Identity = 169/170 (99.41%), Postives = 170/170 (100.00%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDV+LSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTAESAFESALELEKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD
Sbjct:    1 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVALSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTAESAFESALELEKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 170          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068030.1 (SMESG000068030.1)

HSP 1 Score: 258.84 bits (660), Expect = 6.186e-87
Identity = 131/170 (77.06%), Postives = 154/170 (90.59%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            M SQ+RQNFHS+ E GIN+QINKEL+ASYVYQAM F+FDRDDV+L GFSKFFR QS EEREHAEKL+KYQNKRGGR+VL++I+KP   EWT E+AFESAL LEK VNQ+LLDLHK+AE ++DPQMMDF+E EYL+EQV+S+K+ISD+LTNIRRNG G+GVYLFDKLTLKD
Sbjct:    1 MASQVRQNFHSESEAGINKQINKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAEKLIKYQNKRGGRIVLENISKPTASEWTPETAFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTLKD 170          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000068027.1 (SMESG000068027.1)

HSP 1 Score: 258.07 bits (658), Expect = 9.261e-87
Identity = 130/170 (76.47%), Postives = 153/170 (90.00%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            M SQ+RQNFHS+ E GIN+Q+NKEL+ASYVYQAM F+FDRDDV+L GFSKFFR QS EEREHA+KLM YQNKRGGR+VL+DI+KP   EWT E+AFESAL LEK VNQ+LLDLHK+AE ++DPQMMDF+E EYL+EQV+S+K+ISD+LTNIRRNG G+GVYLFDKLTLKD
Sbjct:    1 MASQVRQNFHSESEAGINKQVNKELYASYVYQAMGFYFDRDDVALEGFSKFFRHQSEEEREHAQKLMAYQNKRGGRIVLEDISKPTASEWTPETAFESALALEKEVNQSLLDLHKIAEKHNDPQMMDFLEGEYLKEQVDSIKEISDHLTNIRRNGPGVGVYLFDKLTLKD 170          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000039456.1 (SMESG000039456.1)

HSP 1 Score: 253.832 bits (647), Expect = 5.117e-85
Identity = 127/170 (74.71%), Postives = 156/170 (91.76%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            MTSQ+RQNFHS+ E+GIN+QINKELHASYVYQAMSF+F+RDDV+L GFS FF +QSLEEREHAEKLMKYQN RGGR+VLKDI KP  +EWT E+AFESAL LEK VNQ+LL+LHK+AET++DPQM D++E ++LEEQV+SMK+I+D++TNIRRNG G+G+YL+DKLTLK+
Sbjct:    1 MTSQVRQNFHSESEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 169          
BLAST of Ferritin vs. Planmine SMEST
Match: SMESG000014076.1 (SMESG000014076.1)

