Staphylococcal nuclease domain-containing protein

Overview
NameStaphylococcal nuclease domain-containing protein
Smed IDSMED30002454
Length (bp)2991
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Staphylococcal nuclease domain-containing protein (SMED30002454) t-SNE clustered cells

Violin plots show distribution of expression levels for Staphylococcal nuclease domain-containing protein (SMED30002454) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Staphylococcal nuclease domain-containing protein (SMED30002454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Staphylococcal nuclease domain-containing protein (SMED30002454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002454SMESG000062403.1 dd_Smed_v4_906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002454SMESG000062403.1 Contig48977newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002454SMESG000062403.1 Contig48977uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30002454SMESG000062403.1 dd_Smed_v6_906_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002454SMESG000062403.1 dd_Smed_v6_906_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30002454SMESG000062403.1 dd_Smed_v6_906_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30002454SMESG000062403.1 dd_Smed_v6_906_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Match: SND1 (staphylococcal nuclease and tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30646])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 424/927 (45.74%), Postives = 599/927 (64.62%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            I+K VLSG ++I+R + + GPPPE+ I LS I A  LARR  A    +++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKAA+KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY  P              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++++       +NLS+ LVE+ L+KVHF+AER S++K L  AE  AK+ K  +W       Y EQ  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  IH+ Y+D+GN E+   + L +L        +P QATEY+ A +    DD+ R  +  ++  DI + +  LNVE+ S    P    V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVAP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHID------GANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWA-----HYEEQPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSA-GCPH---VTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Match: SND1 (staphylococcal nuclease and tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30646])

HSP 1 Score: 171.4 bits (433), Expect = 1.117e-47
Identity = 83/144 (57.64%), Postives = 106/144 (73.61%), Query Frame = 3
Query: 1416 EALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREV 1847
            EALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREV
Sbjct:    1 EALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREV 143          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Match: STK31 (serine/threonine kinase 31 [Source:HGNC Symbol;Acc:HGNC:11407])

HSP 1 Score: 56.9954 bits (136), Expect = 9.870e-9
Identity = 43/145 (29.66%), Postives = 67/145 (46.21%), Query Frame = 3
Query: 2172 TQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCA--LENDISDKEVKLNVE 2600
            + + D   F+AQ +     I+ I   L     + S V G   P K  +    F+ D CWYR KV+KI + +   + Y+D+GN EI   S +  +P  LQ     A +Y L  L    D E     +    L + I +KE+K+ ++
Sbjct:   16 SHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNK--IYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQ-FSSVAKKYKLWGLHIPSDQEVTQFDQGTTFLGSLIFEKEIKMRIK 157          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Match: TDRD1 (tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:11712])

HSP 1 Score: 58.5362 bits (140), Expect = 6.936e-8
Identity = 40/128 (31.25%), Postives = 61/128 (47.66%), Query Frame = 3
Query: 2127 ENQVDRVVNYKSALVTQVLDGTRFYA---QLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSL 2501
            E  VD+ +    A V +++    FYA    + EN+  +  +T EL  Y       P  Y+P+ GD C AK+T D  WYRA V+   +   + +LY D+GN E      +  + S    +P+Q    SL
Sbjct:  935 ELPVDKTIQ---ANVLEIISPNLFYALPKGMPENQEKLCMLTAELLEYCNAPKSRP-PYRPRIGDACCAKYTSDDFWYRAVVLGTSD-TDVEVLYADYGNIETLPLCRVQPITSSHLALPFQIIRCSL 1057          

HSP 2 Score: 52.7582 bits (125), Expect = 3.616e-6
Identity = 32/114 (28.07%), Postives = 55/114 (48.25%), Query Frame = 3
Query: 2163 ALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
             +V  +     F+ Q +++   +  +   L  Y  +       Y P  GD+C A+F+ D  WYRA V+   + +++ + YVD+GN EI     L  +   L ++P QA +  LA
Sbjct:  498 GVVAHIQTPEDFFCQQLQSGRKLAELQASLSKYCDQLPPRSDFY-PAIGDICCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLMRLCPIIPKLLELPMQAIKCVLA 610          

HSP 3 Score: 52.373 bits (124), Expect = 4.907e-6
Identity = 33/89 (37.08%), Postives = 50/89 (56.18%), Query Frame = 3
Query: 2169 VTQVLDGTRFYAQLMENENVIINITKELQNYFME-HSHV-PGAYKPKKGDLCAAKFTLDGCWYRAKVIKID-NPKAIHLLYVDFGNEEI 2426
            VT+      FY QL  +E  ++    +L     E +++V    Y P KG++C AK+T+D  W RA +  +D   K  H+LY+D+GNEEI
Sbjct:  270 VTEFKHPGDFYVQLYSSE--VLEYMNQLSASLKETYANVHEKDYIPVKGEVCIAKYTVDQTWNRAIIQNVDVQQKKAHVLYIDYGNEEI 356          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Match: STK31 (serine/threonine kinase 31 [Source:HGNC Symbol;Acc:HGNC:11407])

HSP 1 Score: 58.5362 bits (140), Expect = 7.133e-8
Identity = 46/175 (26.29%), Postives = 80/175 (45.71%), Query Frame = 3
Query: 2091 SSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCA--LENDISDKEVKLNVEYES 2609
            +++  S +G+ + ++       +  + + + D   F+AQ +     I+ I   L     + S V G   P K  +    F+ D CWYR KV+KI + +   + Y+D+GN EI   S +  +P  LQ     A +Y L  L    D E     +    L + I +KE+K+ ++  S
Sbjct:   12 ATESVSFSGIVQMDEDTHYDKVEDVVGSHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNK--IYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQ-FSSVAKKYKLWGLHIPSDQEVTQFDQGTTFLGSLIFEKEIKMRIKATS 183          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Celegans
Match: tsn-1 (Staphylococcal nuclease domain-containing protein [Source:UniProtKB/TrEMBL;Acc:Q19328])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 390/928 (42.03%), Postives = 582/928 (62.72%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSS-NEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPID---SNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKK---EPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNS-KEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINS--NLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGT-RFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDI-SDKEVKLNVEYE-STENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDD 2828
            +VK VLSGD++IL+ +   GPPPE  + LS + APRL RRP   +DS+    DEPYAW++RE++RQ  +GQ V +  +  A SGR++  +++  +S  + +N+AE  V AGL EVR+    G  ++E   KL+ L+E AK+A +GKW+ N     IR+I+W I+NP + V+ +  K + A+IE +RDG T+RAF+LP      F ++T+ LSGV+ P  +  +  +   E F++EAKFF ES+LLQR V I LE+T+NQN VGSI+HPKGNIAE +L+EG+ + VDWS+G L +  A   R AE+QAKEKRLRLWK Y+P             +++     ++  GKV+E+   D + V+  +G   K  LSSIR P+ +  D     P ++ +PLYDIP +F+AREFLRK+L+GKKV I++DY+QPK+++  E+  AT+ +G+ N+AE L+ +GL+ V+R+RA DENRS  YD LLAAE+ A+K   G+ + K   +  +H+I +++G+  KA+QFL  L+R G+  G+VEF++ GSRLR+YIPKET ++T L  GI+CP+ AR  P      AA+ F +EA  FT++L +Q EV++E+++ DK GNF+G++Y+ SP+   +   NLS ALVENGLA +HF+AER   +  L  AE KAK+ K NIW    E  + E+   + +    +K+       N++   VT +  G  RF AQ +E+   I  +T E++    EH  + G+Y  K+GDLC AKF+ DG WYR KV  +   +A  ++Y+D+GN E  E   LA +P+G    P    EY+LA LA  P+++Y  ++  A    +     V +N EY+  T  +   V+V     +K  + G+ L+ +G+   D + +E RL  L+  Y + +E AR  R NIW+YGDF  +D
Sbjct:   27 LVKSVLSGDAVILQGQPHNGPPPEWTVYLSNVTAPRLGRRP---TDSASATPDEPYAWDSREYLRQKLVGQFVTFVRDFTATSGRDHGRIYLGGTSPADAENVAEGAVSAGLLEVRQ----GKVADEYSTKLLELQEQAKSAGRGKWNSNAGT--IRDIRWVIDNPRELVDKYAQKPIDAVIEMVRDGSTVRAFLLP-----NFEYITLQLSGVRAPSTRNPNAADSRAEAFSEEAKFFAESRLLQRDVQIILESTSNQNFVGSIVHPKGNIAESLLREGYAKCVDWSIG-LCTGGAQKLRDAERQAKEKRLRLWKSYQPT------------SSAYSGDRKAFTGKVVEIVLSDAVVVQKDDGSEVKLHLSSIRLPRESGDDKATGGPGRQFRPLYDIPFMFQAREFLRKRLLGKKVQIQIDYVQPKSENFPEKTCATIKIGDQNIAEGLISRGLSKVVRHRADDENRSSEYDTLLAAEANAEKGKKGLFADKTAEKKDTHRIQEITGDLAKAKQFLPYLQRGGRAEGVVEFLSGGSRLRIYIPKETVLITFLLGGINCPKGARVGPGGVSTGAAEPFADEAAAFTRKLVLQHEVQLEVESTDKNGNFVGYLYV-SPDGNTSRAINLSEALVENGLASLHFTAERSGHYNALLSAENKAKKAKKNIWANFTEEQHQEEVEVQQADTSERKQ-------NFRQVAVTDIAPGALRFSAQNIEDGPKIEKMTTEMRQALAEHPPLAGSYTTKRGDLCVAKFSQDGQWYRCKVESVRAGQA-EIVYIDYGNRETIEAVKLAQIPAGFANFPAGVREYNLA-LAKLPNEDYVQLTSDAFAQYLFGHSSVFINSEYKVGTSEY---VTVYYDSGNKKVDIGKSLIAEGLALADHR-REPRLQTLVNDYNTTEEVARKSRKNIWEYGDFTGND 913          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Fly
Match: Tudor-SN (gene:FBgn0035121 transcript:FBtr0332107)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 408/946 (43.13%), Postives = 596/946 (63.00%), Query Frame = 3
Query:   78 SLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLA----IRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPE-----PFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINP----------IDSNP-AKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKAR-QFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNS-KEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGG-NFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQV--DRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLE--NEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDGP 2834
            S IVKQVLSGD++++R  +K  PPPEK I  S ++AP+LARRP A  D ++   DEP+AWE+REF+R+  IG EV +  +  A S REY  V+I       +N+ E IV  GL  VR++   G  + EQ Q LI LE+ A+AA +GKWS   P  +    +RNI+W+ ENP   V+ +    V AIIEH+RDG T+RAF+LP      F ++T+M+SG++ PG KL  + +  P+     PFADEA+++VE++LLQR V+IRLE+ NN N +G+I++PKGNIAE +L+EG  + VDWSM V+ +      RAAE+ AKEKRLR W+DY+             +  +     +   G V+EV NGD I+V+  NGQV+K F SSIR P+             + + P  K  +PLY+IPH+F+AREFLRKKLI KKV   +DYI P  ++  E+   TV++G  NVAEA+V KGLAT +RYR  D+ RS  YD L+AAE  A K   G+H+KK+  + ++ DL+ + ++ + Q+L S +R  +   IVEF+ASGSRLR+++PK++C++T L AGI CPR++R   N    +  + FG+EAL FT+E  +QR+V + ID  DK G + IGW++ +S      +NLS+ALVE GLA+VHFSAE+  +++QL  AE +AK  K NIWT     +Y+E+  +E +V   +KE++V  +R VNY++ +VT++ +   F+AQ +E+ + + ++  +L   F  +  + G+Y PK+GDL AA+FTLD  WYRAKV ++    A  +LY+D+GN+E    + LA+LP         ATEY+LA +A   D+E +  +  A   D+ + +V+LNVE + T     G   L  + D     + G+ L+ +G L + E+  E++L +L+ QY +AQE AR+  L IWKYGD   DD P
Sbjct:   26 SGIVKQVLSGDTVVIR-ATKGAPPPEKQITFSHVLAPKLARRPGAGGDETK---DEPWAWESREFLRKKLIGVEVTFTFDKPANSNREYGFVWIGKDKETGENVVESIVREGLVSVRRE---GRPTAEQ-QTLIELEDQARAAGRGKWS---PTASAADKVRNIKWSHENPAHLVDIYGGNPVKAIIEHVRDGSTVRAFLLP-----DFHYITLMISGIRCPGVKL--DADGKPDLSVKVPFADEARYYVETRLLQRDVEIRLESVNNSNFIGTILYPKGNIAESLLREGLAKCVDWSMAVMKTGTD-KLRAAERFAKEKRLRQWQDYQ------------AKTPAFNSKEKDFSGTVVEVFNGDAINVRLSNGQVKKVFFSSIRPPRDQRAVVGTDGEEIVKAPPRGKNYRPLYEIPHMFDAREFLRKKLINKKVQCNLDYISPPRENFPEKYCYTVSIGGQNVAEAMVAKGLATCVRYRQDDDQRSSAYDQLIAAEQQAIKGLKGLHAKKDNATLRVNDLTVDHSRIKVQYLPSWQRALRTEAIVEFVASGSRLRIFVPKDSCLVTFLLAGISCPRSSRPALNGVPAQEGEPFGDEALTFTRERVLQRDVSVHIDTTDKAGSSVIGWLWTDS-----GANLSVALVEEGLAEVHFSAEKSEYYRQLKIAEDRAKAAKKNIWT-----NYVEEVPKEKTVTEEEKEDKVVAERKVNYENVIVTEITETLTFFAQSVESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNAT-VLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALRAFSEDVLNHKVQLNVELKVT-----GSPNLATLRDPTTKVDFGKQLVAEG-LVLAEQRGERKLKELVDQYKAAQEAARVAHLAIWKYGDITQDDAP 923          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Fly
Match: Tudor-SN (gene:FBgn0035121 transcript:FBtr0072519)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 408/946 (43.13%), Postives = 596/946 (63.00%), Query Frame = 3
Query:   78 SLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLA----IRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPE-----PFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINP----------IDSNP-AKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKAR-QFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNS-KEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGG-NFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQV--DRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLE--NEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDGP 2834
            S IVKQVLSGD++++R  +K  PPPEK I  S ++AP+LARRP A  D ++   DEP+AWE+REF+R+  IG EV +  +  A S REY  V+I       +N+ E IV  GL  VR++   G  + EQ Q LI LE+ A+AA +GKWS   P  +    +RNI+W+ ENP   V+ +    V AIIEH+RDG T+RAF+LP      F ++T+M+SG++ PG KL  + +  P+     PFADEA+++VE++LLQR V+IRLE+ NN N +G+I++PKGNIAE +L+EG  + VDWSM V+ +      RAAE+ AKEKRLR W+DY+             +  +     +   G V+EV NGD I+V+  NGQV+K F SSIR P+             + + P  K  +PLY+IPH+F+AREFLRKKLI KKV   +DYI P  ++  E+   TV++G  NVAEA+V KGLAT +RYR  D+ RS  YD L+AAE  A K   G+H+KK+  + ++ DL+ + ++ + Q+L S +R  +   IVEF+ASGSRLR+++PK++C++T L AGI CPR++R   N    +  + FG+EAL FT+E  +QR+V + ID  DK G + IGW++ +S      +NLS+ALVE GLA+VHFSAE+  +++QL  AE +AK  K NIWT     +Y+E+  +E +V   +KE++V  +R VNY++ +VT++ +   F+AQ +E+ + + ++  +L   F  +  + G+Y PK+GDL AA+FTLD  WYRAKV ++    A  +LY+D+GN+E    + LA+LP         ATEY+LA +A   D+E +  +  A   D+ + +V+LNVE + T     G   L  + D     + G+ L+ +G L + E+  E++L +L+ QY +AQE AR+  L IWKYGD   DD P
Sbjct:   26 SGIVKQVLSGDTVVIR-ATKGAPPPEKQITFSHVLAPKLARRPGAGGDETK---DEPWAWESREFLRKKLIGVEVTFTFDKPANSNREYGFVWIGKDKETGENVVESIVREGLVSVRRE---GRPTAEQ-QTLIELEDQARAAGRGKWS---PTASAADKVRNIKWSHENPAHLVDIYGGNPVKAIIEHVRDGSTVRAFLLP-----DFHYITLMISGIRCPGVKL--DADGKPDLSVKVPFADEARYYVETRLLQRDVEIRLESVNNSNFIGTILYPKGNIAESLLREGLAKCVDWSMAVMKTGTD-KLRAAERFAKEKRLRQWQDYQ------------AKTPAFNSKEKDFSGTVVEVFNGDAINVRLSNGQVKKVFFSSIRPPRDQRAVVGTDGEEIVKAPPRGKNYRPLYEIPHMFDAREFLRKKLINKKVQCNLDYISPPRENFPEKYCYTVSIGGQNVAEAMVAKGLATCVRYRQDDDQRSSAYDQLIAAEQQAIKGLKGLHAKKDNATLRVNDLTVDHSRIKVQYLPSWQRALRTEAIVEFVASGSRLRIFVPKDSCLVTFLLAGISCPRSSRPALNGVPAQEGEPFGDEALTFTRERVLQRDVSVHIDTTDKAGSSVIGWLWTDS-----GANLSVALVEEGLAEVHFSAEKSEYYRQLKIAEDRAKAAKKNIWT-----NYVEEVPKEKTVTEEEKEDKVVAERKVNYENVIVTEITETLTFFAQSVESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNAT-VLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALRAFSEDVLNHKVQLNVELKVT-----GSPNLATLRDPTTKVDFGKQLVAEG-LVLAEQRGERKLKELVDQYKAAQEAARVAHLAIWKYGDITQDDAP 923          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:324404])

