Multidrug and toxin extrusion protein

Overview
NameMultidrug and toxin extrusion protein
Smed IDSMED30002443
Length (bp)1450
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug and toxin extrusion protein (SMED30002443) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug and toxin extrusion protein (SMED30002443) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multidrug and toxin extrusion protein (SMED30002443) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multidrug and toxin extrusion protein (SMED30002443) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002443

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30002443SMESG000080004.1 SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000076091.1 SMESG000070563.1 SMESG000070487.1 SMESG000069936.1 SMESG000069843.1 SMESG000068687.1 SMESG000067323.1 SMESG000067128.1 SMESG000066411.1 SMESG000066333.1 SMESG000065178.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000062279.1 SMESG000057533.1 SMESG000057427.1 SMESG000055265.1 SMESG000053372.1 SMESG000052056.1 SMESG000051183.1 SMESG000050587.1 SMESG000050353.1 SMESG000049398.1 SMESG000048922.1 SMESG000047988.1 SMESG000047874.1 SMESG000046659.1 SMESG000045843.1 SMESG000043782.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000037212.1 SMESG000034701.1 SMESG000034367.1 SMESG000033592.1 SMESG000031778.1 SMESG000031308.1 SMESG000031049.1 SMESG000029226.1 SMESG000028811.1 SMESG000026530.1 SMESG000025956.1 SMESG000024909.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000022236.1 SMESG000021499.1 SMESG000019820.1 SMESG000018414.1 SMESG000017989.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000006220.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig5461GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30002443SMESG000033099.1 Contig5461GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
tail regionSMED30002443SMESG000033099.1 dd_Smed_v6_11031_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 126.331 bits (316), Expect = 1.607e-30
Identity = 115/383 (30.03%), Postives = 183/383 (47.78%), Query Frame = 2
Query:   47 RNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDW--------KHQAYLAQRRILYCSVKKTRDGTESLI-------SSVHLSVDNVKTSPSHV---RTP--SHPITCSTAIVVLSKPRLKVDKSIIWK 1135
            R  + L +   WP V++   GN  N  +    VS L  G + SA  +  S     +  ++YI   K +L TW G+  + L DWG  F L +  +  I  E   +E   F+ GLL  V+L+ Q+++ +V  + +M+  G +I   +R+G  LGA    QAK +  +G  +I   ++VLGT I +L+NQ+  +FTN ++VI  + +V+P   +    ++   V+   LRG G+Q  G  +  I++YI+ LPL I+L FV  M I G+WLG      ++  A        DW        KH     Q+R        TR G E  +       SS  +++     S  HV   RTP  +H ++  T+       RL V + +I +
Sbjct:  206 RASFHLFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQR---AESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTS-------RLSVKQLVIRR 578          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 115.546 bits (288), Expect = 6.327e-27
Identity = 113/386 (29.27%), Postives = 179/386 (46.37%), Query Frame = 2
Query:   80 WPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVY--------------YGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDW--------KHQAYLAQRRILYCSVKKTRDGTESLI-------SSVHLSVDNVKTSPSHV---RTP--SHPITCSTAIVVLSKPRLKVDKSIIWK 1135
            WP V++   GN  N  +    VS L  G + SA  +  S     +  ++YI   K +L TW G+  + L DWG  F L +  +  I  E   +E   F+ GLL  V+L+ Q+++ +V  + +M +               G +I   +R+G  LGA    QAK +  +G  +I   ++VLGT I +L+NQ+  +FTN ++VI  + +V+P   +    ++   V+   LRG G+Q  G  +  I++YI+ LPL I+L FV  M I G+WLG      ++  A        DW        KH     Q+R        TR G E  +       SS  +++     S  HV   RTP  +H ++  T+       RL V + +I +
