60S ribosomal protein L6

Overview
Name60S ribosomal protein L6
Smed IDSMED30002455
Length (bp)658
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L6 (SMED30002455) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L6 (SMED30002455) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L6 (SMED30002455) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L6 (SMED30002455) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002455

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30002455SMESG000076172.1 SmedASXL_003345SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002455SMESG000076172.1 dd_Smed_v4_205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30002455SMESG000076172.1 dd_Smed_v6_205_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002455SMESG000076172.1 dd_Smed_v6_205_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 183.726 bits (465), Expect = 4.215e-57
Identity = 95/185 (51.35%), Postives = 137/185 (74.05%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG RVVFLKQL+SGLLLV+GP  LN+VP+RR HQ +VIAT TKIDIS+++IP+ + DAYF+K +  K + +  +IF  +K++Y ++++RK DQK +DS I+  IK       L  YLR+ F+L++G  PHK+ F
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 183.726 bits (465), Expect = 4.215e-57
Identity = 95/185 (51.35%), Postives = 137/185 (74.05%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG RVVFLKQL+SGLLLV+GP  LN+VP+RR HQ +VIAT TKIDIS+++IP+ + DAYF+K +  K + +  +IF  +K++Y ++++RK DQK +DS I+  IK       L  YLR+ F+L++G  PHK+ F
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 76.2554 bits (186), Expect = 6.165e-18
Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 3
Query:  105 PRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLL 287
            PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG RVVFLKQL+SGLLL
Sbjct:    2 PRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLL 63          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 56.6102 bits (135), Expect = 1.219e-9
Identity = 28/53 (52.83%), Postives = 41/53 (77.36%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRG 242
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRG 159          
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Match: RPL6 (ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:10362])

HSP 1 Score: 56.6102 bits (135), Expect = 1.253e-9
Identity = 28/53 (52.83%), Postives = 41/53 (77.36%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRG 242
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRG 159          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 1.510e-48
Identity = 81/165 (49.09%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  147 NRTKLFSEHKRR--LRSTITPGTVLILLTGRYRGTRVVFLKQL-SSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            N TK    H +   LR T+TPGTVLI+L GR++G RVVFLKQL  SGLLLV+GP K+N  P+RR+ Q +VIAT  K+++S ++IPE I D YF++   ++    +IFA+ K EY +S++RK D K +D+ I+ AIK+  +   L  YL T FSL     PHKM F
Sbjct:   53 NGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 1.510e-48
Identity = 81/165 (49.09%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  147 NRTKLFSEHKRR--LRSTITPGTVLILLTGRYRGTRVVFLKQL-SSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            N TK    H +   LR T+TPGTVLI+L GR++G RVVFLKQL  SGLLLV+GP K+N  P+RR+ Q +VIAT  K+++S ++IPE I D YF++   ++    +IFA+ K EY +S++RK D K +D+ I+ AIK+  +   L  YL T FSL     PHKM F
Sbjct:   53 NGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 1.510e-48
Identity = 81/165 (49.09%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  147 NRTKLFSEHKRR--LRSTITPGTVLILLTGRYRGTRVVFLKQL-SSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            N TK    H +   LR T+TPGTVLI+L GR++G RVVFLKQL  SGLLLV+GP K+N  P+RR+ Q +VIAT  K+++S ++IPE I D YF++   ++    +IFA+ K EY +S++RK D K +D+ I+ AIK+  +   L  YL T FSL     PHKM F
Sbjct:   53 NGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Match: rpl-6 (60S ribosomal protein L6 [Source:UniProtKB/Swiss-Prot;Acc:P47991])

HSP 1 Score: 158.688 bits (400), Expect = 1.510e-48
Identity = 81/165 (49.09%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  147 NRTKLFSEHKRR--LRSTITPGTVLILLTGRYRGTRVVFLKQL-SSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            N TK    H +   LR T+TPGTVLI+L GR++G RVVFLKQL  SGLLLV+GP K+N  P+RR+ Q +VIAT  K+++S ++IPE I D YF++   ++    +IFA+ K EY +S++RK D K +D+ I+ AIK+  +   L  YL T FSL     PHKM F
Sbjct:   53 NGTKFALGHSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKINGFPLRRIGQAFVIATSLKVNVSGVKIPEHINDEYFKRKSTAQKTGKNIFASGKTEYTVSEQRKKDIKTVDAPILAAIKKHPEHKFLFGYLGTRFSLGKNQYPHKMQF 217          
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Match: RpL6 (gene:FBgn0039857 transcript:FBtr0085804)