HSP 1 Score: 798.119 bits (2060), Expect = 0.000e+0
Identity = 426/928 (45.91%), Postives = 610/928 (65.73%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE-------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR +     +++  DEP+A++AREF+R+  IG+EV + VENK P GREY  V++   ++  +N+AE +V  GLA VR++   GI  N   Q +L  LE+ AK+++KG WS    +  IR++++TIENP  FV+S   K V AIIEH+RDGC +RA +LP      +  VTVMLSG+K+P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LKEGF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D I VK  +G+ +   LSSIR P++   + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T+++E       ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QF   L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P    + A+ +  EA+ FTKEL +QREVE+E++++DK GNFIGW+++E    G+  NLS+ALVEN L+KVHF+AER S++K L  AE  A++ K  +W      +Y E+  +E +     KE    RV  Y+S  VT++ DG  FYAQ +E    + N+ + ++        V G++ P++G+ C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+   + LA+LP     + +P QATEY+ A +    D++ R  +  ++  DI + +  LNVEY S    P+   V ++  D  E+ G  L+++G++ VD + KEK L  ++ +YL+AQE A+  RLNIW+YGDFR+DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLGKDTS-GENIAESLVAEGLAMVRRE---GIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVRDGCMVRALLLP-----DYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVY-TQGAEKLRAAERSAKERKVRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRLEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPGGM-QVAEPYSEEAMLFTKELVLQREVEVEVESMDKAGNFIGWLHIE----GV--NLSVALVENALSKVHFTAERSSYYKTLVSAEESARQRKEKLWA-----NYEEKPKEEVAQVTEAKE----RVAKYRSVYVTEITDGLHFYAQDVETGTKLENLMESMRGEIAAQPPVEGSFAPRRGEFCIAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSTRLAALPPAFSTRTLPPQATEYAFAYIQVPQDEDARADAVDSVVRDIHNTQCLLNVEY-SGSVCPQ---VTLQFADTKEDVGLGLVKEGMVMVDIR-KEKYLQKMVTEYLNAQESAKSARLNIWRYGDFRDDDA 906          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:324404])

HSP 1 Score: 530.791 bits (1366), Expect = 5.783e-178
Identity = 281/570 (49.30%), Postives = 385/570 (67.54%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE-------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRL 1763
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR +     +++  DEP+A++AREF+R+  IG+EV + VENK P GREY  V++   ++  +N+AE +V  GLA VR++   GI  N   Q +L  LE+ AK+++KG WS    +  IR++++TIENP  FV+S   K V AIIEH+RDGC +RA +LP      +  VTVMLSG+K+P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LKEGF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D I VK  +G+ +   LSSIR P++   + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T+++E       ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QF   L+R G+   +VE++ SGSRL++Y+PKETC++T L AG   P +A +L
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGALARRAIQGQPDTKDTPDEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLGKDTS-GENIAESLVAEGLAMVRRE---GIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGGSHTIRDLKYTIENPRNFVDSLHQKPVNAIIEHVRDGCMVRALLLP-----DYYLVTVMLSGIKSPTFKREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCPNQVILGTILHPNGNITELLLKEGFARCVDWSMAVY-TQGAEKLRAAERSAKERKVRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRLEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATNAMEMGVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFFPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGKCQPASACQL 570          

HSP 2 Score: 92.8189 bits (229), Expect = 7.046e-19
Identity = 92/300 (30.67%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1179 RKFFLSSIRSPKI--NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAK-VHFSAERLSFFKQLCE----AEVKAKETKLNIW 2057
            R+  LS+IR+  +    I   P  K  P  D P  F+AREF+RKK+IGK+V   V+   P+        +   T GE N+AE+LV +GLA V R      N        L  ++ + KK +         SH I DL       R F+ SL  Q  +N I+E +  G  +R  +  +  ++T++ +GI  P   R    S  E  + F  EA  FT+   +QR+V+I +++     N +    +  P    N N++  L++ G A+ V +S   ++ + Q  E    AE  AKE K+ IW
Sbjct:   47 RQINLSNIRAGALARRAIQGQPDTKDTP--DEPWAFQAREFMRKKVIGKEVCFTVENKTPQGREYGMVYLGKDTSGE-NIAESLVAEGLAMVRREGIRGNNPEQVRLCDLEDQAKSSKKGLWSEGGG---SHTIRDLKYTIENPRNFVDSL-HQKPVNAIIEHVRDGCMVRALLLPDYYLVTVMLSGIKSPTFKREADGS--ETPEPFAAEAKFFTESRLLQRDVQIILESCP---NQVILGTILHP----NGNITELLLKEGFARCVDWS---MAVYTQGAEKLRAAERSAKERKVRIW 327          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 60.077 bits (144), Expect = 1.502e-8
Identity = 46/169 (27.22%), Postives = 75/169 (44.38%), Query Frame = 3
Query: 2238 ITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNP-KAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVD 2741
            IT++LQ  +   S     YKP+ G+LCA KF+LD  WYRA++  +D   K   + Y+DFGNEE      +  L   +  +P  A +    C+A        +  +C +                +      G S+   + D + N+G++L  D ++    KH    L+D
Sbjct:  205 ITQQLQKTYC--SSFAQEYKPEVGELCAVKFSLDQNWYRAEIQAVDVARKTAGVFYIDFGNEENVALDHIRPLSENIDAVPPFALQ---CCIAGVKPLTGSWTGECCI----------------AVRQLIAGKSLTFTVLD-IMNDGDLLAVDSLVSTLGKHVSTFLID 351          

HSP 2 Score: 56.225 bits (134), Expect = 2.448e-7
Identity = 36/118 (30.51%), Postives = 58/118 (49.15%), Query Frame = 3
Query: 2160 SALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGA---YKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +A+VT +   +    Q +EN ++I    ++LQ     H     A   ++P  G +C + F+ D  WYRAKV+   +   + + Y+DFGN E  E + L  +   L  +  QA   SLA
Sbjct:  409 TAVVTHLQSPSEILCQKLENASII----QQLQMNLRVHCSNTAASDDFRPAPGTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLA 522          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 60.077 bits (144), Expect = 1.673e-8
Identity = 48/183 (26.23%), Postives = 79/183 (43.17%), Query Frame = 3
Query: 2196 FYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNP-KAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVD 2741
             + Q  E    +  IT++LQ  +   S     YKP+ G+LCA KF+LD  WYRA++  +D   K   + Y+DFGNEE      +  L   +  +P  A +    C+A        +  +C +                +      G S+   + D + N+G++L  D ++    KH    L+D
Sbjct:  191 IHCQCEEMIESLKKITQQLQKTYC--SSFAQEYKPEVGELCAVKFSLDQNWYRAEIQAVDVARKTAGVFYIDFGNEENVALDHIRPLSENIDAVPPFALQ---CCIAGVKPLTGSWTGECCI----------------AVRQLIAGKSLTFTVLD-IMNDGDLLAVDSLVSTLGKHVSTFLID 351          

HSP 2 Score: 55.8398 bits (133), Expect = 2.634e-7
Identity = 36/118 (30.51%), Postives = 58/118 (49.15%), Query Frame = 3
Query: 2160 SALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGA---YKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +A+VT +   +    Q +EN ++I    ++LQ     H     A   ++P  G +C + F+ D  WYRAKV+   +   + + Y+DFGN E  E + L  +   L  +  QA   SLA
Sbjct:  409 TAVVTHLQSPSEILCQKLENASII----QQLQMNLRVHCSNTAASDDFRPAPGTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLA 522          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 60.077 bits (144), Expect = 1.673e-8
Identity = 48/183 (26.23%), Postives = 79/183 (43.17%), Query Frame = 3
Query: 2196 FYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNP-KAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVD 2741
             + Q  E    +  IT++LQ  +   S     YKP+ G+LCA KF+LD  WYRA++  +D   K   + Y+DFGNEE      +  L   +  +P  A +    C+A        +  +C +                +      G S+   + D + N+G++L  D ++    KH    L+D
Sbjct:  191 IHCQCEEMIESLKKITQQLQKTYC--SSFAQEYKPEVGELCAVKFSLDQNWYRAEIQAVDVARKTAGVFYIDFGNEENVALDHIRPLSENIDAVPPFALQ---CCIAGVKPLTGSWTGECCI----------------AVRQLIAGKSLTFTVLD-IMNDGDLLAVDSLVSTLGKHVSTFLID 351          

HSP 2 Score: 55.8398 bits (133), Expect = 2.634e-7
Identity = 36/118 (30.51%), Postives = 58/118 (49.15%), Query Frame = 3
Query: 2160 SALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGA---YKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +A+VT +   +    Q +EN ++I    ++LQ     H     A   ++P  G +C + F+ D  WYRAKV+   +   + + Y+DFGN E  E + L  +   L  +  QA   SLA
Sbjct:  409 TAVVTHLQSPSEILCQKLENASII----QQLQMNLRVHCSNTAASDDFRPAPGTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLA 522          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Match: tspan11 (tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 399/928 (43.00%), Postives = 589/928 (63.47%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I    LARR  A+   +++  DEP+A+ AREF+R+  IG+EV + V+ K+  GREY  V++   ++  +N++E +V  GLA  R+    G+ +N   Q +L  +EE A++A+KG WS    +  +R++++TIENP  FV+S   K V AIIEH+RDG  +RA +LP         VTVMLSG+K P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDW + V  +  +   RAAE+ AKE + R+W+DY  P              +++  ++  V KV+++ N D + VK  +G  +   LSSIR P++      D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K A G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P+  +E  + F  EA  FTKEL +QREVE+E++ +DK GNFIGW+++    +G+  N+S+ALVE+ L+KVHF+AER +++K L  AE   K+ K  +W+         +  ++     V    + +R  NYK  LVT++ D   FY Q +E    +  + + +++    +  + G++ P++GD C AK+ +DG WYRA+V K+++   +H+ Y+D+GN E+   + L  LP     + +P QA EY  A +    D++ R      +  DI + +  LNVE+ S    P    V ++  D  E+ G  L+++G++ V E  KEK+   ++ +Y+SAQE A+  RLN+W+YGDFR DD 
Sbjct:   19 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFLRKKLIGKEVCFTVDFKSSQGREYGMVYLGKDTS-GENISESLVAEGLASRRE----GVRANTPEQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNAIIEHVRDGSVVRALLLPDC-----YLVTVMLSGIKCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVY-TQGSEKLRAAERFAKEHKTRIWRDYVAP------------TANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGEGAQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPSGVQE-GEPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV----DGV--NISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWS---------KFEEQPVEEVVTVVEEKERNANYKPVLVTEITDELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFSTRTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEH-SGAGCPH---VTLQFADSKEDVGLGLVKEGLVMV-EVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADDA 899          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Match: tspan11 (tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785])