Sbjct:  181 WPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMRHSHRLAYAAHVTRIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQR---AESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTS-------RLSVKQLVIRR 556          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 97.4413 bits (241), Expect = 5.622e-21
Identity = 81/301 (26.91%), Postives = 147/301 (48.84%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQ 937
             + L+  Y L +G + P ++     N+ N  +  LF+  L  G   SA+ +  S   +AL+  +YI   K + ATW G+ LE L DW S   L +  +  +  E   +E   F+ G+LG VEL  QSI+ ++  +++MV  G ++A ++R+G  LGA    QA+ +         +  +     ++  ++ +  +FT  +++I+ + +V+P   +    ++ +      LRG G Q  G I+  I +Y++ LP+ I L F   + + G+W G  I +V   +     +   +WK     AQ
Sbjct:  170 LYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQ 470          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 97.4413 bits (241), Expect = 5.946e-21
Identity = 81/301 (26.91%), Postives = 147/301 (48.84%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQ 937
             + L+  Y L +G + P ++     N+ N  +  LF+  L  G   SA+ +  S   +AL+  +YI   K + ATW G+ LE L DW S   L +  +  +  E   +E   F+ G+LG VEL  QSI+ ++  +++MV  G ++A ++R+G  LGA    QA+ +         +  +     ++  ++ +  +FT  +++I+ + +V+P   +    ++ +      LRG G Q  G I+  I +Y++ LP+ I L F   + + G+W G  I +V   +     +   +WK     AQ
Sbjct:  170 LYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQ 470          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 95.5153 bits (236), Expect = 1.624e-20
Identity = 64/242 (26.45%), Postives = 119/242 (49.17%), Query Frame = 2
Query:   26 SKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAG 751
            +   + L+  Y L +G + P ++     N+ N  +  LF+  L  G   SA+ +  S   +AL+  +YI   K + ATW G+ LE L DW S   L +  +  +  E   +E   F+ G+LG VEL  QSI+ ++  +++MV  G ++A ++R+G  LGA    QA+ +         +  +     ++  ++ +  +FT  +++I+ + +V+P   +    ++ +      LRG G Q  G
Sbjct:  144 ATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVG 385          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: BX248108.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:560089])

HSP 1 Score: 122.479 bits (306), Expect = 1.891e-29
Identity = 106/406 (26.11%), Postives = 190/406 (46.80%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVM-PFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKH--QAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPIT-----CSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFL 1201
            +M    +   ++L+  Y   +G +WP VI    GNI N     +F+  L  G   SA  +A S   +A+I   YI     + ATW G+  + L +WGS   L L  +  +  E   +E   F+ GL+  VEL  QSI+ ++  +++M   G A+A  +R+G  LGA    QAKL+ +       + + V+   I    N I  +F+  ++++  + +VM  + F+ L+ D+ S++    +RG G+Q  G +   + +Y +  P+ + L F FNM I G+W+G      +  L   IL+   DWK   Q  L +  +    +K    G E+   +   + +N +   +   T    ++      + A+ +++   +   K +  +R +   F+ L L  GI ++  L
Sbjct:  177 FMPALPATFMYQLQGLYLQNQGIIWPQVITGAAGNILNALINYVFLYLLDLGVPGSAAANAISQYSLAVILYTYIRCMGLHKATWDGWSWDCLQEWGSFIRLALPSMLMLCAEWWTYEIGGFLAGLISEVELGAQSIVYELASVMYMFPLGFAVAAGVRVGNALGAGNTEQAKLSAKVSLVCGLLVSSVIAVVIAGTNNIIGYIFSKDEDIVLRVSQVMVMYGFVHLF-DATSAITGGIVRGAGKQQIGALCNMVGYYCVGFPIGVSLMFAFNMGIVGLWIGFFTCVFLQSLFFIILIYRLDWKKATQEALIRAGVQLTEIKYESFGLENKGCTEEAAQENTEEGQTDTNTDLEGLSKGEGGITDAVALVTVGEVLTAKQLAVRRGLAFFFMLLILTGGIVLNEVL 581          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a2.1 (solute carrier family 47 member 2.1 [Source:NCBI gene;Acc:560024])