HSP 1 Score: 181.8 bits (460), Expect = 4.105e-57
Identity = 93/190 (48.95%), Postives = 129/190 (67.89%), Query Frame = 3
Query:   72 MEAAPVKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQ--KAEKS-KTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            +E A V +++   SYP    +KK+ ++   FSEHKR  R  +TPGTVLILL GR++G RVV LK L+SGLLLV+GPF LN  P+RRV Q YVI T +K+D+ + ++PE + DAYF+  KA+K  KT   DIFAAKK+ +V +++RK DQK +D+A++K IK   +     KYL+  F+L     PH+M F
Sbjct:   55 VEKAKVPIKKSKASYPTKTFVKKRPSKAN-FSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 243          
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Match: RpL6 (gene:FBgn0039857 transcript:FBtr0085805)

HSP 1 Score: 177.948 bits (450), Expect = 1.816e-55
Identity = 90/177 (50.85%), Postives = 122/177 (68.93%), Query Frame = 3
Query:  111 SYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQ--KAEKS-KTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            SYP    +KK+ ++   FSEHKR  R  +TPGTVLILL GR++G RVV LK L+SGLLLV+GPF LN  P+RRV Q YVI T +K+D+ + ++PE + DAYF+  KA+K  KT   DIFAAKK+ +V +++RK DQK +D+A++K IK   +     KYL+  F+L     PH+M F
Sbjct:   87 SYPTKTFVKKRPSKAN-FSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 262          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 184.496 bits (467), Expect = 7.797e-58
Identity = 96/185 (51.89%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKT--KSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K +++  K FS+H+R+LR TITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ + IAT TK+DIS ++IP  + D+YF+K +  K   +  +IF  +K++Y L+++RKADQK +DS ++  IK+      L  YLR+ FSLS+G  PHK+ F
Sbjct:   84 VKLRKMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKKKKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 184.496 bits (467), Expect = 7.797e-58
Identity = 96/185 (51.89%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKT--KSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K +++  K FS+H+R+LR TITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ + IAT TK+DIS ++IP  + D+YF+K +  K   +  +IF  +K++Y L+++RKADQK +DS ++  IK+      L  YLR+ FSLS+G  PHK+ F
Sbjct:   84 VKLRKMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKKKKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Match: rpl6 (ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030131-8671])

HSP 1 Score: 184.496 bits (467), Expect = 7.797e-58
Identity = 96/185 (51.89%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKT--KSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K +++  K FS+H+R+LR TITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ + IAT TK+DIS ++IP  + D+YF+K +  K   +  +IF  +K++Y L+++RKADQK +DS ++  IK+      L  YLR+ FSLS+G  PHK+ F
Sbjct:   84 VKLRKMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIPRTLTDSYFKKKKLRKPKHQEGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGYLRSMFSLSNGVYPHKLVF 265          
BLAST of 60S ribosomal protein L6 vs. Ensembl Xenopus
Match: mrrf (mitochondrial ribosome recycling factor [Source:Xenbase;Acc:XB-GENE-1008997])

HSP 1 Score: 143.28 bits (360), Expect = 9.827e-42
Identity = 68/111 (61.26%), Postives = 89/111 (80.18%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYF 416
            VK+++ PR YP   V +K  ++  K FS+HKR+LRS+ITPGTVLILL GR+RG RVVFLKQL +GLLLV+GP  +N+VP+RR HQ + IAT TKIDISS++IP+ + D+YF
Sbjct:   78 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHKRKLRSSITPGTVLILLNGRHRGKRVVFLKQLQTGLLLVTGPLAINRVPLRRAHQKFAIATSTKIDISSVKIPKHLTDSYF 188          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Rpl6 (ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:108057])

HSP 1 Score: 186.037 bits (471), Expect = 4.491e-58
Identity = 97/185 (52.43%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H RRLRS+ITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ +VIAT TK+DIS ++IP+ + DAYF+K +  K + +  +IF  +K++Y ++++RKADQK +D  I+  IK       L  YLR+ FSL++G  PHK+ F
Sbjct:  115 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 296          
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Match: Rpl6 (ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:108057])