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 397/929 (42.73%), Postives = 587/929 (63.19%), Query Frame = 3
Query:   81 LIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
             I   VLSG ++I+R + + GPPPE+ I LS I    LARR  A+   +++  DEP+A+ AREF+R+  IG+EV + V+ K+  GREY  V++   ++  +N++E +V  GLA  R+    G+ +N   Q +L  +EE A++A+KG WS    +  +R++++TIENP  FV+S   K V AIIEH+RDG  +RA +LP         VTVMLSG+K P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDW + V  +  +   RAAE+ AKE + R+W+DY  P              +++  ++  V KV+++ N D + VK  +G  +   LSSIR P++      D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K A G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P+  +E  + F  EA  FTKEL +QREVE+E++ +DK GNFIGW+++    +G+  N+S+ALVE+ L+KVHF+AER +++K L  AE   K+ K  +W+         +  ++     V    + +R  NYK  LVT++ D   FY Q +E    +  + + +++    +  + G++ P++GD C AK+ +DG WYRA+V K+++   +H+ Y+D+GN E+   + L  LP     + +P QA EY  A +    D++ R      +  DI + +  LNVE+ S    P    V ++  D  E+ G  L+++G++ V E  KEK+   ++ +Y+SAQE A+  RLN+W+YGDFR DD 
Sbjct:   24 FISNYVLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFLRKKLIGKEVCFTVDFKSSQGREYGMVYLGKDTS-GENISESLVAEGLASRRE----GVRANTPEQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNAIIEHVRDGSVVRALLLPDC-----YLVTVMLSGIKCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVY-TQGSEKLRAAERFAKEHKTRIWRDYVAP------------TANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGEGAQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPSGVQE-GEPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV----DGV--NISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWS---------KFEEQPVEEVVTVVEEKERNANYKPVLVTEITDELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFSTRTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEH-SGAGCPH---VTLQFADSKEDVGLGLVKEGLVMV-EVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADDA 905          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Match: tspan11 (tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 396/924 (42.86%), Postives = 588/924 (63.64%), Query Frame = 3
Query:   96 VLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            VLSG ++I+R + + GPPPE+ I LS I    LARR  A+   +++  DEP+A+ AREF+R+  IG+EV + V+ K+  GREY  V++   ++  +N++E +V  GLA  R+    G+ +N   Q +L  +EE A++A+KG WS    +  +R++++TIENP  FV+S   K V AIIEH+RDG  +RA +LP    + +  VTVMLSG+K P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDW + V  +  +   RAAE+ AKE + R+W+DY  P              +++  ++  V KV+++ N D + VK  +G  +   LSSIR P++      D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K A G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P+  +E  + F  EA  FTKEL +QREVE+E++ +DK GNFIGW+++    +G+  N+S+ALVE+ L+KVHF+AER +++K L  AE   K+ K  +W+         +  ++     V    + +R  NYK  LVT++ D   FY Q +E    +  + + +++    +  + G++ P++GD C AK+ +DG WYRA+V K+++   +H+ Y+D+GN E+   + L  LP     + +P QA EY  A +    D++ R      +  DI + +  LNVE+ S    P    V ++  D  E+ G  L+++G++ V E  KEK+   ++ +Y+SAQE A+  RLN+W+YGDFR DD 
Sbjct:   21 VLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFLRKKLIGKEVCFTVDFKSSQGREYGMVYLGKDTS-GENISESLVAEGLASRRE----GVRANTPEQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNAIIEHVRDGSVVRALLLP----DCYL-VTVMLSGIKCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVY-TQGSEKLRAAERFAKEHKTRIWRDYVAP------------TANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGEGAQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPSGVQE-GEPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV----DGV--NISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWS---------KFEEQPVEEVVTVVEEKERNANYKPVLVTEITDELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFSTRTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEH-SGAGCPH---VTLQFADSKEDVGLGLVKEGLVMV-EVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADDA 897          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Match: tspan11 (tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 380/929 (40.90%), Postives = 568/929 (61.14%), Query Frame = 3
Query:   81 LIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
             I   VLSG ++I+R + + GPPPE+ I LS I    LARR  A+   +++  DEP+A+ AREF+R+  IG+EV + V+ K+  GREY  V++   ++  +N++E +V  GLA  R+    G+ +N   Q +L  +EE A++A+KG WS    +  +R++++TIENP  FV+S   K V             +  I        F    V     + P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDW + V  +  +   RAAE+ AKE + R+W+DY  P              +++  ++  V KV+++ N D + VK  +G  +   LSSIR P++      D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K A G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P+  +E  + F  EA  FTKEL +QREVE+E++ +DK GNFIGW+++    +G+  N+S+ALVE+ L+KVHF+AER +++K L  AE   K+ K  +W+         +  ++     V    + +R  NYK  LVT++ D   FY Q +E    +  + + +++    +  + G++ P++GD C AK+ +DG WYRA+V K+++   +H+ Y+D+GN E+   + L  LP     + +P QA EY  A +    D++ R      +  DI + +  LNVE+ S    P    V ++  D  E+ G  L+++G++ V E  KEK+   ++ +Y+SAQE A+  RLN+W+YGDFR DD 
Sbjct:   24 FISNYVLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFLRKKLIGKEVCFTVDFKSSQGREYGMVYLGKDTS-GENISESLVAEGLASRRE----GVRANTPEQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNG-----------KLLIFS------FSSNFVHTFNSQCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVY-TQGSEKLRAAERFAKEHKTRIWRDYVAP------------TANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGEGAQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPSGVQE-GEPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV----DGV--NISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWS---------KFEEQPVEEVVTVVEEKERNANYKPVLVTEITDELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFSTRTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEH-SGAGCPH---VTLQFADSKEDVGLGLVKEGLVMV-EVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADDA 893          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Match: tspan11 (tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 379/924 (41.02%), Postives = 567/924 (61.36%), Query Frame = 3
Query:   96 VLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            VLSG ++I+R + + GPPPE+ I LS I    LARR  A+   +++  DEP+A+ AREF+R+  IG+EV + V+ K+  GREY  V++   ++  +N++E +V  GLA  R+    G+ +N   Q +L  +EE A++A+KG WS    +  +R++++TIENP  FV+S   K V             +  I        F    V     + P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDW + V  +  +   RAAE+ AKE + R+W+DY  P              +++  ++  V KV+++ N D + VK  +G  +   LSSIR P++      D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K A G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P+  +E  + F  EA  FTKEL +QREVE+E++ +DK GNFIGW+++    +G+  N+S+ALVE+ L+KVHF+AER +++K L  AE   K+ K  +W+         +  ++     V    + +R  NYK  LVT++ D   FY Q +E    +  + + +++    +  + G++ P++GD C AK+ +DG WYRA+V K+++   +H+ Y+D+GN E+   + L  LP     + +P QA EY  A +    D++ R      +  DI + +  LNVE+ S    P    V ++  D  E+ G  L+++G++ V E  KEK+   ++ +Y+SAQE A+  RLN+W+YGDFR DD 
Sbjct:   25 VLSGCAIIVRGQPRGGPPPERQINLSNIRTGALARRAAASQQDAKDTPDEPWAFPAREFLRKKLIGKEVCFTVDFKSSQGREYGMVYLGKDTS-GENISESLVAEGLASRRE----GVRANTPEQSRLAEVEEQARSAKKGVWSEGTGSQTVRDLKYTIENPRHFVDSMHQKPVNG-----------KLLIFS------FSSNFVHTFNSQCPTFKREADGTETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWCIAVY-TQGSEKLRAAERFAKEHKTRIWRDYVAP------------TANLDQKDKQFVAKVVQILNADAMVVKLNSGDYKTIHLSSIRPPRLEGEGAQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVNVDYIRSASAATETVPAFPERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNAKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNMPSGVQE-GEPFSEEATLFTKELVLQREVEVEVEAMDKAGNFIGWLHV----DGV--NISVALVEHALSKVHFTAERSNYYKTLLAAEEGPKQRKEKVWS---------KFEEQPVEEVVTVVEEKERNANYKPVLVTEITDELHFYIQDVETGTQLEKLMESMRSEIASNPPLEGSFSPRRGDYCIAKY-MDGEWYRARVEKVESVAKVHVFYIDYGNREVLPSTRLGPLPQSFSTRTLPAQAIEYCFAFIQVPADEDARADVVDNVVRDIQNTQCLLNVEH-SGAGCPH---VTLQFADSKEDVGLGLVKEGLVMV-EVRKEKQFQKVIAEYVSAQESAKAARLNLWRYGDFRADDA 889          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Match: Snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1929266])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 423/927 (45.63%), Postives = 600/927 (64.72%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A     ++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKA++KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP  G ++   VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQN++G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY PP              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++M+       +NLS+ LVE  L+KVHF+AER +++K L  AE  AK+ K  +W       Y E+  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  +H+ Y+D+GN EI   + L +LP       +P QATEY+ A +    D++ R  +  ++  DI + +  LNVE+ S         V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP--GHHL---VTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVPP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMD------GANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWA-----HYEERPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISSHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSAS----CPHVTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Match: Snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1929266])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 304/609 (49.92%), Postives = 413/609 (67.82%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGN 1883
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A     ++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKA++KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP  G ++   VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQN++G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY PP              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QRE+ +EI++  K  N
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP--GHHL---VTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVPP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREL-LEINHGPKISN 605          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Match: Snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1929266])

HSP 1 Score: 95.1301 bits (235), Expect = 3.878e-21
Identity = 45/98 (45.92%), Postives = 65/98 (66.33%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNE 377
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A     ++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++  + + 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKAQSR 120          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 62.3882 bits (150), Expect = 3.304e-9
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 3
Query: 2160 SALVTQVLDGTRFYA---QLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSL 2501
            +A V +++    FYA   ++ EN+  +  +  EL  +       P AY+P+ GD C AK+T D  WYRA V++      + +LY D+GN E    S +  +P+   ++P+Q    SL
Sbjct:  935 AANVLEIISPALFYAIPSEMSENQEKLCVLAAELLEHCNAQKGQP-AYRPRTGDACCAKYTNDDFWYRAIVLETSE-SDVKVLYADYGNIETLPLSRVQPIPASHLELPFQIIRCSL 1049          

HSP 2 Score: 59.6918 bits (143), Expect = 2.249e-8
Identity = 43/162 (26.54%), Postives = 74/162 (45.68%), Query Frame = 3
Query: 2067 GEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLD----------------GTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            GE S  EQS   +++  V +     ++V  ++AL+ +VL                    F+ Q +++ + +  + + L  Y   H      + P  GD+C A+F+ D  WYRA V+   + +++ + YVD+GN EI     L  +   L  +P QA    LA
Sbjct:  445 GEQSSTEQSVDHSALEDVGRVTVESKIVTDRNALIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGHKLAELQESLSEY-CGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLA 605          

HSP 3 Score: 58.5362 bits (140), Expect = 4.991e-8
Identity = 39/112 (34.82%), Postives = 55/112 (49.11%), Query Frame = 3
Query: 2169 VTQVLDGTRFYAQL-----MENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDN-PKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQA 2486
            VT+    + FY QL     +EN N +    KE     +        Y P KG++C AK+T+D  W RA V  +D   +  H+LY+D+GNEE+    S+  L  GL   P  A
Sbjct:  264 VTEFKHPSNFYIQLYSSEVLENMNQLSTSLKETYANVVPED----GYLPVKGEVCVAKYTVDQTWNRAIVQAVDVLQRKAHVLYIDYGNEEMIPIDSVHPLSRGLDLFPPSA 371          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 62.3882 bits (150), Expect = 3.304e-9
Identity = 37/117 (31.62%), Postives = 61/117 (52.14%), Query Frame = 3
Query: 2160 SALVTQVLDGTRFYA---QLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSL 2501
            +A V +++    FYA   ++ EN+  +  +  EL  +       P AY+P+ GD C AK+T D  WYRA V++      + +LY D+GN E    S +  +P+   ++P+Q    SL
Sbjct:  935 AANVLEIISPALFYAIPSEMSENQEKLCVLAAELLEHCNAQKGQP-AYRPRTGDACCAKYTNDDFWYRAIVLETSE-SDVKVLYADYGNIETLPLSRVQPIPASHLELPFQIIRCSL 1049          

HSP 2 Score: 59.6918 bits (143), Expect = 2.249e-8
Identity = 43/162 (26.54%), Postives = 74/162 (45.68%), Query Frame = 3
Query: 2067 GEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLD----------------GTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            GE S  EQS   +++  V +     ++V  ++AL+ +VL                    F+ Q +++ + +  + + L  Y   H      + P  GD+C A+F+ D  WYRA V+   + +++ + YVD+GN EI     L  +   L  +P QA    LA
Sbjct:  445 GEQSSTEQSVDHSALEDVGRVTVESKIVTDRNALIPKVLTLNVGDEFCGVVAHIQTPEDFFCQQLQSGHKLAELQESLSEY-CGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLA 605          

HSP 3 Score: 58.5362 bits (140), Expect = 4.991e-8
Identity = 39/112 (34.82%), Postives = 55/112 (49.11%), Query Frame = 3
Query: 2169 VTQVLDGTRFYAQL-----MENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDN-PKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQA 2486
            VT+    + FY QL     +EN N +    KE     +        Y P KG++C AK+T+D  W RA V  +D   +  H+LY+D+GNEE+    S+  L  GL   P  A
Sbjct:  264 VTEFKHPSNFYIQLYSSEVLENMNQLSTSLKETYANVVPED----GYLPVKGEVCVAKYTVDQTWNRAIVQAVDVLQRKAHVLYIDYGNEEMIPIDSVHPLSRGLDLFPPSA 371          
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5REU4|SND1_PONAB (Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii OX=9601 GN=SND1 PE=2 SV=1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 426/927 (45.95%), Postives = 600/927 (64.72%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A    +++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKAA+KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY  P              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++++       +NLS+ LVE+ L+KVHF+AER S++K L  AE  AK+ K  +W       Y EQ  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  IH+ Y+D+GN E+   + L +LP       +P QATEY+ A +    DD+ R  +  ++  DI + +  LNVE+ S    P    V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVAP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHID------GANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWA-----HYEEQPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSA-GCPH---VTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Match: sp|Q78PY7|SND1_MOUSE (Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus OX=10090 GN=Snd1 PE=1 SV=1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 423/927 (45.63%), Postives = 600/927 (64.72%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A     ++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKA++KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP  G ++   VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQN++G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY PP              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++M+       +NLS+ LVE  L+KVHF+AER +++K L  AE  AK+ K  +W       Y E+  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  +H+ Y+D+GN EI   + L +LP       +P QATEY+ A +    D++ R  +  ++  DI + +  LNVE+ S         V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP--GHHL---VTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVPP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMD------GANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWA-----HYEERPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISSHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSAS----CPHVTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7KZF4|SND1_HUMAN (Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1)

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 424/927 (45.74%), Postives = 599/927 (64.62%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            I+K VLSG ++I+R + + GPPPE+ I LS I A  LARR  A    +++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKAA+KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY  P              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++++       +NLS+ LVE+ L+KVHF+AER S++K L  AE  AK+ K  +W       Y EQ  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  IH+ Y+D+GN E+   + L +L        +P QATEY+ A +    DD+ R  +  ++  DI + +  LNVE+ S    P    V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVAP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHID------GANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWA-----HYEEQPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSA-GCPH---VTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Match: sp|Q66X93|SND1_RAT (Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Snd1 PE=1 SV=1)