HSP 1 Score: 108.612 bits (270), Expect = 8.013e-25
Identity = 85/327 (25.99%), Postives = 153/327 (46.79%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTES 988
            +M    +   ++L+  Y   +G +WP VI    GNI N     +F+  L+ G   SA  +  S   +A+   +YI     + ATW G+  + L +WG+   L L  +  +  E   +E   F+ GL+   EL  QS++ ++  + +M   G A+A ++R+G  LGA    +AKL+ +       + + V+ T I   ++ I  +FT ++ ++  + +VM         D+ + +    +RG G+Q+ G +   + +Y +  P  + L F  +M I G+W+G      +  L   IL+   DWK      Q  ++   V+ T    ES
Sbjct:  179 FMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWSRDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLFFIILIYKLDWKKA---TQEALIRAGVQLTETKDES 502          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 105.531 bits (262), Expect = 7.655e-24
Identity = 84/292 (28.77%), Postives = 139/292 (47.60%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            +G  WP VI     NI N     + +  L  G + SA  +  S   +A I  IYI     Y  TW G+ ++ L +W S  YL +  +  +  E   +E    + GL+  VEL  QS++  +  + +M   G +IA ++R+G  +GA   +QAKL+ +          +VL T I   +N I  +FTN +++I  +  VM         D+ ++  S+ ++G G+Q  G I   + +Y +  P+ I L F   M I G+W+G  +   +  +   +LL   +WK  +  AQ R
Sbjct:  178 QGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSMDCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTAAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWKKASEEAQIR 469          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 99.7525 bits (247), Expect = 2.064e-22
Identity = 81/286 (28.32%), Postives = 135/286 (47.20%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQA 925
            +G  WP VI     NI N     + +  L  G + SA  +  S   +A I  IYI     Y  TW G+ ++ L +W S  YL +  +  +  E   +E    + GL+  VEL  QS++  +  + +M   G +IA ++R+G  +GA   +QAKL+ +          +VL T I   +N I  +FTN +++I  +  VM         D+ +   S+ ++G G+Q  G I   + +Y +  P+ I L F   M I G+W+G  +   +  +   +LL   +WK  +
Sbjct:  101 QGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSMDCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTVAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWKKAS 386          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Match: slc47a1 (solute carrier family 47 member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-20])

HSP 1 Score: 93.2041 bits (230), Expect = 1.180e-19
Identity = 60/225 (26.67%), Postives = 110/225 (48.89%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQ 742
            +G + P +  A   NI N+ +  + +  ++ G K SA  ++ S   + L+   YI   K +L TW G+   +L +WGS   L +     + FE  I+E   F+ G+LG V+LA Q +L+++  + +M   G   A  +R+G  LGA    +A +  +       I     G  I L ++++  +FT+ ++++  + + +     L + D+   V S  L G G+Q
Sbjct:  193 QGIILPQMYTAVAANILNVATNYILLHAMKLGVKGSAAANSISQITICLLLFAYIRWKKLHLKTWGGWSTASLQEWGSYMKLAIPSTLMLCFEWWIYEIGGFLAGMLGEVDLAAQHVLLEIGSIAYMFPLGVHAAACVRVGNALGAGDTVRALITSKVTLMISGILAFAQGIGIALTKSKLGYIFTSDESIVAIVSQNLTLYVFLQFFDALVCVCSGILLGAGKQ 417          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: tmed6 (transmembrane p24 trafficking protein 6 [Source:Xenbase;Acc:XB-GENE-967876])

HSP 1 Score: 115.931 bits (289), Expect = 4.226e-27
Identity = 97/345 (28.12%), Postives = 155/345 (44.93%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKK---TRDGTESLISSVHLSVDNVKTSPSHVRTPSH 1060
            FF L   Y   +G +WP V+ +F   I N     + +  L+ G   +A+    S     +I   YI+  K ++ TWPG+  E L DWGS F L L  +  ++ +   +E  + + GL+  VEL  QSI+ Q++ LL  +    ++A  IR+G  LGA    QAK + R      A    +    +I LR +I  +FTN  +++  +  +MP   +     S  ++F   LRG G Q  G  +    + ++  P+++ L F   + +KG W G   G  V  +   I L   +WK     A  R     +K+   T      + SS H  ++N  T  S      H