HSP 1 Score: 75.8702 bits (185), Expect = 7.567e-18
Identity = 36/44 (81.82%), Postives = 41/44 (93.18%), Query Frame = 3
Query:  162 FSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVS 293
            FS+H RRLRS+ITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+
Sbjct:    2 FSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVT 45          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|P21533|RL6_RAT (60S ribosomal protein L6 OS=Rattus norvegicus OX=10116 GN=Rpl6 PE=1 SV=5)

HSP 1 Score: 190.274 bits (482), Expect = 9.441e-59
Identity = 99/185 (53.51%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKA--EKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H RRLRS+ITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  LN+VP+RR HQ +VIAT TK+DIS ++IP+ + DAYF+K    K + +  +IF  +K++Y ++++RKADQK +DS I+  IK       L  YLR+ FSL++G  PHK+ F
Sbjct:  117 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLGSGLLLVTGPLALNRVPLRRTHQKFVIATSTKVDISKVKIPKHLTDAYFKKKPLRKPRHQEGEIFDTEKEKYEITEQRKADQKAVDSQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 298          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q2YGT9|RL6_PIG (60S ribosomal protein L6 OS=Sus scrofa OX=9823 GN=RPL6 PE=1 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 2.347e-58
Identity = 97/185 (52.43%), Postives = 137/185 (74.05%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG RV+FLKQLSSGLLLV+GP  LN+VP+RR HQ +VIAT TKIDIS ++IPE + DAYF+K +  K + +  +IF  +K++Y +S++RK DQK +DS I++ IK       L  YLR+ F+L++G  PHK+ F
Sbjct:  103 VKLRKMPRYYPTEDVPRKLLSHGKKPFSKHVRKLRASITPGTILIILTGRHRGKRVIFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISGVKIPEHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEISEQRKVDQKAVDSQILRRIKAVPQ---LQGYLRSVFALTNGIYPHKLVF 284          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q6QMZ4|RL6_CHILA (60S ribosomal protein L6 OS=Chinchilla lanigera OX=34839 GN=RPL6 PE=2 SV=3)

HSP 1 Score: 186.808 bits (473), Expect = 1.607e-57
Identity = 97/185 (52.43%), Postives = 136/185 (73.51%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGTVLI+LTGR+RG RVVFLKQL+SGLLLV+GP  LN+VP+RR HQ +VIAT TKIDIS+++IP+ + DAYF+K +  K + +  +IF  +K+ Y +S++RK DQK +DS I+  IK       L  YLR+ F+L++G  PHK+ F
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTVLIILTGRHRGKRVVFLKQLASGLLLVTGPLNLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKERYQISEQRKVDQKAVDSQILPKIKAVPQ---LRGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|P47911|RL6_MOUSE (60S ribosomal protein L6 OS=Mus musculus OX=10090 GN=Rpl6 PE=1 SV=3)