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 424/929 (45.64%), Postives = 599/929 (64.48%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRH--VTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR  A     ++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKA++KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP        H  VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY PP              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKV++ VDYI+P + + E      ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++M+       +NLS+ LVE+ L+KVHF+AER +++K L  AE  AK+ K  +W       Y EQ  +E  V  V +E +  R  +YK   VT++ D   FY Q +E    +  + + +++    H  V GAY P++G+ C AKF +DG WYRA+V K+++P  +H+ Y+D+GN EI   + L +LP       +P QATEY+ A +    D++ R  +  ++  DI + +  LNVE+ S         V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   22 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLASRREGMRA---NNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP-------DHYLVTVMLSGIKCPTFRRETDGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVPP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGDNIQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVSVTVDYIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHMD------GANLSVLLVEHALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWA-----HYEEQPVEE--VMPVLEEKE--RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRSDISSHPPVEGAYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGALPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCP----HVTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 902          
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Match: sp|Q863B3|SND1_BOVIN (Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus OX=9913 GN=SND1 PE=1 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 422/927 (45.52%), Postives = 598/927 (64.51%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPK---TDSL---EERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQK--IPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR       +++  DEP+A+ AREF+R+  IG+EV + +ENK P GREY  +++   +N  +N+AE +V  GLA  R+   A   +N +  +L   EE AKA++KG WS  + +  IR++++TIENP  FV+SH  K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P ++   +  ++PEPFA EAKFF ES+LLQR V I LE+ +NQNI+G+I+HP GNI E +LKEGF R VDWS+ V  +  A   RAAE+ AKE+RLR+W+DY  P              +++  ++  V KV++V N D I VK  +G  +   LSSIR P++   N  D N  KK++PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+P    TD++    ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR AR LP   +E  + F  EA  FTKEL +QREVE+E++++DK GNFIGW++++       +NLS+ LVE+ L+KVHF+AER +++K L  AE  AK+ K  +W       Y EQ  +E      +KE    R  +YK   VT++ D   FY Q +E    +  + + ++N    H  V G+Y P++G+ C AKF +DG WYRA+V K+++P  +H+ Y+D+GN EI   + L +LP       +P QATEY+ A +    D++ R  +  ++  DI + +  LNVE+ S    P    V ++  D   + G  L+++G++ V E  KEK+   ++ +YL+AQE A+  RLN+W+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAVAQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTN-GENIAESLVAEGLATRREGMRA---NNPEQNRLAECEEQAKASKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWSIAVY-TRGAEKLRAAERFAKERRLRIWRDYVAP------------TANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKN--KKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATDTVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQE-GEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHID------GANLSVLLVEHALSKVHFTAERSAYYKSLLSAEEAAKQKKEKVWA-----HYEEQPVEELMPVLEEKE----RSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKF-VDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLPPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSA-GCPH---VTLQFADSKGDVGLGLVKEGLVMV-EVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDA 903          
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Match: A0A433U9X2 (Staphylococcal nuclease domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_001596 PE=4 SV=1)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 454/926 (49.03%), Postives = 630/926 (68.03%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAP-SGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNE-QYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSN-------PAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQ-VDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            +VKQVLSGD+++LR + K GPPPE+ + LS I AP+LARRP  N ++S    DEP+AWEAREF+R+  IG+EV + VE K P +GREY  +++   S   +NL E ++  GL +VRK    G+ S++   Q+L  LE+AAK A KGK +  + +  +RNI WTIENP  FV+SH NK + A+IEH+RDGCT+RAF+LP      F +VTVMLSG+K P  K + + +Q PEPF +EAK+F ES+LLQ+ V I LE  +NQN++G+++HP GNI EF+LKEGF R VDWSMGV+ +  A   RAA+K A+EK+LR+WKDY+P             + S  + +++  GKV+E+ NGD + +K      +K FL+SIR P+  P++S+       P K+ +PLYDIP++FEAREF+RKKLIGKKVN+ +DYIQP      E+   TVT   +NVAEALV KGLATVIRYR  D+ RS +YD LLAAES A KK VGVHSKKEPP H++ D+SG+ NKA+QFL  L+R GK   IVEFIASGSRLR+Y+PKETC++T+L +GI+CP+ AR LP+ +   AD FG EAL F KE+CMQREVE+E++ +DKGGNFIGW+++    +G+  NLS+ALVE+GLA VHF+AE   F+KQL + E +AKE KL +W      +++E          VK E++ V+R +N+   +VT+V D   FYAQ  EN   +  + ++L+     +  +PGAY PKKGD+CA++F+ D  WYRAK+ KI+  KA  + ++D+GN E    SSLA+LP+  + +  QAT+Y+LAC+A   D+E +  +  AL  DI +K + LN+EY+S+        V +K  +  ++   +L+ +G L V E  +EKRL  ++ Q   AQEEA+  R N+W+YGDFR D+ 
Sbjct:   14 VVKQVLSGDTVVLRGQPKGGPPPERTVCLSNITAPKLARRPNPNVENSTETKDEPWAWEAREFLRKKIIGKEVAFTVEYKVPGTGREYGVIYLGKDST-GENLTESLISEGLVDVRK---TGLKSDDPAQQRLAQLEDAAKTAGKGKHAEGEASKHVRNITWTIENPRNFVDSHHNKCIDAVIEHVRDGCTIRAFLLP-----TFEYVTVMLSGIKCPMNKQSTDGKQVPEPFMEEAKYFTESRLLQKDVQIILEGVSNQNLLGTVMHPNGNITEFLLKEGFARCVDWSMGVV-TQGAEKLRAAQKFAREKKLRIWKDYKP-------------SESAVIKDKTFSGKVVEIVNGDAMVIKT-ETSFKKIFLASIRPPR--PVESSENTEKQAPNKRSRPLYDIPYMFEAREFMRKKLIGKKVNVEIDYIQPPNQGFAEKTCCTVTTSGINVAEALVSKGLATVIRYRQDDDQRSSHYDDLLAAESRAVKKGVGVHSKKEPPIHRVADVSGDVNKAKQFLPFLQRAGKSEAIVEFIASGSRLRLYLPKETCLITLLISGIECPKGARTLPSGQSFPADPFGEEALTFVKEMCMQREVEVEVEGMDKGGNFIGWLFV----DGV--NLSVALVESGLASVHFTAENSQFYKQLVQKEAEAKEAKLKLWA-----NFVEHKE-------VKVEDEPVERKINFTKVVVTEVTDELTFYAQTSENGAALEKLMEDLRQEMESNPPLPGAYTPKKGDMCASRFSQDNQWYRAKIEKIEGGKAT-VFFIDYGNREQASTSSLAALPTNFRIVSPQATQYALACVAVPNDEEAKQDAVDALFQDIVNKPMLLNLEYKSSPAD----CVTLKHPESEDDVASVLVAEGFLTV-ESRREKRLAKMVAQLQKAQEEAKRLRKNLWRYGDFREDEA 889          
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Match: A0A1S3IS83 (Staphylococcal nuclease domain-containing protein OS=Lingula unguis OX=7574 GN=LOC106166393 PE=4 SV=1)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 459/925 (49.62%), Postives = 626/925 (67.68%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAP-SGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGI-ASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDS-------NPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVS-VLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDD 2828
            IVKQ+LSGD++++R + + GPPPE+ I LS + APRLARR   N + S    DE +AWEAREF+R+  IG+EV + VE K P SGREY  V++   ++  +N+ E++V  GL EVR+    GI A++E  QKLI LE+ AK A KGKW    P   IRNI WTIENP  FV+SH  K V A+IEH+RDGCT+RAF+LP      F +VTVMLSG+K P +KL +     PEP+A+EAKFF ES+LLQR+V+I LE  +N N++GS++HPKGNIAE +L+EGF R VDWSMG + S  A   R AEK AKEKRLR+WKD+ P               ++EL +++  GKV+EV NGD++ VK    Q +K FLSS+R P+  PI          P K+ +PLYDIP++FEAREFLRKKL+GKKVN+++DYIQP  ++  E+   T+T+G +NVAEAL+ KGLA+VIRYR  D+ RS +YD LLAAE+ A+KK VG+HSKKEPP H++ D+SG+ NKA+QFL  L+R GK   IVEF+ASGSRLR++IP+ETC++T L AGIDCPR +R  PN+     D  G EA+ FTKE C+QREVE+E+++IDKGGNFIGW+++    +G+N   SI+LVE GL+K+HF+AER +F+K L  AE +AKE K N+W      +++E+   E    G +     +R VN+K+ +VT+V +   FYAQ +EN   +  + ++L+     +  +PG+Y PKKGDLCAAKF +DG WYRAKV K+D    +H+ Y+D+GN E    + LA L      +P QA EY+LA +A   D++ +  +  AL NDI +K++ LNVEY       +G   V +   D  ++    L+ +G+L V E  +EKRL  L+  Y  AQE+A+  R+N+W+YGDF  DD
Sbjct:   13 IVKQILSGDAIVIRGQPRGGPPPERTICLSNVTAPRLARRANPNLEGSTETKDEAFAWEAREFLRKKLIGKEVAFTVEYKVPGSGREYGCVYLGKDTS-AENVTEILVAEGLVEVRR---GGIKATDENQQKLIQLEDTAKGAGKGKWGQYQPGEHIRNITWTIENPRNFVDSHHGKPVSAVIEHVRDGCTVRAFLLP-----NFDYVTVMLSGIKCPMFKL-EGTTPKPEPYAEEAKFFTESRLLQREVEIILEGVSNNNLLGSVLHPKGNIAELLLREGFARCVDWSMGSV-SQGADKLRTAEKFAKEKRLRIWKDFTP------------STPTVELKDKNFSGKVVEVVNGDSLMVKIGENQYKKCFLSSVRPPRPAPITDADEPKKDEPKKRSRPLYDIPYMFEAREFLRKKLVGKKVNVQIDYIQPPANNFPEKTCCTITIGGINVAEALISKGLASVIRYRQDDDQRSAHYDELLAAEARAEKKGVGIHSKKEPPIHRVADISGDVNKAKQFLPFLQRAGKSEAIVEFVASGSRLRLFIPRETCLITFLLAGIDCPRGSRPGPNNTTVPGDPCGEEAMVFTKEACLQREVEVEVESIDKGGNFIGWMFV----DGVNH--SISLVEEGLSKMHFTAERSNFYKALSTAEERAKELKKNVWA-----NFVEEKPVEEIDEGPQ-----ERAVNHKTVVVTEVREDMHFYAQDVENGPKLEKLMEQLRQDMETNPPLPGSYTPKKGDLCAAKF-VDGEWYRAKVEKVDK-NNVHVFYMDYGNREALSPTRLAVLTPTFHGLPPQAKEYALALVAVPEDEDAKKDASDALYNDILNKQMLLNVEYRG-----QGFDYVSLAYTDNKDDVALGLISEGLLIV-EGRREKRLQKLLDDYKKAQEKAKASRVNLWRYGDFTEDD 890          
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Match: K1R512 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10026535 PE=4 SV=1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 438/920 (47.61%), Postives = 626/920 (68.04%), Query Frame = 3
Query:   96 VLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAP-SGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQ-YQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINP-----IDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKIN-DKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            VLSGD++++R + K GPPPEK I  S I APR+ARRP    D+ E   DEP+AWEARE++R+  IG+EV + +E   P +GREY  V++       +N+ E +V  GL EVR+    G+  ++Q  Q+LI LE+AAK+A KGKW+  +    IRN++WT+EN   FV+SH NK + A+IEH+RDGCT+RAF+LP      F +VT+MLSG+K P +K  ++ +Q PE FA+EAK+F E +LLQR V I LE  +N N++G+++HP GNIAE +L+EGF R VDWSMGV+ +  A   RAAEK AKEK+ RLWKDY P               ++++ +++  GKV+EV NGD + VK    Q +K FLSSIR P+  P      DS P  + +PLYD+P++FEAREFLRKKLIGKKVN++VDYIQP  ++  E+   TVT+  +NV EALV KGLATV+RYR  D+ RS +YD LLAAE+ AQKK VG+HSKKE P H++ D+SG+ NK +QFL  L+R GK   IVEF+ASGSR+R+Y+PKETC+ T L +GI+CPR AR LP  +   ++ +G+EAL FTKE+C+QREVE+ ++ +DKGGNFIGW++++      N+NLS+ALVE GLAKVHF+AER +++KQL  AE  AK  + N+W          +  QE +      E+  +R V+YKS +VT+V    +F+AQL++N   + N+ ++L+     +  +PGAY PK+ D+CAAKF+ D  WYRAKV ++D  K + +L++D+GN+E    +SLA+LP+  Q +  QATEY LAC+A  PD++++  ++ A  ++I+++++ +NVEY+       G+  +  +N +  E+  + L+  G L + E+ +EKRL  L+  Y+ AQE+A+  R N+W+YGDF  DD 
Sbjct:  197 VLSGDAVVIRGQPKGGPPPEKTICFSNITAPRMARRPNPAQDNVETK-DEPFAWEAREYLRKKLIGKEVAFVIEYTVPGTGREYGCVYLGKDIATGENITEALVSEGLVEVRR---GGLKLDDQGQQQLIQLEDAAKSAGKGKWNTAEAAKHIRNVKWTVENARNFVDSHHNKPIDAVIEHVRDGCTVRAFLLP-----SFDYVTIMLSGIKCPMFKQDESGKQVPELFAEEAKYFTEVRLLQRDVQIILEGVSNNNLLGTVLHPNGNIAELLLREGFARCVDWSMGVV-TQGADKLRAAEKIAKEKKARLWKDYSPS------------GPTVDIKDKTFSGKVVEVVNGDALVVKTDKNQFKKVFLSSIRPPRNAPAPADSTDSTPKPRGRPLYDVPYMFEAREFLRKKLIGKKVNVQVDYIQPANNNFPEKTCCTVTISGINVGEALVGKGLATVVRYRMEDDQRSEHYDELLAAEARAQKKGVGLHSKKEAPIHRVADVSGDLNKCKQFLPFLQRAGKTEAIVEFVASGSRVRLYLPKETCLTTFLISGIECPRGARPLPGGQMSQSEPYGDEALQFTKEMCLQREVEVRVETMDKGGNFIGWLFVD------NTNLSVALVEEGLAKVHFTAERSNYYKQLQIAEENAKRNRRNLW----------KDYQEVTEVEEVVEDNTERNVSYKSVVVTEVTADLKFFAQLVDNGPQLENLMEQLRQDMTANPPLPGAYTPKRNDMCAAKFSQDSEWYRAKVERVDGSK-VTVLFIDYGNKEQTTATSLATLPASFQSLAPQATEYCLACVALPPDEDFKNDAEDAFYDEIANRQLNMNVEYKVG-----GLEYVSLVNPETKEDVAQKLVSSGFL-LAERRREKRLAKLVSDYVKAQEKAKTARENMWRYGDFTEDDA 1071          
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Match: A0A2C9JNE9 (Staphylococcal nuclease domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061143 PE=4 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 450/924 (48.70%), Postives = 625/924 (67.64%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAP-SGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNE-QYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI------NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            +VKQVLSGD+++LR + K GPPPE+ + LS I AP+LARR   N DSS    DEP+AWEARE++R+  +G+EV + VE K P +GREY  +++   ++  +N+ E ++  GL EVRK    G+ +++   Q+L  LE+AAKAA KGK +  + +  +R+I+WTI+NP  FV+SH NK + A+IEH+RDGCT+RAF+LP      F +VTVML+G+K P  K   + +Q PEPF +EAK+F ES+LLQ+ V I LE  +NQN++G+I+HP GNI EF+LKEGF R VDWSMGV+ +  A   RAAEK AK+K+LR+WKDY+P ++            ++ +  +S  GKV+EV NGD + +K ++   +K FL+SIR P+        P+   P K+ +PLYDIP++FEAREFLRKKLIGKKVN+ VDYIQP      E+   TVT+G +NVAEALV KGLATVIRYR  D+ RS +YD LLAAE+ A KK  G+HSKKE P H++ D+SG+  KA+QFL  L+R G+   +VEFIASGSRLR+Y+PKETC++T+L +GI+CP+ AR LPN++   A+ FG EAL FTKE+CMQREVE+E++ IDKGGNFIGW+++    +G+  NLS+ALVE GLAKVHF+AE+ SF+K L E E KAKE KL IW           ++         +E  V+R  NY   +VT+V D   F+AQ ++N   +  + ++L+     +  +PG+Y  +KGDLCAA+F+ D  WYRAK+ KI+   A  +L+VD+GN E    S L +LP   + +P QATEY+LAC++   D++ +  +  AL NDI +K + LN+EY      P  VS  +K  +  ++    L+ +G L V E  KEKRL  ++ +Y  AQEEA+  R N+W+YGDFR D+ 
Sbjct:   14 VVKQVLSGDTVVLRGQPKGGPPPERTVCLSNITAPKLARRANPNVDSSVETKDEPWAWEAREYLRKKLVGKEVVFTVEYKVPGTGREYGVIYLGKDTS-GENITESLIAEGLVEVRK---TGLKNDDPAQQRLAQLEDAAKAAGKGKHAEGEASKHVRDIKWTIDNPRHFVDSHHNKPIDAVIEHVRDGCTVRAFLLP-----TFEYVTVMLAGIKCPMNKQDADGKQVPEPFMEEAKYFTESRLLQKDVKIILEGVSNQNLLGTILHPNGNITEFLLKEGFARCVDWSMGVV-TQGADKLRAAEKIAKDKKLRIWKDYKPAES------------NINIKEKSFTGKVVEVVNGDGLVIK-LDNTFKKIFLASIRPPRPLEAQGDAPVKETPNKRSRPLYDIPYMFEAREFLRKKLIGKKVNVEVDYIQPPNQGYPEKTCCTVTIGGINVAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAVKKGAGLHSKKEAPIHRVADVSGDVAKAKQFLPFLQRAGRSEAVVEFIASGSRLRLYLPKETCLITLLISGIECPKGARTLPNNQNFPAEPFGEEALLFTKEMCMQREVEVEVEGIDKGGNFIGWLFV----DGV--NLSVALVEAGLAKVHFTAEKSSFYKTLLEKEAKAKEDKLKIW-----------ANFVEEKEVKIEEEPVERKPNYNRVIVTEVTDDLTFFAQNVDNGTNLEKLMEDLRQEMEVNPPLPGSYTARKGDLCAARFSQDNQWYRAKLEKIEGSTAT-VLFVDYGNREKTAVSGLCALPGSFKTLPPQATEYTLACVSVPSDEDAKQDAVDALYNDILNKTMLLNIEYRGGSGSPDYVS--LKHAETDDDVVTALITEGYLTV-EARKEKRLAKMVSEYQKAQEEAKRLRKNLWRYGDFREDEA 893          
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Match: A0A126Q9D5 (Staphylococcal nuclease domain-containing protein OS=Mytilus galloprovincialis OX=29158 PE=2 SV=1)