HSP 1 Score: 253.832 bits (647), Expect = 5.117e-85
Identity = 127/170 (74.71%), Postives = 156/170 (91.76%), Query Frame = 1
Query:  169 MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSKFFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTXXXXXXXXXXXXKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTNIRRNGGGLGVYLFDKLTLKD 678
            MTSQ+RQNFHS+ E+GIN+QINKELHASYVYQAMSF+F+RDDV+L GFS FF +QSLEEREHAEKLMKYQN RGGR+VLKDI KP  +EWT E+AFESAL LEK VNQ+LL+LHK+AET++DPQM D++E ++LEEQV+SMK+I+D++TNIRRNG G+G+YL+DKLTLK+
Sbjct:    1 MTSQVRQNFHSESEDGINDQINKELHASYVYQAMSFYFNRDDVALQGFSNFFHKQSLEEREHAEKLMKYQNIRGGRIVLKDIAKPSIVEWTPETAFESALALEKDVNQSLLNLHKIAETHNDPQMTDYLE-DFLEEQVDSMKEIADHITNIRRNGTGVGIYLYDKLTLKE 169          
The following BLAST results are available for this feature:
BLAST of Ferritin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FTH12.585e-5958.38ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTH12.585e-5958.38ferritin heavy chain 1 [Source:HGNC Symbol;Acc:HGN... [more]
FTL3.121e-5250.87ferritin light chain [Source:HGNC Symbol;Acc:HGNC:... [more]
FTMT6.876e-5153.80ferritin mitochondrial [Source:HGNC Symbol;Acc:HGN... [more]
FTHL175.339e-4347.06ferritin heavy chain like 17 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Ferritin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ftn-22.819e-5355.62Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-22.819e-5355.62Ferritin [Source:UniProtKB/TrEMBL;Acc:Q9TYS3][more]
ftn-16.526e-4951.48Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
ftn-16.526e-4951.48Ferritin [Source:UniProtKB/TrEMBL;Acc:O16453][more]
back to top
BLAST of Ferritin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fer3HCH9.683e-4344.24gene:FBgn0030449 transcript:FBtr0073745[more]
Fer1HCH1.043e-1732.52gene:FBgn0015222 transcript:FBtr0344763[more]
Fer1HCH1.965e-1732.52gene:FBgn0015222 transcript:FBtr0085633[more]
Fer1HCH1.965e-1732.52gene:FBgn0015222 transcript:FBtr0085632[more]
Fer1HCH1.965e-1732.52gene:FBgn0015222 transcript:FBtr0085631[more]
back to top
BLAST of Ferritin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1a6.901e-6358.72ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fth1a6.901e-6358.72ferritin, heavy polypeptide 1a [Source:ZFIN;Acc:ZD... [more]
fthl275.243e-6057.56ferritin, heavy polypeptide-like 27 [Source:ZFIN;A... [more]
fthl284.113e-5856.73ferritin, heavy polypeptide-like 28 [Source:ZFIN;A... [more]
fth1b6.264e-5856.98ferritin, heavy polypeptide 1b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Ferritin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1.13.779e-6762.21ferritin, heavy polypeptide 1, gene 1 [Source:NCBI... [more]
nop531.430e-6156.98NOP53 ribosome biogenesis factor [Source:Xenbase;A... [more]
MGC757524.171e-5956.82uncharacterized protein MGC75752 [Source:NCBI gene... [more]
MGC797259.446e-5856.40MGC79725 protein [Source:NCBI gene;Acc:448524][more]
MGC797251.454e-5756.73MGC79725 protein [Source:NCBI gene;Acc:448524][more]
back to top
BLAST of Ferritin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fth17.754e-5858.24ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Fth17.754e-5858.24ferritin heavy polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftmt1.156e-5556.65ferritin mitochondrial [Source:MGI Symbol;Acc:MGI:... [more]
Ftl11.566e-5046.41ferritin light polypeptide 1 [Source:MGI Symbol;Ac... [more]
Ftl1-ps11.566e-5046.41ferritin light polypeptide 1, pseudogene 1 [Source... [more]
back to top
BLAST of Ferritin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42577|FRIS_LYMST1.125e-6864.29Soma ferritin OS=Lymnaea stagnalis OX=6523 PE=2 SV... [more]
sp|P17663|FRIHB_XENLA3.410e-6762.79Ferritin heavy chain B OS=Xenopus laevis OX=8355 G... [more]
sp|P49948|FRIHA_XENLA2.960e-6662.21Ferritin heavy chain A OS=Xenopus laevis OX=8355 G... [more]
sp|P07229|FRI1_LITCT1.426e-6460.47Ferritin, higher subunit OS=Lithobates catesbeianu... [more]
sp|P49946|FRIH_SALSA4.654e-6461.05Ferritin, heavy subunit OS=Salmo salar OX=8030 PE=... [more]
back to top
BLAST of Ferritin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JSJ75.646e-7269.05Ferritin OS=Biomphalaria glabrata OX=6526 GN=10606... [more]
A0A2R4PCX03.130e-7067.66Ferritin OS=Sinanodonta woodiana OX=1069815 GN=Fer... [more]
Q6WNW71.034e-6967.65Ferritin OS=Branchiostoma belcheri tsingtauense OX... [more]
G0YWG01.315e-6967.66Ferritin OS=Hyriopsis schlegelii OX=319528 PE=2 SV... [more]
H6TG562.696e-6967.66Ferritin OS=Hyriopsis cumingii OX=165450 PE=3 SV=1[more]
back to top
BLAST of Ferritin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fth1b5.339e-6561.63ferritin, heavy subunit [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000033875.12.092e-6157.56ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000048516.12.000e-5955.81ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000042393.11.546e-5855.88ferritin, middle subunit [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000052792.11.305e-5654.71ferritin, middle subunit-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Ferritin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009440.12.735e-6762.21pep scaffold:Pmarinus_7.0:GL477527:22989:26064:-1 ... [more]
ENSPMAT00000006438.15.056e-6560.47pep scaffold:Pmarinus_7.0:GL477323:212806:215511:-... [more]
ENSPMAT00000009047.11.932e-6358.96pep scaffold:Pmarinus_7.0:GL479272:14627:24709:-1 ... [more]
ENSPMAT00000006468.16.110e-6260.34pep scaffold:Pmarinus_7.0:GL477323:226303:228626:1... [more]
ENSPMAT00000008696.13.351e-5653.45pep scaffold:Pmarinus_7.0:GL479023:7641:33670:-1 g... [more]
back to top
BLAST of Ferritin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ferritin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399481.706e-6159.28Ferritin [Source:UniProtKB/TrEMBL;Acc:A7S8I6][more]
EDO353744.078e-6058.08Ferritin [Source:UniProtKB/TrEMBL;Acc:A7SLM6][more]
EDO315789.085e-6057.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315791.981e-5957.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322571.172e-5756.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ferritin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020971.21.991e-6158.14ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020975.22.034e-6158.14ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020972.22.034e-6158.14ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000020974.22.603e-6158.14ferritin, middle subunit [Source:NCBI gene;Acc:101... [more]
ENSORLT00000007389.25.071e-6058.82ferritin, heavy subunit [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Ferritin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076636.17.192e-11499.41SMESG000076636.1[more]
SMESG000068030.16.186e-8777.06SMESG000068030.1[more]
SMESG000068027.19.261e-8776.47SMESG000068027.1[more]
SMESG000039456.15.117e-8574.71SMESG000039456.1[more]
SMESG000014076.15.117e-8574.71SMESG000014076.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002458 ID=SMED30002458|Name=Ferritin|organism=Schmidtea mediterranea sexual|type=transcript|length=964bp
ATAATCTGTAAAACTAGACAATTTCAGAGAACAGTTTATTGATGTTTCTA
AAAATACCAGCCAATCAAATATCGATATTCTTGTTTTGTTGCATATCTGA
TATCGCTTTCCCATAACTCTGCATATTATCATATTTAAATAAGGAATAAG
TTGGAAAAACTCATAACGATGACTTCTCAAATTAGACAAAATTTCCACTC
TGACTGTGAAAATGGAATAAACGAACAAATTAATAAAGAACTTCATGCCA
GCTATGTTTATCAAGCTATGAGTTTCTTTTTCGACAGAGATGATGTCTCT
TTATCGGGATTTAGTAAATTTTTCAGAGAACAATCATTGGAAGAAAGAGA
ACACGCCGAAAAATTAATGAAATATCAAAACAAACGAGGCGGCAGAGTTG
TGTTGAAAGATATTACGAAACCGCCACAAATCGAATGGACAGCCGAATCG
GCATTTGAATCAGCATTGGAGTTAGAAAAGTTGGTTAATCAAGCTCTATT
GGACCTGCATAAAGTTGCCGAAACCAATTCAGATCCGCAAATGATGGATT
TTATTGAACACGAATATTTAGAAGAGCAAGTCGAATCAATGAAGAAAATT
AGCGATTATCTAACAAACATTCGTCGCAACGGTGGAGGATTGGGAGTGTA
TTTATTTGATAAATTAACTCTCAAAGACTAAATTCATTCACAATTATCAT
AACTCATCAAATTCACTTTGTTTGATTGAATCGATTTATTCTTATTCCTT
TCCAATCGATATCAAATGTGGATTTTCTATTATTCATGGATATTATGTAA
TAGATAGTGAATTCTGATTTGCATAAATATTTCTCTCAAATTCTATCGTT
CCGACACTGTTAGTTAGCTGTTCAATGCATCTTTCACAAACATTTTATTG
AAAACTTTTGTATTTATATTGGAAGATAGAAATCATGAATAAATTTTATC
TATTTCAAAAAAAA
back to top