HSP 1 Score: 186.037 bits (471), Expect = 3.141e-57
Identity = 97/185 (52.43%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H RRLRS+ITPGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ +VIAT TK+DIS ++IP+ + DAYF+K +  K + +  +IF  +K++Y ++++RKADQK +D  I+  IK       L  YLR+ FSL++G  PHK+ F
Sbjct:  115 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLTNGMYPHKLVF 296          
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Match: sp|Q02878|RL6_HUMAN (60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 2.024e-56
Identity = 95/185 (51.35%), Postives = 137/185 (74.05%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKK-ANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K  ++  K FS+H R+LR++ITPGT+LI+LTGR+RG RVVFLKQL+SGLLLV+GP  LN+VP+RR HQ +VIAT TKIDIS+++IP+ + DAYF+K +  K + +  +IF  +K++Y ++++RK DQK +DS I+  IK       L  YLR+ F+L++G  PHK+ F
Sbjct:  107 VKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQ---LQGYLRSVFALTNGIYPHKLVF 288          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A0A0R251 (60S ribosomal protein OS=Phragmatopoma lapidosa OX=341668 PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 6.604e-62
Identity = 100/184 (54.35%), Postives = 134/184 (72.83%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQ--KAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            V+V R PR YP     +K A R + FS+HKR +R++ITPGTVLI++ GR +G RVVFLKQLSSGLLLV+GP+++N  P+RRV+QNYVIAT TKID SS+++P+R+ DAYF+  K  + K    +IF  KK+EY +S ERK DQ  +D A++ AI +  DK VL++YL + FSL +   PHKM F
Sbjct:   37 VRVNRMPRFYPTEDGPRKLATRKRPFSQHKRSIRASITPGTVLIMVAGRQKGKRVVFLKQLSSGLLLVTGPYQVNGCPLRRVNQNYVIATKTKIDTSSVQVPDRVNDAYFKRTKLRRPKHTEGEIFDKKKEEYTVSQERKDDQVAVDKALLAAIGKNADKKVLLQYLASRFSLRNHQYPHKMVF 220          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1I8HCC1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017071g1 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 5.877e-60
Identity = 100/185 (54.05%), Postives = 131/185 (70.81%), Query Frame = 3
Query:   96 QRKPRSYPLNAVMKKKANR-TKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQK-----AEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            +R PRS P +   +    R TK F +HKRRLR++ITPGTVLILL GR+RG RVVFL+QLSSGLLLV+GP K N  P+RRV Q+YVIAT T+IDIS + +PER+ DAYF++     A+++K  S D FA  +  Y L DER+ DQK +DS ++ AI+   D  +L  Y+R+ FSL +G KPH+M F
Sbjct:  190 RRSPRSLPTSVPHRYSPPRPTKCFKDHKRRLRASITPGTVLILLAGRHRGKRVVFLRQLSSGLLLVTGPLKFNGCPLRRVAQSYVIATKTRIDISGVSLPERVNDAYFRRAKQLQAKRAKPSSADPFAKPQSAYQLVDERREDQKAVDSQVMTAIRASPDAKMLASYMRSLFSLRNGQKPHEMVF 374          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1I8I3J0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017071g2 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.291e-59
Identity = 99/185 (53.51%), Postives = 131/185 (70.81%), Query Frame = 3
Query:   96 QRKPRSYPLNAVMKKKANR-TKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQK-----AEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            +R PRS P +   +    R TK F +HKRRLR++ITPGTVLILL GR+RG RVVFL+QLSSGLLLV+GP K N  P+RR+ Q+YVIAT T+IDIS + +PER+ DAYF++     A+++K  S D FA  +  Y L DER+ DQK +DS ++ AI+   D  +L  Y+R+ FSL +G KPH+M F
Sbjct:  190 RRSPRSLPTSVPHRYSPPRPTKCFKDHKRRLRASITPGTVLILLAGRHRGKRVVFLRQLSSGLLLVTGPLKFNGCPLRRIAQSYVIATKTQIDISGVSLPERVNDAYFRRAKQLQAKRAKPSSADPFAKPQSAYQLVDERREDQKAVDSQVMTAIRASPDAKMLASYMRSLFSLRNGQKPHEMVF 374          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A3Q1JH37 (Ribosomal protein L6 OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 9.334e-59
Identity = 102/185 (55.14%), Postives = 137/185 (74.05%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K FSEHKR+LRSTITPGTVLILLTGR+RG RVVFLKQLSSGLLLV+GP  LN+VP+RR HQ +VIAT TK+DIS ++IP+ + DAYF+K +  + + +  +IF  +K++Y L+++RK DQK +DS ++  IK+      L  YLR+ F LS G  PHK+ F
Sbjct:   77 VKLRKMPRYYPTEDVPRKLKSHGKKPFSEHKRKLRSTITPGTVLILLTGRHRGKRVVFLKQLSSGLLLVTGPLALNRVPLRRAHQKFVIATNTKVDISGVKIPKTLNDAYFKKKKLRRPRHQEGEIFDTEKEKYQLTEQRKEDQKAVDSQLLPLIKKVPQ---LKGYLRSSFCLSSGVFPHKLVF 258          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A3S1BKF4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006356 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.594e-59
Identity = 93/184 (50.54%), Postives = 133/184 (72.28%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYF--QKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            V+V+R PR YP     +K  N    F++HKR+LR +ITPGT+LIL+ GR++G RVVFLKQL++GLLLV+GP+ LN  P+RR++Q YVIAT TK+DI  +++P+R+ D YF  QK++K K    DIF+ +K+ Y +SDERK DQ  +D  I+  I+++++K +L  YL + FSLS+   PHKM F
Sbjct:   25 VRVKRMPRWYPTEDKPRKLKNHKIAFNQHKRKLRESITPGTILILVAGRHKGKRVVFLKQLNTGLLLVTGPYHLNGCPLRRINQRYVIATKTKLDIKGVKVPDRVNDEYFKRQKSKKPKHTEGDIFSTEKEVYTVSDERKEDQANVDRQILDVIRKQKEKKLLFGYLGSMFSLSNNQFPHKMVF 208          
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Match: rpl6 (ribosomal protein L6 [Source:NCBI gene;Acc:103032571])