Sbjct:  163 FFNLEIRYLQNQGIIWPQVVVSFLACIINGILNYVLLFVLKIGVIGAAIAVTVSIVSKVIILFFYIWIRKIHVDTWPGWTKECLKDWGSFFALALPTMIMLSLKWWTFEIAIILSGLINLVELGGQSIMHQIMNLLNKISLALSLASCIRVGTYLGAGETEQAKRSARLSFVISAFPVFLGVGLLIGLRREIASIFTNDSSILFLVSDIMPLCAVFQIVGSACNLFYGILRGIGMQKVGAFVTVGGYLLIVFPMAVPLMFPAKLGVKGFWTGINAGLAVMDIVFVIYLWKANWKLITEKALERAGLKELKEKGPTALEANGIASSDHFELNNYDTMNSAFIGEQH 507          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: slc47a2 (solute carrier family 47 (multidrug and toxin extrusion), member 2 [Source:NCBI gene;Acc:100125051])

HSP 1 Score: 97.4413 bits (241), Expect = 5.085e-21
Identity = 85/314 (27.07%), Postives = 147/314 (46.82%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            A+Y+Q+Q                G ++P V+  F  NIFN     + +  L  G   SA  +  S  +  ++  +YI   + Y  TW G+      +WG+   L +A +  +  E   +E ++F+ G+LG V+LA Q+I+ QV  +++++  G  IA +IR+G  LGA    QAK +         +  ++ G  +  L++ +  +FT+  N++  +  V+P     L  D+  +     LRG G+   G I   + +Y++ LPL I L F   + I G W G     +   + + I +   DWK  +  AQ R
Sbjct:  190 AKYLQNQ----------------GIIYPQVLTGFIANIFNALFNYILLYVLGLGVMGSACANTVSQFIQMILLFLYIVWRRLYADTWGGWSQACFEEWGAFIRLAVASMLMLCIEWWAFEISMFLAGVLGMVDLAAQAIIYQVAIVVYLIPLGLCIAGSIRVGHGLGAGNTEQAKRSALVVLCMTELCALLSGILLATLKDVVAYIFTSDPNIVALVSYVLPVYSACLLFDACVAACGGILRGSGKLKVGAISHTVGYYVIGLPLGISLMFAAKLGIIGFWFGILACGIAQSIFLIIFVFKIDWKRASEEAQTR 487          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 94.7449 bits (234), Expect = 3.912e-20
Identity = 71/236 (30.08%), Postives = 111/236 (47.03%), Query Frame = 2
Query:   56 Y*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAK----LAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAG 751
            Y + +G ++  +I +F  NI N     +F+  L+ G   SA  +  +     L+  +YI   + ++ TW G+ +E L DW S   L +  +  +  E   +E    M GLLG VEL  QS++ QVV   +M+ +G  +A ++R+G  LGA    QAK    +A+     ++     V    +   +NQ   +FTN + V         F F+LLY      V    LRG GRQ  G
Sbjct:  184 YVIFQGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIFLYIRVKRLHVNTWGGWSIECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVTTAYMIPFGIGMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWV---------FTFLLLYLSFSFCVAGGILRGTGRQKIG 410          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 92.8189 bits (229), Expect = 1.127e-19
Identity = 85/267 (31.84%), Postives = 131/267 (49.06%), Query Frame = 2
Query:   56 Y*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAK----LAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIW 844
            Y + +G ++  +I +F  NI N     +F+  L+ G   SA  +  +     L+  +YI   + ++ TW G+ +E L DW S   L +  +  +  E   +E    M GLLG VEL  QS++ QVV   +MV   A++A ++R+G  LGA    QAK    +A+     ++     V    +   +NQ   +FTN + V         F F+LLY      V    LRG GRQ  G II  + +Y++ LPL+  L F  N+ IKGI+
Sbjct:  156 YVIFQGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIFLYIRVKRLHVNTWGGWSIECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVTTAYMV-RSASMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWV---------FTFLLLYLSFSFCVAGGILRGTGRQKIGAIINMVGYYLIGLPLAAALMFAVNIGIKGIY 412          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 100.138 bits (248), Expect = 5.373e-22
Identity = 85/364 (23.35%), Postives = 161/364 (44.23%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVD-NVKTSPSHVRTPSHPITCSTAIVVLSKPRLKVDKS 1123
             + L+  Y L +G + P ++     N+ N  +  +F+ +L  G   SA+ +  S   +A+   +YI   + + ATW G+  E L DW S   L +  +  +  E   +E   F+ G+LG VEL  QSI  ++  +++M+  G ++A N+R+G  LGA    QAK +         +  +     ++  ++ +  +FT  ++++  + +V+P   +    +  +      LRG G Q  G I+  I +Y++ LP+ I L F   + + G+W G  I +          +   +WK     AQ                     VH ++  NV  + +    P+HP+   +   ++     K D++