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 432/919 (47.01%), Postives = 621/919 (67.57%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNE-QYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI--NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVKQ LSGD++++R + + GPPPEK I LS I APR+ARRP  N + S    DEP+AWEAREF+R+  IG+E+ +  E + P  +    +  A      +N+ E +V  GL EVR+    G+  ++   Q+LI LEE AK+  KG+W     +  +R+I W IENP  FV+S  NK + A+IEH+RDGCT+RAF+LP +      +VT++LSG+K P +K  D  +Q  EPFA+EAKF+ E +LLQR V + LE+ +NQN++G+++HP GNIAE +L+EGF R VDWSMGV+ S  A   RAAE++AK+K+ R+WK+Y P             ++S+++ +++  GKV+E+ NGD + VK  +G+ +K FLSS+R P+   N  +  P K+++PLYDIP+++EAREFLR KLIGKKVN++VDYIQP      E+   TVT+G +NV EALV KGLA VIRYR  D+ RS +YD LLAAE+ A+KK VG+HSKKE P H++ D+SG+  K++QFL  L+R G+   +VEFIASGSRLR+YIP+ETC++T L +GI CPR AR LP  +   ++ +G+EAL FTKE+C+QREVE+ ++ +DKGGNFIGW++++      N NLS+ALVE GLAKVHF+AER +F+KQ+  AE  AK+ KLN+W       Y+E +S    +     +++ +R VNY++ +VT+V +   F+AQ ++N   +  + ++L+     +  +PGAY PKKGDLCAAKF+ DG WYRAKV K +  K   +L++D+GN E    + LA+LP+  Q +P QATE++LAC A  PD++ +  +     + + +KE+KLN+EY S  N+     V++   D  ++  + L+ DG L V EK +EK+L  L+  Y  AQE+A+  RLN+W+YGDF  DD 
Sbjct:   12 IVKQALSGDAVVIRGQPQGGPPPEKTICLSNITAPRMARRPNPNMEGSVETKDEPFAWEAREFLRKKLIGKEIVFVKEYEVPGTKRLYGIIYAGKDTNAENITESMVSEGLVEVRR---GGLKPDDVNQQRLIQLEEEAKSQGKGRWG-EGASKHVRDITWVIENPRNFVDSFHNKPIDAVIEHVRDGCTVRAFLLPKMD-----YVTILLSGIKAPMFKQDDKGDQVSEPFAEEAKFYTEVRLLQRDVKVILESVSNQNLIGTVLHPNGNIAELLLREGFARCVDWSMGVV-SQGADKLRAAEREAKDKKKRIWKEYTP------------SSSSIDIKDKAFQGKVVEIVNGDALVVKMGDGKSKKVFLSSVRPPRAVDNTENQAPNKRMRPLYDIPYMYEAREFLRTKLIGKKVNVKVDYIQPANQGFPEKTCCTVTIGGVNVGEALVGKGLAKVIRYRQDDDQRSSHYDELLAAEARAEKKLVGIHSKKEAPIHRVADVSGDIAKSKQFLPFLQRAGRSEALVEFIASGSRLRLYIPRETCLVTFLLSGISCPRGARPLPGGETSKSEPYGDEALAFTKEMCLQREVEVTVEAMDKGGNFIGWLFVD------NVNLSLALVEEGLAKVHFTAERSNFYKQMLNAEENAKKKKLNLWK-----DYVEDTSVHEEI----VDDKTEREVNYRNVVVTEVNEDLSFFAQYVDNGPQLEKLMEQLRTEMESNPPLPGAYSPKKGDLCAAKFSQDGQWYRAKVEKNEKGK-FTVLFIDYGNREKTASTELATLPASYQTLPAQATEFTLACSALPPDEDAKQDALDQFYDSVVNKELKLNIEYRSGGNY-----VVLLYPDTDQDVAQGLISDGYLIV-EKRREKKLAKLVSDYQKAQEKAKAGRLNLWRYGDFTEDDA 886          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:103026608])

HSP 1 Score: 776.548 bits (2004), Expect = 0.000e+0
Identity = 420/929 (45.21%), Postives = 599/929 (64.48%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE--------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS + A  LARR + N   +++  DEP+A++AREF+R+  IG+EV + VE K   GREY  V++   ++  +N+AE +V  GLA VR++   GI  N   Q +L  LE+ AK+++KG WS    +  IR+++++IENP  FV+S   K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LK+GF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D I VK  +G+ +   LSSIR P+    + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T + E        ER  ATVT+G +N+AEALV KGLAT IRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P      A+ F  EA  FTKEL +QREVE+E++++DK GNFIGW+++E    G+  NLS+ALVEN L+KVHF+AER S++K L  AE  A++ K  +W      +Y E+ ++E +    +KE    RV NY++  VT++ DG  FY Q +E    + N+ + ++        V G++ P +GD C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+     LA+LP     + +P QATEY+ A +    D++ R  +   +  DI + +  LNVEY S  + P    V ++  D  ++ G  L+++G++ VD + KEK L  ++ +YL+ QE A+  RLNIW+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNVRAGALARRAIQNQPETKDTPDEPWAFQAREFLRKKMIGKEVCFTVEIKTQQGREYGMVYLGKDTS-GENIAESLVSEGLATVRRE---GIRGNNPDQARLCDLEDQAKSSKKGMWSEGGGSHTIRDLKYSIENPRNFVDSLHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFKREADGAETPEPFAAEAKFFTESRLLQRDVQIILESCPNQIILGTILHPNGNITELLLKDGFARCVDWSMAVY-TQGAEKLRAAERSAKERKVRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRNEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATTAAETGPVPAFPERTCATVTIGGINIAEALVSKGLATCIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNIPGG---TAEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIE----GV--NLSVALVENSLSKVHFTAERSSYYKTLQSAEEVARQRKDKLWA-----NYEEKPTEEVAQVSEEKE----RVANYRAVYVTEITDGLHFYTQDVETGAQLENLMETMRAEIAAQPPVEGSFTPHRGDYCMAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSVRLATLPPAFSTRALPAQATEYAFAFIQVSQDEDARADAVDCIVKDIQNTQCLLNVEY-SGASCPH---VTLQFTDSKDDVGLGLVKEGLVMVDVR-KEKHLQKMVTEYLNGQESAKSARLNIWRYGDFRADDA 905          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:103026608])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 415/929 (44.67%), Postives = 589/929 (63.40%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQ-KLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLE--------ERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGL--QKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS + A  LARR + N   +++  DEP+A++AREF+R+  IG+EV + VE K   GREY  V++   ++  +N+AE +V  GLA VR++   GI  N   Q +L  LE+ AK+++KG WS    +  IR+++++IENP  FV+S   K V AIIEH+RDG  +RA +LP      +  VTVMLSG+K P +K   +  ++PEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LK+GF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D I VK  +G+ +   LSSIR P+    + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T + E        ER  ATVT+G +N+AEALV KGLAT IRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QFL  L+R G+   +VE++ SGSRL++Y+PKETC++T L AGI+CPR +R +P      A+ F  EA  FTKEL +QREVE+E++++DK GNFIGW+++E    G+  NLS+ALVEN L+KVHF+AER S++K L  AE  A++ K  +W      +Y E+ ++E +    +KE    RV NY++  VT++ DG  FY Q +E    + N+ + ++        V G++ P +GD C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+     LA+LP     + +P QATEY+ A +    D++ R  +   +  DI + +  LNVEY S  + P    V ++  D  ++ G  L+++G++ VD + KEK L                K LNIW+YGDFR DD 
Sbjct:   23 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNVRAGALARRAIQNQPETKDTPDEPWAFQAREFLRKKMIGKEVCFTVEIKTQQGREYGMVYLGKDTS-GENIAESLVSEGLATVRRE---GIRGNNPDQARLCDLEDQAKSSKKGMWSEGGGSHTIRDLKYSIENPRNFVDSLHQKPVNAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFKREADGAETPEPFAAEAKFFTESRLLQRDVQIILESCPNQIILGTILHPNGNITELLLKDGFARCVDWSMAVY-TQGAEKLRAAERSAKERKVRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAIVVKLNSGEYKTIHLSSIRPPRNEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATTAAETGPVPAFPERTCATVTIGGINIAEALVSKGLATCIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYMPKETCLITFLLAGIECPRGSRNIPGG---TAEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIE----GV--NLSVALVENSLSKVHFTAERSSYYKTLQSAEEVARQRKDKLWA-----NYEEKPTEEVAQVSEEKE----RVANYRAVYVTEITDGLHFYTQDVETGAQLENLMETMRAEIAAQPPVEGSFTPHRGDYCMAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVLSSVRLATLPPAFSTRALPAQATEYAFAFIQVSQDEDARADAVDCIVKDIQNTQCLLNVEY-SGASCPH---VTLQFTDSKDDVGLGLVKEGLVMVDVR-KEKHL---------------QKMLNIWRYGDFRADDA 890          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Match: stk31 (serine/threonine kinase 31 [Source:NCBI gene;Acc:103024260])

HSP 1 Score: 61.2326 bits (147), Expect = 5.315e-9
Identity = 47/145 (32.41%), Postives = 69/145 (47.59%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLAC--LANHPDDEYRYISKCALENDISDKEVKLN 2594
            +VT V+D   F+AQ +  +     I   L         V G   P+K     A F+ D CWYR KV +  + K   + YVD+GN E+ + S LA LP  LQ +P  A +Y      L++  D       K  L+N I  K++++N
Sbjct:   37 VVTHVVDAITFWAQNVTEDKTTETIDTILSEKCPTAVRVTGKPSPQK--FYGACFSEDRCWYRCKVQQQVDDK-FQVSYVDYGNTEVVDRSDLAELPEDLQ-MPALAKKYKFWGFHLSSEQDSPNYSQGKSFLQNLIYGKKLRIN 177          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Match: stk31 (serine/threonine kinase 31 [Source:NCBI gene;Acc:103024260])

HSP 1 Score: 60.8474 bits (146), Expect = 6.197e-9
Identity = 47/145 (32.41%), Postives = 69/145 (47.59%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLAC--LANHPDDEYRYISKCALENDISDKEVKLN 2594
            +VT V+D   F+AQ +  +     I   L         V G   P+K     A F+ D CWYR KV +  + K   + YVD+GN E+ + S LA LP  LQ +P  A +Y      L++  D       K  L+N I  K++++N
Sbjct:   37 VVTHVVDAITFWAQNVTEDKTTETIDTILSEKCPTAVRVTGKPSPQK--FYGACFSEDRCWYRCKVQQQVDDK-FQVSYVDYGNTEVVDRSDLAELPEDLQ-MPALAKKYKFWGFHLSSEQDSPNYSQGKSFLQNLIYGKKLRIN 177          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 57.7658 bits (138), Expect = 6.030e-8
Identity = 38/119 (31.93%), Postives = 62/119 (52.10%), Query Frame = 3
Query: 2169 VTQVLDGTRFYAQLMENENVIINITKELQNYFME-HSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHP 2522
            ++ ++    F+ QL ++EN ++++T+EL +     ++     Y P  G L  A F  D  WYRA VIK  N K IH+ ++DFGNE     +S+  L     ++P  +   SL    +HP
Sbjct:  986 ISHIISPNSFFVQLAKDENGLVSLTEELNSISSSVNNQAQMNYFPH-GSLVKAVFPDDNSWYRA-VIKETNGKDIHVEFIDFGNEATVPATSVRKLEEQFLQVPRFSIHCSLK--RDHP 1100          

HSP 2 Score: 57.3806 bits (137), Expect = 9.852e-8
Identity = 31/61 (50.82%), Postives = 40/61 (65.57%), Query Frame = 3
Query: 2304 KGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQA 2486
            +GD C A FT D  WYRAKVIK  + K++ +L+VD+GNE  NE  S+  LP  L + P QA
Sbjct: 1234 QGDPCLALFT-DKLWYRAKVIK-KSQKSVSVLFVDYGNESENESGSVKPLPLSLLERPLQA 1292          