HSP 1 Score: 176.022 bits (445), Expect = 1.386e-54
Identity = 91/185 (49.19%), Postives = 132/185 (71.35%), Query Frame = 3
Query:   87 VKVQRKPRSYPL-NAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKT--KSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            V++++ PR YP  N   K +++  K FS+H+R+LRS+I+PGTVLI+LTGR+RG RVVFLKQL SGLLLV+GP  +N+VP+RR HQ + IAT TK+DIS ++IP+ + DAYF+K +  K   +  +IF  +K++Y L+++RK DQK +D  ++  I+       L  YLR+ F LS+G  PHK+ F
Sbjct:   79 VRLRKMPRYYPTENPPRKLRSHGIKPFSQHRRKLRSSISPGTVLIMLTGRHRGKRVVFLKQLGSGLLLVTGPLAINRVPLRRAHQKFCIATSTKLDISGVKIPKNLNDAYFKKKKLRKPKHQEGEIFDTEKEKYQLTEQRKEDQKAVDKQLLPLIRNFPH---LKGYLRSQFFLSNGVYPHKLIF 260          
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Match: RPL6A (Ribosomal 60S subunit protein L6A; N-terminally acetylated; binds 5.8S rRNA; homologous to mammalian ribosomal protein L6, no bacterial homolog; RPL6A has a paralog, RPL6B, that arose from the whole genome duplication [Source:SGD;Acc:S000004538])

HSP 1 Score: 130.568 bits (327), Expect = 8.211e-39
Identity = 75/181 (41.44%), Postives = 111/181 (61.33%), Query Frame = 3
Query:   96 QRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSD--DIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            Q+ P+ YP   V   K  R    +   ++LR+++ PGTVLILL GR+RG RVV+LK L    LL+SGPFK+N VP+RRV+  YVIAT TK+ +  + + E+    YF K + +K +    ++F  ++Q   +  ER  DQK++D A++  IK+     +L +YL   FSL +GDKPH + F
Sbjct:    4 QKAPKWYPSEDVAALKKTRK---AARPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNV-EKFNVEYFAKEKLTKKEKKEANLF-PEQQNKEIKAERVEDQKVVDKALIAEIKKTP---LLKQYLSASFSLKNGDKPHMLKF 176          
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Match: RPL6B (Ribosomal 60S subunit protein L6B; binds 5.8S rRNA; homologous to mammalian ribosomal protein L6, no bacterial homolog; RPL6B has a paralog, RPL6A, that arose from the whole genome duplication [Source:SGD;Acc:S000004440])

HSP 1 Score: 128.257 bits (321), Expect = 6.256e-38
Identity = 75/181 (41.44%), Postives = 111/181 (61.33%), Query Frame = 3
Query:   96 QRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSD--DIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            Q+ P+ YP   V   K  R  +     ++LR+++ PGTVLILL GR+RG RVV+LK L    LLV+GPFK+N VP+RRV+  YVIAT TK+ +  + + E+    YF K + +K +    ++F  ++Q   +  ER  DQK++D A++  IK+     +L +YL   FSL +GDKPH + F
Sbjct:    4 QQAPKWYPSEDVAAPKKTRKAV---RPQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDNTLLVTGPFKVNGVPLRRVNARYVIATSTKVSVEGVNV-EKFNVEYFAKEKLTKKEKKEANLF-PEQQTKEIKTERVEDQKVVDKALLAEIKKTP---LLKQYLSASFSLKNGDKPHLLKF 176          
BLAST of 60S ribosomal protein L6 vs. Ensembl Nematostella
Match: EDO41373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S4])