Sbjct:  170 LYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWKRACQQAQ---------------------VHANLKVNVALNSAVSHEPAHPVCPESHGEIMMTDLEKKDET 512          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 93.2041 bits (230), Expect = 1.093e-19
Identity = 74/314 (23.57%), Postives = 144/314 (45.86%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRD 976
             F+L+  Y   +G + P VI     N+ N+      +  L  G   SA  +  S   ++ +  +Y++  + ++ TW G+  E   +W S   L +  +  +  E   +E   F+ GL+   EL  Q+++ ++  + +MV +G  +A ++R+G  LGA    QA+ +         +  +++G  +  L++ +  +FTN +++I  + +VMP        D+ +      LRG G+Q  G ++  I +Y    P+ + L F   + I G+W G  +       +  I +   +W   A  AQ R     +K T++
Sbjct:  179 LFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQVR---AGLKSTKE 489          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 90.1225 bits (222), Expect = 6.528e-19
Identity = 57/242 (23.55%), Postives = 114/242 (47.11%), Query Frame = 2
Query:   26 SKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAG 751
            +   F+L+  Y   +G + P VI     N+ N+      +  L  G   SA  +  S   ++ +  +Y++  + ++ TW G+  E   +W S   L +  +  +  E   +E   F+ GL+   EL  Q+++ ++  + +MV +G  +A ++R+G  LGA    QA+ +         +  +++G  +  L++ +  +FTN +++I  + +VMP        D+ +      LRG G+Q  G
Sbjct:  176 AAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIG 417          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q86VL8|S47A2_HUMAN (Multidrug and toxin extrusion protein 2 OS=Homo sapiens OX=9606 GN=SLC47A2 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 7.717e-30
Identity = 115/383 (30.03%), Postives = 183/383 (47.78%), Query Frame = 2
Query:   47 RNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDW--------KHQAYLAQRRILYCSVKKTRDGTESLI-------SSVHLSVDNVKTSPSHV---RTP--SHPITCSTAIVVLSKPRLKVDKSIIWK 1135
            R  + L +   WP V++   GN  N  +    VS L  G + SA  +  S     +  ++YI   K +L TW G+  + L DWG  F L +  +  I  E   +E   F+ GLL  V+L+ Q+++ +V  + +M+  G +I   +R+G  LGA    QAK +  +G  +I   ++VLGT I +L+NQ+  +FTN ++VI  + +V+P   +    ++   V+   LRG G+Q  G  +  I++YI+ LPL I+L FV  M I G+WLG      ++  A        DW        KH     Q+R        TR G E  +       SS  +++     S  HV   RTP  +H ++  T+       RL V + +I +
Sbjct:  206 RASFHLFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGRQQQQR---AESTATRPGPEKAVLSSVATGSSPGITLTTYSRSECHVDFFRTPEEAHALSAPTS-------RLSVKQLVIRR 578          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A7KAU3|S47A2_RABIT (Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC47A2 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.468e-27
Identity = 100/314 (31.85%), Postives = 159/314 (50.64%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            A+Y+Q+Q                G +WP V++   GN  N  +    VS L  G + SA  +  S  V A    ++I   K +L TW G+  + L DWG    L +  +  +  E   +E   F+ GLLG V+L+ Q+I+ +V  +++M+  G  +A  +R+G  LGA    QAK +  +G    A T++V+GT + LL +Q+  +FT+ + VI  + +V+P   +    ++   VF   LRG G+Q  G I+  I +YI+ LPL I+L FV  M I G+WLG      ++ +   +     DWK  A  AQ+ 
Sbjct:  200 AKYLQNQ----------------GIVWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANTISQFVQAAFLFLHIVLKKLHLETWEGWSSQCLRDWGPFLSLAIPSMLMMCVEWWAYEIGSFLMGLLGVVDLSGQAIIYEVATVVYMIPMGLGMAVCVRVGTALGAADTLQAKRSAVSGLLCTAGTSLVVGTLLGLLNSQLGYIFTSDEEVIALVNQVLPIYIVFQLVEAVCCVFGGVLRGTGKQAFGAIVNAIMYYIVGLPLGIVLTFVVGMRIMGLWLGMLTCIFLAAVTFVVYAVQLDWKLAAEEAQKH 497          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q5R7E4|S47A2_PONAB (Multidrug and toxin extrusion protein 2 OS=Pongo abelii OX=9601 GN=SLC47A2 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.678e-27