protein sequence of SMED30002458-orf-1

>SMED30002458-orf-1 ID=SMED30002458-orf-1|Name=SMED30002458-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MTSQIRQNFHSDCENGINEQINKELHASYVYQAMSFFFDRDDVSLSGFSK
FFREQSLEEREHAEKLMKYQNKRGGRVVLKDITKPPQIEWTAESAFESAL
ELEKLVNQALLDLHKVAETNSDPQMMDFIEHEYLEEQVESMKKISDYLTN
IRRNGGGLGVYLFDKLTLKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001519Ferritin
IPR009078Ferritin-like_SF
IPR008331Ferritin_DPS_dom
IPR014034Ferritin_CS
IPR009040Ferritin-like_diiron
IPR012347Ferritin-like
Vocabulary: biological process
TermDefinition
GO:0006879cellular iron ion homeostasis
GO:0006826iron ion transport
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0008199ferric iron binding
GO:0004322ferroxidase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012347Ferritin-likeGENE3DG3DSA:1.20.1260.10coord: 1..170
e-value: 2.2E-77
score: 260.8
IPR008331Ferritin/DPS protein domainPFAMPF00210Ferritincoord: 16..153
e-value: 1.9E-38
score: 131.6
IPR001519FerritinPANTHERPTHR11431FERRITINcoord: 2..169
IPR014034Ferritin, conserved sitePROSITEPS00540FERRITIN_1coord: 58..76
IPR009040Ferritin-like diiron domainPROSITEPS50905FERRITIN_LIKEcoord: 7..155
score: 48.592
NoneNo IPR availableCDDcd01056Euk_Ferritincoord: 10..166
e-value: 3.80188E-86
score: 247.842
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 2..169