HSP 1 Score: 164.466 bits (415), Expect = 7.809e-51
Identity = 91/184 (49.46%), Postives = 122/184 (66.30%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPER--IEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            V VQR+ R YP   V ++ ANR K       +LRS+ITPGTVLILL G +RG RVVFLKQL+SGLLLV+GPFK+N VP+RR+ Q+YVIAT T ID+S +++PE    +++YF+   K K +S+D+F    +E   S++R ADQK +D  I+  I    +   + KYL + FSL  G  PH M F
Sbjct:   67 VPVQRESRYYPTEDVRRRLANRKK---PGMAKLRSSITPGTVLILLAGAHRGKRVVFLKQLNSGLLLVTGPFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESYFKGEPKKKKRSEDMFEEAAEEKKPSEQRIADQKAVDDQILPKISAVPN---MKKYLSSLFSLRKGQFPHDMVF 244          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: rpl6 (ribosomal protein L6 [Source:NCBI gene;Acc:101172170])

HSP 1 Score: 184.496 bits (467), Expect = 6.055e-58
Identity = 96/185 (51.89%), Postives = 136/185 (73.51%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K F +HKR+LR++ITPGTVLILLTGR+RG RVVFLKQLSSGLLLV+GP  LN+VP+RR HQ +VIAT TK+DI+ ++IP+ + DAYF+K +  + + +  +IF  +K++Y L++ERK  QK +DS ++  IK+      L  YLR+ F L++G  PHK+ F
Sbjct:   79 VKLRKMPRYYPTEDVPRKLKSHGKKPFCQHKRKLRASITPGTVLILLTGRHRGKRVVFLKQLSSGLLLVTGPLALNRVPLRRAHQKFVIATNTKVDITGMKIPKTLNDAYFKKKKLRRPRHQEGEIFDTEKEKYQLTEERKEIQKEVDSKLLPLIKKVPQ---LKGYLRSSFYLTNGVYPHKLVF 260          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000027450.1 (pep primary_assembly:ASM223467v1:10:1314901:1318310:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000027450.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 8.779e-17
Identity = 59/185 (31.89%), Postives = 95/185 (51.35%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K   +HKR+LR                   RVVFLKQLSS             VP+              +DI+ ++IP+ + DAYF+K +    + +  +IF  +K++Y L+++RK  QK ++S ++  IK+      L +YLR+ F L++G  PHK+ F
Sbjct:   76 VKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSS-------------VPL--------------LDITGMKIPKTLNDAYFKKKKLRGPRQQEGEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 211          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000027419.1 (pep primary_assembly:ASM223467v1:10:1314901:1317268:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000027419.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.310e-16
Identity = 59/185 (31.89%), Postives = 95/185 (51.35%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K   +HKR+LR                   RVVFLKQLSS             VP+              +DI+ ++IP+ + DAYF+K +    + +  +IF  +K++Y L+++RK  QK ++S ++  IK+      L +YLR+ F L++G  PHK+ F
Sbjct:   81 VKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSS-------------VPL--------------LDITGMKIPKTLNDAYFKKKKLRGPRQQEGEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 216          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000045286.1 (pep primary_assembly:ASM223467v1:10:1314901:1319647:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000045286.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.470e-16
Identity = 59/185 (31.89%), Postives = 95/185 (51.35%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K   +HKR+LR                   RVVFLKQLSS             VP+              +DI+ ++IP+ + DAYF+K +    + +  +IF  +K++Y L+++RK  QK ++S ++  IK+      L +YLR+ F L++G  PHK+ F
Sbjct:   87 VKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSS-------------VPL--------------LDITGMKIPKTLNDAYFKKKKLRGPRQQEGEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 222          
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Match: ENSORLT00000039896.1 (pep primary_assembly:ASM223467v1:10:1314901:1318545:-1 gene:ENSORLG00000020235.2 transcript:ENSORLT00000039896.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.496e-16
Identity = 59/185 (31.89%), Postives = 95/185 (51.35%), Query Frame = 3
Query:   87 VKVQRKPRSYPLNAVMKK-KANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAE--KSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            VK+++ PR YP   V +K K++  K   +HKR+LR                   RVVFLKQLSS             VP+              +DI+ ++IP+ + DAYF+K +    + +  +IF  +K++Y L+++RK  QK ++S ++  IK+      L +YLR+ F L++G  PHK+ F
Sbjct:   89 VKLRKMPRYYPTEDVPRKLKSHGKKPVCQHKRKLR-------------------RVVFLKQLSS-------------VPL--------------LDITGMKIPKTLNDAYFKKKKLRGPRQQEGEIFHTEKKKYQLTEQRKEIQKEVNSKLLPLIKKVPQ---LKEYLRSSFYLTNGVYPHKLVF 224          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000076172.1 (SMESG000076172.1)