HSP 3 Score: 54.299 bits (129), Expect = 8.038e-7
Identity = 60/223 (26.91%), Postives = 104/223 (46.64%), Query Frame = 3
Query: 1899 YMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAK------ETKLNIWTV---DGEMSYLEQSSQEASVN------------GVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENV--IINITKEL----QNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQA 2486
            +++ P   I+  +++    N   K  ++ E++  FK +  A  + K      E K ++W V   D  +  LE + +  S N            GV K+  V      K A  + V+D   F+ Q  ++E +  I +I +E     Q   +   H+       +GD C A F  D  WYRA+VI   +  ++ +L+VD+GNE   +++S+ S+P+ L +IP QA
Sbjct:  634 FLKFPRYSIHCCINVG---NAERKKEWTEEQMDIFKNVIVANGERKLRCNFIEEKESVWQVGIQDQSLLNLESTLELKSCNTSTTVCSRGVCPGVYKKPDVSLGQTIK-AYASSVVDPNFFWCQFADSEKLDKISSIAQETGHSAQTNRVLLDHL------SQGDSCLALFPDDNLWYRAQVIN-KSVSSVSVLFVDYGNESELDQTSVRSVPASLLEIPPQA 845          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008839.1 (pep scaffold:Pmarinus_7.0:GL476434:959:218706:-1 gene:ENSPMAG00000007915.1 transcript:ENSPMAT00000008839.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 398/925 (43.03%), Postives = 576/925 (62.27%), Query Frame = 3
Query:   93 QVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGI-ASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKI---NPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQP------KTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSG--LQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYE-STENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDD 2828
            QVLSG ++I+R + + GPPPE+ I LS + AP LARR   +   + ++ DEP+A+ AREF+R+  IG+EV + VE KAP+GREY  V+I  +    +N+ E +V  GL  VR++   GI  SN+   +L  LE+ AKA +KG W     +   R++++T+ENP  FV+S     V AIIEH+RDGCT RA +L  + +N    VTVMLSGVK P +K   +  ++PEPFA EAKFF ES+LLQR V I LE  +NQNI+G+I+HP GNI E +LKEGF R VDWSMG+         RAAE+ AKE++ R+WKDY  P              +++  ++    KV+++ N D I VK    + +   LSSIR P++      D N  ++++PLYDIP++FEAREFLRKKLIGKKVNI VDYI+        T +  ER  AT+T+G +N+AEALV KG ATV+RYR  D+ RS +YD LLAAES A K A G+HSKKE P H++ DLSG+  KA+QFL  L+R G+   IVE + SGSR+++++PKETC++T L AGI+CPR AR  P   +E ++ + NEA+ FTKE+ + REVE+E++ +DK GNFIGW+ +E        NLS+ALVE+ L++VHF+AER S+FK L  AE  AK+ K  IW       Y EQ  +  +V  V+   + +R   YK  ++T++ D   F+AQ +E    +  + + +++    +  + G++ P +GD C + F  DG WYRA++ K++    + + Y+D+GN E    + LA+LP+G  +   P QA EY+ A +    D++ +  +  +L  D+ + +  LNVEY  +T +H     V +   D  ++ G  L+++G++ V E  KEKRL  L    +  QE     R NI+ + DF ++D
Sbjct:    1 QVLSGGAIIVRGQPRGGPPPERQINLSNVRAPALARRAALSLPDARDIPDEPWAFPAREFLRKKLIGKEVCFVVEYKAPAGREYGMVYIGKADTSGENVTESLVIEGLVSVRRE---GIRTSNQDQARLCDLEDQAKAQKKGLWGEGTGSQTTRDLKYTVENPRHFVDSFHQNPVNAIIEHVRDGCTFRALLL--LPDNFM--VTVMLSGVKCPMFKREADGTETPEPFAAEAKFFTESRLLQRDVQIVLEGVSNQNILGTILHPNGNITELLLKEGFARCVDWSMGIYTQG-PDKLRAAERIAKEQKRRIWKDYVAP------------TANLDSKDKQFTAKVVQILNADAIVVKTNAAEFKTIHLSSIRPPRMEEGGGQDKN--RRLRPLYDIPYMFEAREFLRKKLIGKKVNISVDYIRAASAATDSTPAFTERTCATITIGGVNIAEALVSKGFATVLRYRQDDDQRSAHYDELLAAESRAIKNAKGLHSKKEVPIHRVADLSGDVQKAKQFLPFLQRAGRSEAIVEHVFSGSRIKLFLPKETCLITFLLAGIECPRMARNGPGGAQE-SEPYSNEAMLFTKEMVLHREVEVEVETMDKAGNFIGWLQVE------GVNLSVALVEHALSRVHFTAERSSYFKNLTVAEEAAKKAKEKIWA-----DYTEQPEEGTTVPLVE---ETERKTVYKQVVITEINDDLHFFAQDVETGAQLEKLMESMRSELAANPPLEGSFTPHRGDYCISNFA-DGEWYRARIEKVEGLSKVSVFYIDYGNRETVANAKLAALPTGYSVHSFPAQAKEYAFALIQVAEDEDAKGDTVDSLVRDVQNIQCLLNVEYRGATCDH-----VTLLYADTQDDVGLGLVKEGLVIV-EVRKEKRLAKLFTFEMLTQETCETDRANIYFFADFISED 881          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009031.1 (pep scaffold:Pmarinus_7.0:GL480172:2151:16965:1 gene:ENSPMAG00000008166.1 transcript:ENSPMAT00000009031.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.851e-8
Identity = 39/118 (33.05%), Postives = 62/118 (52.54%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKP---KKGDLCAAKFTLDGCWYRAKV--IKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
             V  V+  +RFY QL+ +E  I  + +EL +     S   G+ +P   K GDL  AK++ D  WYRA V   + D+P A+ + ++D+GN +     S++ L     + P Q+   SLA
Sbjct: 1216 FVLHVVTPSRFYVQLVSDEQTIYGLAEELND----GSVSGGSLRPSDLKLGDLICAKYSADESWYRAVVRGFEPDDPLAL-VEFIDYGNTDRVGSDSMSELHPVFLRHPRQSIACSLA 1328          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004862.1 (pep scaffold:Pmarinus_7.0:GL477964:49898:56541:1 gene:ENSPMAG00000004416.1 transcript:ENSPMAT00000004862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 2.163e-7
Identity = 30/113 (26.55%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +V  +++   FY Q  E    ++ +   +     E    P    P  G + +A+++ D  WYRA ++ + +   + + Y+DFGN E  + S L ++P  L K+P QA    L+
Sbjct:  242 VVGDLVNPGLFYCQRTEFAEELVKVMAMVACLGSEPE--PPRVSPCVGQVVSAQYSGDNVWYRAMILDVPSEDTVKVCYMDFGNCESLKVSRLRAIPHALLKLPAQALRCCLS 352          

HSP 2 Score: 48.1358 bits (113), Expect = 8.411e-6
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 3
Query: 2283 PGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLY-VDFGNEEINEESSLASLPSGLQKIPYQATEYSLAC 2507
            PG Y+P KGD+CAA F+ D  WYR  V ++D  +   L Y +D+G+ E     ++   P   +K P     Y+L C
Sbjct:   47 PG-YRPWKGDVCAALFSQDQVWYRVVVSEVDEARGCILAYFLDYGSWEEVAFENVRPPPEAFRKHP----PYTLQC 117          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004867.1 (pep scaffold:Pmarinus_7.0:GL477964:49907:56535:1 gene:ENSPMAG00000004416.1 transcript:ENSPMAT00000004867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 2.982e-7
Identity = 30/113 (26.55%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +V  +++   FY Q  E    ++ +   +     E    P    P  G + +A+++ D  WYRA ++ + +   + + Y+DFGN E  + S L ++P  L K+P QA    L+
Sbjct:  226 VVGDLVNPGLFYCQRTEFAEELVKVMAMVACLGSEPE--PPRVSPCVGQVVSAQYSGDNVWYRAMILDVPSEDTVKVCYMDFGNCESLKVSRLRAIPHALLKLPAQALRCCLS 336          

HSP 2 Score: 47.7506 bits (112), Expect = 8.405e-6
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 3
Query: 2283 PGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLY-VDFGNEEINEESSLASLPSGLQKIPYQATEYSLAC 2507
            PG Y+P KGD+CAA F+ D  WYR  V ++D  +   L Y +D+G+ E     ++   P   +K P     Y+L C
Sbjct:   44 PG-YRPWKGDVCAALFSQDQVWYRVVVSEVDEARGCILAYFLDYGSWEEVAFENVRPPPEAFRKHP----PYTLQC 114          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Match: EDO43681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU0])

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 432/927 (46.60%), Postives = 602/927 (64.94%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAP-SGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPID-------SNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNS---KEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVKQVLSGDS+I+R + K GPPPE+ + LS I AP+LARR   N +SS    DEP+AWEAREF+R   IG+EV + VE K P +GREY  +F+ N++ E +N+ E IV  GL EVR+    GI  +++  KLI LEE AK   KG+W+ ND +  +R I W++ENP  F+++H  K +PAI+EH+RDGCT+R F+LP      F H+TVMLSG+K+P +K  + +++ PEPFADEAKFF ES+LLQR+V + LE  +N N +G++IHP GNI+E +L+EGF R VDWSM VL     +  RAAEK AKEKR+R+WK+Y P               ++E+ +Q   GKVLE+ N D + V+  +G+  K  LSS+R P++ P +       +   K+ +PLYDIP++FEAREF+RKKL+GKKVN+++DYI+   D   ER  AT+T+G +NVAEALV KG  TV+R+R  D+ RS +YD LLAAE+ A K   G+HSKKEPP H++ DLSGEA KA+QFL  L+R G+ + IVEF+ASGSR+R+Y+PKETC++T L AGI CPRA R   +         D FG+EA  FTK++ MQREVE+E++ IDK GNFIGW++++      + NLS+ALVE+GL+ VHFSAER SF+ QL  AE  AK+ KL +W       Y E          V    + +R  NYK  +VT+  +   FYAQL+E    +  +  +L         +PG++  +KG++CAA+F +D  WYRAK+  + +P  + + YVD+GN E+   + L  LPS     P QA E++LA +    D +    +   L+  + +++  LNVEY++       VSV+ +  D +   G+ L+ DG + V EK KEKRL  +M++Y  AQ+ AR  RLN+W+YGDF  DD 
Sbjct:   12 IVKQVLSGDSVIIRGQPKGGPPPERQLCLSNITAPKLARRANPNVESSTATNDEPFAWEAREFLRTRLIGKEVLFSVEYKVPGTGREYGCIFLKNATGELENVTEAIVAEGLVEVRR---GGIKPSDEQTKLIDLEEIAKTQGKGRWA-NDASEHVRKINWSVENPRHFLDTHTGKEIPAIVEHVRDGCTVRLFLLPE-----FYHITVMLSGIKSPMFK-REGDKEFPEPFADEAKFFTESRLLQREVKVILEGVSNTNFLGTVIHPAGNISELLLREGFARCVDWSMAVLSKGHDI-LRAAEKLAKEKRIRIWKEYVP------------STPAIEIKDQEFSGKVLEIVNADAVVVRHPSGKDMKIHLSSVRPPRVQPKEDAELAPVAKENKRSRPLYDIPYMFEAREFMRKKLVGKKVNVKIDYIKLPNDGFPERTCATITIGGVNVAEALVSKGFVTVLRHRQDDDQRSSHYDELLAAETRAVKNGKGLHSKKEPPIHRVADLSGEAAKAKQFLPFLQRAGRSSAIVEFVASGSRMRLYLPKETCLVTFLLAGISCPRAGRIATSQGVITNMDGDAFGDEAQRFTKDMVMQREVEVEVEGIDKAGNFIGWMFVD------DKNLSVALVESGLSSVHFSAERTSFYHQLSRAEELAKQQKLKMWA-----KYEEPKD-------VVVVEETERKCNYKKIIVTEFKNELTFYAQLVETGPQLEQLMTDLNTELGSSPPLPGSFTARKGEMCAARF-VDNSWYRAKIESVKSPSEVSVFYVDYGNREVLPVTRLCPLPSAFIAFPNQAKEFTLAFVELPKDPDQAEDAMEELQKRVLNRQFLLNVEYKNGGQE--FVSVMTEGGDDV---GKSLVADGFVLV-EKRKEKRLQKMMEEYRKAQDTARTTRLNLWRYGDFTEDDA 890          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Match: EDO35934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK17])

HSP 1 Score: 64.3142 bits (155), Expect = 3.452e-12
Identity = 36/117 (30.77%), Postives = 65/117 (55.56%), Query Frame = 3
Query: 2163 ALVTQVLDGTRFYAQL--MENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNP-KAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
             LVT++++   FY QL  +++   ++ ++ ++  ++   +HV   + P+   +CAAK++  G WYRA +++  NP +   + YVDFGN E    +SL  L      +P+ A   SLA
Sbjct:    1 GLVTEIMNPGEFYIQLADLQSAQKLVALSSDMDKHYKSTNHV--EFTPEVKTVCAAKYSESGEWYRA-IVETRNPDRTAGVFYVDFGNRETLPLTSLQPLKEQFSHLPHYAYRCSLA 114          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Match: EDO44006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWP9])

HSP 1 Score: 65.855 bits (159), Expect = 5.821e-11
Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 3
Query: 2301 KKGDLCAAKFTLDGCWYRAKVIKID--NPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLA 2504
            +KG LC  ++T D  WYRA+VI ++  NP + H+ Y+D+GN+E+   + L   PS L ++P QAT   LA
Sbjct:  594 QKGMLCCGQYTEDDMWYRAQVISVESGNPLSAHVRYIDYGNDEVLPPARLRGFPSELLELPIQATRCRLA 663          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Match: EDO36108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ0])

HSP 1 Score: 65.855 bits (159), Expect = 8.612e-11
Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 2163 ALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYK-PKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDD 2528
             LVT +   ++FY Q  ++ + +  +   L+ ++        A K P+ G  C A+F+ D  WYRA V K+    +I +LYVD+GN E+   S    L     K+P QA E  L  +++  DD
Sbjct: 1057 GLVTSITSSSKFYLQDSQSASALDEVMDLLEGHYRALGEGEEALKKPQVGQFCVARFSEDDGWYRAVVTKVHG-NSIEVLYVDYGNAEVIPVSRAKILKPEFAKLPMQAVECCLHNVSSSTDD 1178          

HSP 2 Score: 62.7734 bits (151), Expect = 9.074e-10
Identity = 40/118 (33.90%), Postives = 60/118 (50.85%), Query Frame = 3
Query: 2304 KGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKIND 2657
            +G  C AKFT D  WYRA +  +++P   H+ YVDFGN E      L  +     ++P QA   S   L   P D+ R I    L  ++ DK V++ V  +++E      S+L+K+ D
Sbjct: 1919 EGKPCLAKFTEDNAWYRAVITAVEDP-TFHVRYVDFGNTECLPVDRLVPISPSFLQLPTQAVRCS---LHGFPADKSRQIV-AQLNEELKDKTVEVEVLQQTSE------SILVKLYD 2025          

HSP 3 Score: 61.2326 bits (147), Expect = 2.673e-9
Identity = 34/113 (30.09%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 2166 LVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYK-PKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSL 2501
            L+T     ++FY QL    + +  +  +++NY+   S        P  GD+C AKF+ D CWYRA V ++   K + + ++D+GN E      +  L      +P Q  E SL
Sbjct:  464 LITACQSPSKFYIQLFSMASKLEKLMMDIENYYDRLSADDEWLACPVVGDICCAKFSEDDCWYRAIVTEVQESKKVGVRFIDYGNCESLPPKHIKKLVPRFSDLPCQGIECSL 576          

HSP 4 Score: 55.4546 bits (132), Expect = 1.351e-7
Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 3
Query: 2169 VTQVLDGTRFYAQLMENENVIINITKELQNYF---MEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQ 2483
            VT V+  T+FY Q+M+    +  +   L +++    +   V    KP  G  CAA++T D  WYRA+++++     + + Y+D+GN E    + L  L S   ++P Q
Sbjct:  877 VTSVVGVTQFYCQVMKASEQLDRMMVALDDHYNTLADSQEVLTEVKP--GVCCAARYTEDDSWYRARILEVSR-NTVTVQYIDYGNSETLPNNRLKMLASKFAELPEQ 981          

HSP 5 Score: 53.5286 bits (127), Expect = 4.789e-7
Identity = 31/123 (25.20%), Postives = 54/123 (43.90%), Query Frame = 3
Query: 2151 NYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANH 2519
            +Y+  LV+       F+ QL++++  + +I   L  Y            P+ G  C A F++D  WYR  V  +     + + +VD+GN EI   S L ++      +  QA    ++C   H
Sbjct:  669 DYEDVLVSYSESPAVFWCQLLKHKAELDSIMNALHEYCANSGPKDNINSPRVGTPCCAMFSVDEGWYRGLVTGVTRANQVEVQFVDYGNSEIMPPSQLRAMKPEFMSLSAQA----ISCELEH 787          