HSP 1 Score: 378.637 bits (971), Expect = 1.064e-135
Identity = 186/187 (99.47%), Postives = 187/187 (100.00%), Query Frame = 3
Query:   72 MEAAPVKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            MEAAPVKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLV+GPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF
Sbjct:    1 MEAAPVKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVNGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 187          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000019835.1 (SMESG000019835.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.235e-65
Identity = 103/179 (57.54%), Postives = 130/179 (72.63%), Query Frame = 3
Query:  108 RSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLILLTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKIDISSIEIPERIEDAYF----QKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLIDSAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF 632
            +SYP+ +  K   NR K FS HK+RLR  I PG VLILL+G +RG RV+FLKQLSSGLLLV+GP+KLN  P+RRVHQ  VIAT TK+DI  +EIP+ ++D YF    Q+ EK  +  ++IFA  K+ YV+ ++RK DQK IDS I+KAIK+R+DK    KYL+T FSLS  D PHKM F
Sbjct:  113 KSYPVQSQKKVSKNRKKPFSAHKKRLREKIKPGVVLILLSGIHRGKRVIFLKQLSSGLLLVTGPYKLNGCPIRRVHQKMVIATSTKLDIGELEIPDHLKDDYFAREPQQDEKLSSDVNNIFAKSKKNYVVKEKRKEDQKKIDSQILKAIKKRDDKATFSKYLKTSFSLSSHDYPHKMEF 291          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL64.215e-5751.35ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL64.215e-5751.35ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL66.165e-1862.90ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL61.219e-952.83ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL61.253e-952.83ribosomal protein L6 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl-61.510e-4849.0960S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-61.510e-4849.0960S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-61.510e-4849.0960S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
rpl-61.510e-4849.0960S ribosomal protein L6 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RpL64.105e-5748.95gene:FBgn0039857 transcript:FBtr0085804[more]
RpL61.816e-5550.85gene:FBgn0039857 transcript:FBtr0085805[more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl67.797e-5851.89ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl67.797e-5851.89ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl67.797e-5851.89ribosomal protein L6 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrrf9.827e-4261.26mitochondrial ribosome recycling factor [Source:Xe... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpl64.491e-5852.43ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:10... [more]
Rpl67.567e-1881.82ribosomal protein L6 [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21533|RL6_RAT9.441e-5953.5160S ribosomal protein L6 OS=Rattus norvegicus OX=1... [more]
sp|Q2YGT9|RL6_PIG2.347e-5852.4360S ribosomal protein L6 OS=Sus scrofa OX=9823 GN=... [more]
sp|Q6QMZ4|RL6_CHILA1.607e-5752.4360S ribosomal protein L6 OS=Chinchilla lanigera OX... [more]
sp|P47911|RL6_MOUSE3.141e-5752.4360S ribosomal protein L6 OS=Mus musculus OX=10090 ... [more]
sp|Q02878|RL6_HUMAN2.024e-5651.3560S ribosomal protein L6 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A0R2516.604e-6254.3560S ribosomal protein OS=Phragmatopoma lapidosa OX... [more]
A0A1I8HCC15.877e-6054.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I3J01.291e-5953.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3Q1JH379.334e-5955.14Ribosomal protein L6 OS=Anabas testudineus OX=6414... [more]
A0A3S1BKF49.594e-5950.54Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl61.386e-5449.19ribosomal protein L6 [Source:NCBI gene;Acc:1030325... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL6A8.211e-3941.44Ribosomal 60S subunit protein L6A; N-terminally ac... [more]
RPL6B6.256e-3841.44Ribosomal 60S subunit protein L6B; binds 5.8S rRNA... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413737.809e-5149.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpl66.055e-5851.89ribosomal protein L6 [Source:NCBI gene;Acc:1011721... [more]
ENSORLT00000027450.18.779e-1731.89pep primary_assembly:ASM223467v1:10:1314901:131831... [more]
ENSORLT00000027419.11.310e-1631.89pep primary_assembly:ASM223467v1:10:1314901:131726... [more]
ENSORLT00000045286.11.470e-1631.89pep primary_assembly:ASM223467v1:10:1314901:131964... [more]
ENSORLT00000039896.11.496e-1631.89pep primary_assembly:ASM223467v1:10:1314901:131854... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000076172.11.064e-13599.47SMESG000076172.1[more]
SMESG000019835.11.235e-6557.54SMESG000019835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002455 ID=SMED30002455|Name=60S ribosomal protein L6|organism=Schmidtea mediterranea sexual|type=transcript|length=658bp
ATTTTATTGAAGAAATTTAAAAAGTACGTATTAAATTAACTAAAAAATAA
TTTTAAGTTTTGTAAATTAGAATGGAAGCTGCTCCAGTTAAAGTTCAACG
TAAACCTAGAAGTTATCCTTTGAATGCTGTCATGAAAAAGAAAGCAAACA
GAACTAAGCTCTTTTCTGAACATAAAAGACGTTTGAGATCTACTATCACC
CCTGGAACTGTCTTGATTCTTTTGACTGGACGTTATCGAGGAACCCGTGT
TGTTTTTTTGAAGCAATTAAGCAGTGGATTATTGCTCGTTAGCGGACCTT
TTAAACTCAACAAAGTTCCAATGAGAAGAGTTCACCAAAACTATGTCATT
GCTACTGGAACTAAAATCGATATTAGTAGCATTGAAATTCCAGAACGCAT
TGAAGATGCTTATTTCCAAAAAGCCGAGAAAAGCAAAACTAAGTCCGATG
ATATTTTCGCAGCCAAAAAACAAGAATATGTTTTGTCAGATGAACGCAAA
GCTGACCAAAAACTAATTGACAGTGCAATTGTCAAGGCAATTAAAGAAAG
AGAAGACAAGGGAGTCTTAGTTAAATATTTGAGAACTCCATTTTCACTGT
CACACGGAGACAAACCACACAAAATGACTTTTTAAGCTTTTGAAATAAAT
TTGGATTT
back to top

protein sequence of SMED30002455-orf-1

>SMED30002455-orf-1 ID=SMED30002455-orf-1|Name=SMED30002455-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MEAAPVKVQRKPRSYPLNAVMKKKANRTKLFSEHKRRLRSTITPGTVLIL
LTGRYRGTRVVFLKQLSSGLLLVSGPFKLNKVPMRRVHQNYVIATGTKID
ISSIEIPERIEDAYFQKAEKSKTKSDDIFAAKKQEYVLSDERKADQKLID
SAIVKAIKEREDKGVLVKYLRTPFSLSHGDKPHKMTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0002181cytoplasmic translation
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005791rough endoplasmic reticulum
GO:0005829cytosol
GO:0022625cytosolic large ribosomal subunit
GO:0042788polysomal ribosome
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041997KOW_RPL6
IPR014722Rib_L2_dom2
IPR00091560S_ribosomal_L6E
IPR008991Translation_prot_SH3-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014722Ribosomal protein L2, domain 2GENE3DG3DSA:2.30.30.30coord: 40..125
e-value: 6.6E-11
score: 44.1
IPR00091560S ribosomal protein L6EPFAMPF01159Ribosomal_L6ecoord: 79..187
e-value: 5.0E-36
score: 123.6
IPR00091560S ribosomal protein L6EPANTHERPTHR1071560S RIBOSOMAL PROTEIN L6coord: 7..187
NoneNo IPR availablePANTHERPTHR10715:SF060S RIBOSOMAL PROTEIN L6coord: 7..187
IPR041997Ribosomal Protein L6, KOW domainCDDcd13156KOW_RPL6coord: 34..187
e-value: 9.42315E-76
score: 222.038
IPR008991Translation protein SH3-like domain superfamilySUPERFAMILYSSF50104Translation proteins SH3-like domaincoord: 40..132