HSP 6 Score: 52.373 bits (124), Expect = 1.352e-6
Identity = 35/118 (29.66%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 2154 YKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYK---PKKGDLCAAKFTLDGCWYRAKVIK--IDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATE 2492
            Y    +T V   + F  QL+ N   I  + +EL + + +    P   +     KG  C AKFT DGCWYRA + K   D    I + ++D+GN +    + +  L      +P Q  E
Sbjct:  226 YLDVFITSVDSPSDFSCQLIANTESIATMMEELASTYTDLG--PQDLRLLASTKGYPCCAKFTEDGCWYRALITKDLRDASGFIEVKFMDYGNIQRTPLTDVRELKDEFLSLPAQVVE 341          

HSP 7 Score: 49.6766 bits (117), Expect = 7.118e-6
Identity = 24/72 (33.33%), Postives = 41/72 (56.94%), Query Frame = 3
Query: 2316 CAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDE 2531
            C A+FT D  WYRA++ ++ +   + + Y+D+GN E    S L+ +PS   ++P QA    L  +A   D++
Sbjct: 2107 CLAQFTDDDAWYRAEIQEVKD-GGVDVRYMDYGNSEFLPLSRLSPIPSSFLELPAQAVRCGLYGVAAGTDEQ 2177          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Match: EDO26981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAI9])

HSP 1 Score: 58.9214 bits (141), Expect = 3.115e-10
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 3
Query: 2274 SHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACL 2510
            + +PG   P +GD C AKF+ D  WYRAKV+  D+  +I + Y+D+GN E      +   PS   ++P QA    L  L
Sbjct:   13 TGLPG--PPAQGDFCLAKFSFDDTWYRAKVLHCDSSFSITVQYIDYGNSETLMLDRVMEPPSQFLQLPPQALPCYLPGL 89          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:101156932])

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 416/926 (44.92%), Postives = 593/926 (64.04%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTD------SLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPS--GLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDG 2831
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR        ++  D+P+A++AREF+R+  IG+EV + VE K   GREY  V++   +   +N+AE +V  GLA VR++   G  +N +  +L  LE+ AKA++KG WS       IR++++TIENP  FV+S   K + AIIEH+RDG  +RA +LP      +  VTVMLSG+K P +K   +  +SPEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LKEGF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D + VK  +G+ +   LSSIR P+    + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T       +  ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QFL  L+R G+   +VE + SGSRL++Y+PKETC++T L AGI+CPR+AR +P    + A+ F ++A+ FTKEL +QREVE+E++++DK GNFIGW+++E        NLS+ALVEN L+KVHF+AER  ++K L  AE + ++ K  IW      +Y E+  +E     V    + +RV NY+   VT++ D   FYAQ +E    +  + + ++     H  V G+Y  ++GD C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+   + LA++P   G + +P QATEY+ A +    D++ R      +  DI + +  +N+EY S  + P    V I+  D  E+ G  L+++G++ VD + KEK L  ++ +YL++QE A+  RLNIW+YGDFR DD 
Sbjct:   22 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGVLARRAAQGQPDIKDTPDDPWAFQAREFLRKKLIGKEVCFNVEIKTALGREYGMVYLGKDTT-GENIAESLVNEGLATVRREGIRG--NNPEQARLCELEDQAKASKKGMWSEGGGTHTIRDLKYTIENPRNFVDSLHQKPINAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFKREADGTESPEPFAAEAKFFTESRLLQRDVQIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVY-TQGAEKLRAAERSAKERKIRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAMVVKLNSGEYKTIHLSSIRPPRNEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPGESTPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEHVFSGSRLKLYMPKETCLITFLLAGIECPRSARNMPGGM-QVAEPFSDQAMLFTKELVLQREVEVEVESMDKAGNFIGWLHIE------GVNLSVALVENALSKVHFTAERSPYYKTLVSAEEQCRQRKEKIWA-----NYEEKPVEEV----VHLSEEKERVPNYRPVFVTEISDNLHFYAQDVETGAQLETLMETMRAEIAAHPSVEGSYSARRGDYCLAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVVPSTRLAAMPPAFGTRTLPAQATEYTFAFIQVPLDEDARADVVDCIVRDIQNTQCMMNIEY-SGASCPH---VSIQFGDTKEDVGLGLVKEGLVMVDVR-KEKHLQKIVTEYLNSQESAKSARLNIWRYGDFRADDA 904          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:101156932])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 405/914 (44.31%), Postives = 583/914 (63.79%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTD------SLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPS--GLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLN 2795
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR        ++  D+P+A++AREF+R+  IG+EV + VE K   GREY  V++   +   +N+AE +V  GLA VR++   G  +N +  +L  LE+ AKA++KG WS       IR++++TIENP  FV+S   K + AIIEH+RDG  +RA +LP      +  VTVMLSG+K P +K   +  +SPEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LKEGF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D + VK  +G+ +   LSSIR P+    + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T       +  ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QFL  L+R G+   +VE + SGSRL++Y+PKETC++T L AGI+CPR+AR +P    + A+ F ++A+ FTKEL +QREVE+E++++DK GNFIGW+++E        NLS+ALVEN L+KVHF+AER  ++K L  AE + ++ K  IW      +Y E+  +E     V    + +RV NY+   VT++ D   FYAQ +E    +  + + ++     H  V G+Y  ++GD C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+   + LA++P   G + +P QATEY+ A +    D++ R      +  DI + +  +N+EY S  + P    V I+  D  E+ G  L+++G++ VD + KEK L  ++ +YL++QE A+  R++
Sbjct:   22 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGVLARRAAQGQPDIKDTPDDPWAFQAREFLRKKLIGKEVCFNVEIKTALGREYGMVYLGKDTT-GENIAESLVNEGLATVRREGIRG--NNPEQARLCELEDQAKASKKGMWSEGGGTHTIRDLKYTIENPRNFVDSLHQKPINAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFKREADGTESPEPFAAEAKFFTESRLLQRDVQIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVY-TQGAEKLRAAERSAKERKIRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAMVVKLNSGEYKTIHLSSIRPPRNEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPGESTPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEHVFSGSRLKLYMPKETCLITFLLAGIECPRSARNMPGGM-QVAEPFSDQAMLFTKELVLQREVEVEVESMDKAGNFIGWLHIE------GVNLSVALVENALSKVHFTAERSPYYKTLVSAEEQCRQRKEKIWA-----NYEEKPVEEV----VHLSEEKERVPNYRPVFVTEISDNLHFYAQDVETGAQLETLMETMRAEIAAHPSVEGSYSARRGDYCLAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVVPSTRLAAMPPAFGTRTLPAQATEYTFAFIQVPLDEDARADVVDCIVRDIQNTQCMMNIEY-SGASCPH---VSIQFGDTKEDVGLGLVKEGLVMVDVR-KEKHLQKIVTEYLNSQESAKSARVS 892          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Match: snd1 (staphylococcal nuclease and tudor domain containing 1 [Source:NCBI gene;Acc:101156932])

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 407/923 (44.10%), Postives = 584/923 (63.27%), Query Frame = 3
Query:   84 IVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAK--KIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTD------SLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPS--GLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRN 2822
            IVK VLSG ++I+R + + GPPPE+ I LS I A  LARR        ++  D+P+A++AREF+R+  IG+EV + VE K   GREY  V++   +   +N+AE +V  GLA VR++   G  +N +  +L  LE+ AKA++KG WS       IR++++TIENP  FV+S   K + AIIEH+RDG  +RA +LP      +  VTVMLSG+K P +K   +  +SPEPFA EAKFF ES+LLQR V I LE+  NQ I+G+I+HP GNI E +LKEGF R VDWSM V  +  A   RAAE+ AKE+++R+WKDY  P              +++  ++  V KV++V N D + VK  +G+ +   LSSIR P+    + N  K  + +PLYDIP++FEAREFLRKKLIGKKVN+ VDYI+  T       +  ER  ATVT+G +N+AEALV KGLATVIRYR  D+ RS +YD LLAAE+ A K   G+HSKKE P H++ D+SGE  KA+QFL  L+R G+   +VE + SGSRL++Y+PKETC++T L AGI+CPR+AR +P    + A+ F ++A+ FTKEL +QREVE+E++++DK GNFIGW+++E        NLS+ALVEN L+KVHF+AER  ++K L  AE + ++ K  IW      +Y E+  +E     V    + +RV NY+   VT++ D   FYAQ +E    +  + + ++     H  V G+Y  ++GD C AKF  DG WYRA+V K+++P  +H+ Y+D+GN E+   + LA++P   G + +P QATEY+ A +    D++ R      +  DI + +  +N+EY S  + P    V I+  D  E+ G  L+++G++ VD + KEK L  ++ +YL++QE A+  R   W+     N
Sbjct:   22 IVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGVLARRAAQGQPDIKDTPDDPWAFQAREFLRKKLIGKEVCFNVEIKTALGREYGMVYLGKDTT-GENIAESLVNEGLATVRREGIRG--NNPEQARLCELEDQAKASKKGMWSEGGGTHTIRDLKYTIENPRNFVDSLHQKPINAIIEHVRDGSVVRALLLP-----DYYLVTVMLSGIKCPTFKREADGTESPEPFAAEAKFFTESRLLQRDVQIILESCPNQIILGTILHPNGNITELLLKEGFARCVDWSMAVY-TQGAEKLRAAERSAKERKIRIWKDYVAP------------TANLDQKDRQFVAKVMQVVNADAMVVKLNSGEYKTIHLSSIRPPRNEGEEKNKDKDKRFRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRAATGPGESTPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGETQKAKQFLPFLQRAGRSEAVVEHVFSGSRLKLYMPKETCLITFLLAGIECPRSARNMPGGM-QVAEPFSDQAMLFTKELVLQREVEVEVESMDKAGNFIGWLHIE------GVNLSVALVENALSKVHFTAERSPYYKTLVSAEEQCRQRKEKIWA-----NYEEKPVEEV----VHLSEEKERVPNYRPVFVTEISDNLHFYAQDVETGAQLETLMETMRAEIAAHPSVEGSYSARRGDYCLAKFA-DGEWYRARVEKVESPAKVHVFYIDYGNREVVPSTRLAAMPPAFGTRTLPAQATEYTFAFIQVPLDEDARADVVDCIVRDIQNTQCMMNIEY-SGASCPH---VSIQFGDTKEDVGLGLVKEGLVMVDVR-KEKHLQKIVTEYLNSQESAKSARKK-WRLNGLHN 900          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Match: si:dkeyp-93d12.1 (tudor domain-containing protein 15 [Source:NCBI gene;Acc:101169997])

HSP 1 Score: 62.003 bits (149), Expect = 3.576e-9
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 2151 NYKSALVTQVLDGTRFYAQLMENENVIINITKELQ--NYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSG---LQKIPYQATEYSLACLANHP--DDEYRYISKCALENDIS 2573
            N +   VT V     FY QL  N   +    KEL      +  S  P  +   +   C AK+ LDG WYR  V++   P  + + +VD+GN  I E++++A++P+    L   P QA + +L  ++N P   D   ++   AL+  ++
Sbjct:  883 NRERVYVTHVSSQREFYCQLGNNTGAM----KELDRVTTVLCESGQPSGWDGVQKKPCLAKY-LDGKWYRCSVLRAAAPPYVFVFFVDYGNTYICEKNNIAAIPAACRCLLDTPMQALKCNLVAVSNRPLCADAKGWLMDAALDRSMT 1025          
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Match: si:dkeyp-93d12.1 (tudor domain-containing protein 15 [Source:NCBI gene;Acc:101169997])

HSP 1 Score: 62.003 bits (149), Expect = 3.738e-9
Identity = 43/148 (29.05%), Postives = 71/148 (47.97%), Query Frame = 3
Query: 2151 NYKSALVTQVLDGTRFYAQLMENENVIINITKELQ--NYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSG---LQKIPYQATEYSLACLANHP--DDEYRYISKCALENDIS 2573
            N +   VT V     FY QL  N   +    KEL      +  S  P  +   +   C AK+ LDG WYR  V++   P  + + +VD+GN  I E++++A++P+    L   P QA + +L  ++N P   D   ++   AL+  ++
Sbjct:  849 NRERVYVTHVSSQREFYCQLGNNTGAM----KELDRVTTVLCESGQPSGWDGVQKKPCLAKY-LDGKWYRCSVLRAAAPPYVFVFFVDYGNTYICEKNNIAAIPAACRCLLDTPMQALKCNLVAVSNRPLCADAKGWLMDAALDRSMT 991          
BLAST of Staphylococcal nuclease domain-containing protein vs. Planmine SMEST
Match: SMESG000062403.1 (SMESG000062403.1)

HSP 1 Score: 1893.24 bits (4903), Expect = 0.000e+0
Identity = 921/926 (99.46%), Postives = 924/926 (99.78%), Query Frame = 3
Query:   60 MSSSFKSLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDGPL 2837
            MSSSFKSLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWT+ENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSN AKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQS QEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQ+YFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAI+LLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDGPL
Sbjct:    1 MSSSFKSLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPVANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFIANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAARKGKWSLNDPNLAIRNIQWTMENPIQFVESHQNKTVPAIIEHIRDGCTLRAFILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESKLLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLPSNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQSLVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNSAKKIKPLYDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMNVAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEPPSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETCILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEIDNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQLCEAEVKAKETKLNIWTVDGEMSYLEQSLQEASVNGVKKENQVDRVVNYKSALVTQVLDGTRFYAQLMENENVIINITKELQSYFMEHSHVPGAYKPKKGDLCAAKFTLDGCWYRAKVIKIDNPKAINLLYVDFGNEEINEESSLASLPSGLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYESTENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYLSAQEEARLKRLNIWKYGDFRNDDGPL 926          
The following BLAST results are available for this feature:
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SND10.000e+045.74staphylococcal nuclease and tudor domain containin... [more]
SND11.117e-4757.64staphylococcal nuclease and tudor domain containin... [more]
STK319.870e-929.66serine/threonine kinase 31 [Source:HGNC Symbol;Acc... [more]
TDRD16.936e-831.25tudor domain containing 1 [Source:HGNC Symbol;Acc:... [more]
STK317.133e-826.29serine/threonine kinase 31 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsn-10.000e+042.03Staphylococcal nuclease domain-containing protein ... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tudor-SN0.000e+043.13gene:FBgn0035121 transcript:FBtr0332107[more]
Tudor-SN0.000e+043.13gene:FBgn0035121 transcript:FBtr0072519[more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snd10.000e+045.91staphylococcal nuclease and tudor domain containin... [more]
snd15.783e-17849.30staphylococcal nuclease and tudor domain containin... [more]
tdrd11.502e-827.22tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
tdrd11.673e-826.23tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
tdrd11.673e-826.23tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan110.000e+043.00tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785... [more]
tspan110.000e+042.73tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785... [more]
tspan110.000e+042.86tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785... [more]
tspan110.000e+040.90tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785... [more]
tspan110.000e+041.02tetraspanin 11 [Source:Xenbase;Acc:XB-GENE-6035785... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snd10.000e+045.63staphylococcal nuclease and tudor domain containin... [more]
Snd10.000e+049.92staphylococcal nuclease and tudor domain containin... [more]
Snd13.878e-2145.92staphylococcal nuclease and tudor domain containin... [more]
Tdrd13.304e-931.62tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Tdrd13.304e-931.62tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5REU4|SND1_PONAB0.000e+045.95Staphylococcal nuclease domain-containing protein ... [more]
sp|Q78PY7|SND1_MOUSE0.000e+045.63Staphylococcal nuclease domain-containing protein ... [more]
sp|Q7KZF4|SND1_HUMAN0.000e+045.74Staphylococcal nuclease domain-containing protein ... [more]
sp|Q66X93|SND1_RAT0.000e+045.64Staphylococcal nuclease domain-containing protein ... [more]
sp|Q863B3|SND1_BOVIN0.000e+045.52Staphylococcal nuclease domain-containing protein ... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433U9X20.000e+049.03Staphylococcal nuclease domain-containing protein ... [more]
A0A1S3IS830.000e+049.62Staphylococcal nuclease domain-containing protein ... [more]
K1R5120.000e+047.61Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A2C9JNE90.000e+048.70Staphylococcal nuclease domain-containing protein ... [more]
A0A126Q9D50.000e+047.01Staphylococcal nuclease domain-containing protein ... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snd10.000e+045.21staphylococcal nuclease and tudor domain containin... [more]
snd10.000e+044.67staphylococcal nuclease and tudor domain containin... [more]
stk315.315e-932.41serine/threonine kinase 31 [Source:NCBI gene;Acc:1... [more]
stk316.197e-932.41serine/threonine kinase 31 [Source:NCBI gene;Acc:1... [more]
si:ch211-189e2.36.030e-831.93tudor domain-containing protein 6-like [Source:NCB... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008839.10.000e+043.03pep scaffold:Pmarinus_7.0:GL476434:959:218706:-1 g... [more]
ENSPMAT00000009031.11.851e-833.05pep scaffold:Pmarinus_7.0:GL480172:2151:16965:1 ge... [more]
ENSPMAT00000004862.12.163e-726.55pep scaffold:Pmarinus_7.0:GL477964:49898:56541:1 g... [more]
ENSPMAT00000004867.12.982e-726.55pep scaffold:Pmarinus_7.0:GL477964:49907:56535:1 g... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436810.000e+046.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359343.452e-1230.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440065.821e-1142.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361088.612e-1131.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269813.115e-1037.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snd10.000e+044.92staphylococcal nuclease and tudor domain containin... [more]
snd10.000e+044.31staphylococcal nuclease and tudor domain containin... [more]
snd10.000e+044.10staphylococcal nuclease and tudor domain containin... [more]
si:dkeyp-93d12.13.576e-929.05tudor domain-containing protein 15 [Source:NCBI ge... [more]
si:dkeyp-93d12.13.738e-929.05tudor domain-containing protein 15 [Source:NCBI ge... [more]
back to top
BLAST of Staphylococcal nuclease domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062403.10.000e+099.46SMESG000062403.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002454 ID=SMED30002454|Name=Staphylococcal nuclease domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2991bp
CAATTGTGTATCCACTTTTTTAAAGAATAAGTGACGTTTTATTGGTTGTC
AAAATTTAAATGTCATCATCATTCAAAAGTCTTATTGTAAAACAAGTTCT
CTCGGGAGATTCATTAATTCTAAGAGATAGATCGAAGACTGGACCACCTC
CAGAAAAAGTTATTGCTCTTAGTGGTATTATTGCACCAAGATTAGCAAGG
CGACCAGTAGCTAATAGTGATAGCAGCGAAAATTTAGTGGATGAACCTTA
CGCTTGGGAGGCTCGAGAATTCATAAGACAATTATGCATTGGGCAAGAAG
TGTGGTATCAAGTAGAAAATAAAGCACCAAGTGGTAGAGAATATGCAACT
GTTTTTATAGCTAATAGTTCCAACGAAAAAGATAATCTAGCTGAATTAAT
AGTTGAAGCTGGTTTAGCAGAAGTCCGTAAGCAAACAAATGCTGGAATAG
CTTCTAATGAGCAATATCAAAAGTTAATATTTCTTGAAGAAGCAGCTAAG
GCAGCACGAAAGGGGAAATGGAGTTTAAATGATCCTAATTTAGCTATCAG
AAACATTCAATGGACTATTGAGAATCCCATTCAATTTGTAGAAAGTCATC
AAAATAAAACTGTTCCAGCTATAATCGAACACATACGTGATGGTTGCACA
CTGAGGGCTTTCATTCTACCACTTATCGGTGAAAATATCTTTAGACACGT
TACAGTTATGTTATCTGGAGTTAAAACTCCTGGTTATAAGTTAACAGATA
ATAATGAACAATCGCCAGAACCCTTTGCCGATGAAGCAAAATTTTTTGTT
GAATCAAAATTATTGCAACGTAAAGTAGATATTAGATTAGAAACCACGAA
CAATCAAAATATTGTTGGTTCCATTATCCATCCCAAAGGCAATATTGCTG
AATTTGTATTAAAAGAAGGTTTTGGAAGGATTGTTGATTGGAGTATGGGA
GTCTTACCCTCAAATGTCGCTATGTCTTATAGAGCTGCTGAAAAACAAGC
AAAGGAAAAAAGGTTACGATTATGGAAAGATTACGAACCTCCTAAAAATA
TTACTGAGCTAAGTCCTATTAACGGACGTGCAAATTCAATGGAATTAAGC
AATCAGTCTTTAGTTGGAAAAGTCTTAGAAGTTGGAAATGGAGACAATAT
TTCTGTCAAATGCATTAATGGACAAGTTAGAAAATTTTTTCTTTCCAGTA
TTAGATCTCCAAAAATTAATCCGATTGATTCTAATCCCGCTAAAAAAATA
AAGCCATTGTATGATATTCCTCATTTATTTGAAGCTAGAGAGTTTTTAAG
AAAGAAATTAATTGGAAAGAAGGTTAATATTAGAGTTGATTATATTCAAC
CAAAAACTGACAGTCTAGAAGAAAGAGTTATGGCAACAGTTACCGTTGGA
GAAATGAATGTTGCGGAAGCCCTTGTTTTAAAAGGATTAGCTACTGTTAT
TCGGTATCGTGCATCAGATGAAAATAGATCATTATATTATGATGCATTAT
TGGCAGCTGAAAGCACTGCCCAAAAAAAAGCCGTTGGTGTTCATTCAAAG
AAAGAACCGCCCAGTCATAAAATATGTGATTTATCTGGGGAGGCTAACAA
GGCTAGACAGTTTTTGTCTTCTCTTAAACGACAAGGCAAATTAAATGGTA
TTGTGGAATTTATTGCTAGTGGCAGTCGTCTTAGAGTTTATATACCTAAA
GAAACATGTATTTTGACCATTCTTTGTGCTGGTATTGATTGTCCTAGAGC
AGCAAGGCGTTTACCTAATAGTAAAGAAGAAGCAGCTGACTTATTTGGAA
ATGAAGCGCTTAATTTTACAAAGGAATTATGCATGCAGCGAGAAGTGGAA
ATCGAAATAGATAATATCGACAAGGGAGGAAATTTCATCGGCTGGGTGTA
TATGGAATCGCCGGAAAATGGCATAAATTCCAATTTAAGTATAGCTCTAG
TGGAAAATGGATTGGCCAAAGTGCATTTCTCAGCTGAACGTTTAAGTTTT
TTCAAGCAGTTGTGTGAAGCTGAAGTGAAAGCAAAAGAAACGAAGCTTAA
TATATGGACTGTCGATGGAGAAATGAGTTATCTGGAACAAAGTTCACAAG
AAGCTAGTGTTAACGGAGTTAAAAAAGAGAATCAGGTTGATCGGGTTGTT
AATTATAAAAGTGCTCTTGTTACGCAAGTACTCGATGGAACAAGGTTTTA
TGCACAGTTAATGGAAAATGAAAACGTTATTATCAATATCACAAAAGAAC
TCCAAAATTACTTTATGGAACATTCTCATGTTCCCGGAGCATATAAACCT
AAGAAAGGTGACTTGTGCGCCGCTAAGTTTACTCTGGATGGTTGCTGGTA
TCGAGCTAAAGTCATTAAGATCGATAATCCTAAAGCTATCCACTTATTGT
ATGTGGATTTTGGAAATGAGGAAATCAATGAAGAGTCATCTTTAGCGTCT
CTTCCTAGTGGTCTTCAGAAAATCCCTTACCAAGCTACAGAATACAGTTT
AGCTTGTTTGGCCAATCATCCCGATGATGAATATAGGTATATTTCAAAAT
GCGCTTTGGAAAATGATATTTCTGATAAAGAGGTGAAATTGAATGTTGAA
TACGAATCCACCGAAAACCATCCTCGAGGAGTGTCAGTTTTGATTAAAAT
CAACGATAAATTGGAAAACGAAGGTGAAATGCTTTTGCGTGATGGAATTC
TCTATGTGGATGAAAAGCACAAGGAGAAAAGACTTGTTGATTTAATGAAG
CAATATCTTAGTGCTCAAGAAGAAGCTCGACTGAAACGGTTAAATATTTG
GAAATATGGGGATTTCAGAAATGACGACGGACCTTTGTAAATTAATTTTA
ATGTGCCTATTCTTTTGGTGCTTGTTTTTATATTTGATCGGTGATAAATA
CTATCATAATTTTTTATGTTGATGTGCGTTAATCGAATTCAGCCTTTAAA
TGTGATCATTTAATAAAATAATTGCGTGACTTTTAAAAAAA
back to top

protein sequence of SMED30002454-orf-1

>SMED30002454-orf-1 ID=SMED30002454-orf-1|Name=SMED30002454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=927bp
MSSSFKSLIVKQVLSGDSLILRDRSKTGPPPEKVIALSGIIAPRLARRPV
ANSDSSENLVDEPYAWEAREFIRQLCIGQEVWYQVENKAPSGREYATVFI
ANSSNEKDNLAELIVEAGLAEVRKQTNAGIASNEQYQKLIFLEEAAKAAR
KGKWSLNDPNLAIRNIQWTIENPIQFVESHQNKTVPAIIEHIRDGCTLRA
FILPLIGENIFRHVTVMLSGVKTPGYKLTDNNEQSPEPFADEAKFFVESK
LLQRKVDIRLETTNNQNIVGSIIHPKGNIAEFVLKEGFGRIVDWSMGVLP
SNVAMSYRAAEKQAKEKRLRLWKDYEPPKNITELSPINGRANSMELSNQS
LVGKVLEVGNGDNISVKCINGQVRKFFLSSIRSPKINPIDSNPAKKIKPL
YDIPHLFEAREFLRKKLIGKKVNIRVDYIQPKTDSLEERVMATVTVGEMN
VAEALVLKGLATVIRYRASDENRSLYYDALLAAESTAQKKAVGVHSKKEP
PSHKICDLSGEANKARQFLSSLKRQGKLNGIVEFIASGSRLRVYIPKETC
ILTILCAGIDCPRAARRLPNSKEEAADLFGNEALNFTKELCMQREVEIEI
DNIDKGGNFIGWVYMESPENGINSNLSIALVENGLAKVHFSAERLSFFKQ
LCEAEVKAKETKLNIWTVDGEMSYLEQSSQEASVNGVKKENQVDRVVNYK
SALVTQVLDGTRFYAQLMENENVIINITKELQNYFMEHSHVPGAYKPKKG
DLCAAKFTLDGCWYRAKVIKIDNPKAIHLLYVDFGNEEINEESSLASLPS
GLQKIPYQATEYSLACLANHPDDEYRYISKCALENDISDKEVKLNVEYES
TENHPRGVSVLIKINDKLENEGEMLLRDGILYVDEKHKEKRLVDLMKQYL
SAQEEARLKRLNIWKYGDFRNDDGPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004521endoribonuclease activity
GO:0003676nucleic acid binding
GO:0004518nuclease activity
Vocabulary: biological process
TermDefinition
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0031047gene silencing by RNA
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035437SNase_OB-fold_sf
IPR002999Tudor
IPR016685Silence_cplx_Nase-comp_TudorSN
IPR016071Staphylococal_nuclease_OB-fold
Vocabulary: cellular component
TermDefinition
GO:0016442RISC complex
GO:0005634nucleus
GO:0005737cytoplasm
GO:0042470melanosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 745..803
e-value: 2.5E-12
score: 57.0
IPR002999Tudor domainPFAMPF00567TUDORcoord: 698..815
e-value: 7.3E-23
score: 80.9
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 746..805
score: 16.527
IPR016071Staphylococcal nuclease (SNase-like), OB-foldSMARTSM00318SNASE_2coord: 7..156
e-value: 7.0E-31
score: 118.6
coord: 183..324
e-value: 1.3E-34
score: 131.0
coord: 526..668
e-value: 1.8E-36
score: 137.2
coord: 349..497
e-value: 2.1E-29
score: 113.7
IPR016071Staphylococcal nuclease (SNase-like), OB-foldPFAMPF00565SNasecoord: 378..494
e-value: 2.3E-11
score: 44.1
coord: 554..667
e-value: 1.5E-17
score: 64.0
coord: 35..155
e-value: 8.8E-12
score: 45.5
coord: 215..324
e-value: 2.8E-11
score: 43.9
IPR016071Staphylococcal nuclease (SNase-like), OB-foldPROSITEPS50830TNASE_3coord: 4..156
score: 28.546
IPR016071Staphylococcal nuclease (SNase-like), OB-foldPROSITEPS50830TNASE_3coord: 526..668
score: 28.527
IPR016071Staphylococcal nuclease (SNase-like), OB-foldPROSITEPS50830TNASE_3coord: 349..497
score: 25.985
IPR016071Staphylococcal nuclease (SNase-like), OB-foldPROSITEPS50830TNASE_3coord: 183..324
score: 27.132
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 174..333
e-value: 3.4E-39
score: 135.7
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 506..666
e-value: 1.3E-55
score: 189.1
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 703..917
e-value: 2.4E-52
score: 180.0
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 348..505
e-value: 3.7E-45
score: 155.4
IPR035437SNase-like, OB-fold superfamilyGENE3DG3DSA:2.40.50.90coord: 3..173
e-value: 9.2E-43
score: 147.5
IPR016685RNA-induced silencing complex, nuclease component Tudor-SNPIRSFPIRSF017179RISC-Tudor-SNcoord: 1..926
e-value: 1.3E-283
score: 940.5
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 718..809
e-value: 2.4E-52
score: 180.0
NoneNo IPR availablePANTHERPTHR12302EBNA2 BINDING PROTEIN P100coord: 9..923
NoneNo IPR availablePANTHERPTHR12302:SF2LD20211Pcoord: 9..923
NoneNo IPR availableCDDcd00175SNccoord: 13..155
e-value: 3.13742E-30
score: 113.909
NoneNo IPR availableCDDcd00175SNccoord: 534..666
e-value: 1.78774E-30
score: 114.679
NoneNo IPR availableCDDcd04508TUDORcoord: 750..789
e-value: 5.14111E-15
score: 67.6231
NoneNo IPR availableSUPERFAMILYSSF50199Staphylococcal nucleasecoord: 522..667
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 724..817
NoneNo IPR availableSUPERFAMILYSSF50199Staphylococcal nucleasecoord: 756..922
NoneNo IPR availableSUPERFAMILYSSF50199Staphylococcal nucleasecoord: 347..501
NoneNo IPR availableSUPERFAMILYSSF50199Staphylococcal nucleasecoord: 179..328
NoneNo IPR availableSUPERFAMILYSSF50199Staphylococcal nucleasecoord: 9..159