Identity = 111/377 (29.44%), Postives = 174/377 (46.15%), Query Frame = 2
Query:   80 WPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVY--------------YGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR------ILYCSVKKTRDGTESLI-------SSVHLSVDNVKTSPSHV---RTPSHPITCSTAIVVLSKPRLKVDK 1120
            WP V++   GN  N  +    VS L  G + SA  +  S     +  ++YI   K +L TW G+  + L DWG  F L +  +  I  E   +E   F+ GLL  V+L+ Q+++ +V  + +M +               G +I   +R+G  LGA    QAK +  +G  +I   ++VLGT I +L+NQ+  +FTN ++VI  + +V+P   +    ++   V+   LRG G+Q  G  +  I++YI+ LPL I+L FV  M I G+WLG      ++  A        DWK  A  A++               TR G E  +       SS  +++     S  HV   RTP    T S     LS  +L + +
Sbjct:  181 WPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMRHSHHLAYTAHVARIPLGLSIGVCVRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWKLAAEEAKKHSGQQQQQQRAESTATRSGPEKAVLSSVATGSSPGITLTTYSRSECHVDLFRTPEEAHTLSAPTSRLSVKQLVIRR 557          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|Q5RFD2|S47A1_PONAB (Multidrug and toxin extrusion protein 1 OS=Pongo abelii OX=9601 GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 5.027e-24
Identity = 84/319 (26.33%), Postives = 151/319 (47.34%), Query Frame = 2
Query:   35 FFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESL 991
             + L+  Y L +G + P ++     N+ N  +  LF+  L  G   SA+ +  S   +AL+   YI   K + ATW G+ LE L DW S  +L +  +  +  E   +E   F+ G+LG VEL  QSI+ ++  +++MV  G ++A ++R+G  LGA    QA+ +         +  +     ++  ++ +  +FT  +++I+ + +V+P   +    ++ +      LRG G Q  G I+  I +Y++ LP+ I L F   + + G+W G  I +V   +     +   +WK     AQ           R G  +L
Sbjct:  170 LYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGAIGSALANLISQYTLALLLFFYILGKKLHQATWGGWSLECLQDWASFLHLAVPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATKLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSAL 488          
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Match: sp|A1L1P9|S47A1_DANRE (Multidrug and toxin extrusion protein 1 OS=Danio rerio OX=7955 GN=slc47a1 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.049e-24
Identity = 85/327 (25.99%), Postives = 153/327 (46.79%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTES 988
            +M    +   ++L+  Y   +G +WP VI    GNI N     +F+  L+ G   SA  +  S   +A+   +YI     + ATW G+  + L +WG+   L L  +  +  E   +E   F+ GL+   EL  QS++ ++  + +M   G A+A ++R+G  LGA    +AKL+ +       + + V+ T I   ++ I  +FT ++ ++  + +VM         D+ + +    +RG G+Q+ G +   + +Y +  P  + L F  +M I G+W+G      +  L   IL+   DWK      Q  ++   V+ T    ES
Sbjct:  179 FMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWSRDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLFFIILIYKLDWKKA---TQEALIRAGVQLTETKDES 502          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A0H3YKK5 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-6 PE=2 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 2.145e-160
Identity = 253/414 (61.11%), Postives = 316/414 (76.33%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTS--PSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTI 1237
            ARYMQDQ                GCLWP VIA  CGN+FNIC QLLFV+YLQ+GFK++A+CHAFSFG+M L+E +YI+KSKFYL TWPGFQLEA +DW  M  LGLAG+GH TFEV++WE +VFMGGLLG V++A QSI++Q++ + FM+YYG  IA NIR+GQCLGANRP+QAK AYRAG FN AI+TI+L T+IILLR QIPLVFTNK+ V++     MP++F++LY D FS V S TLRGC RQ++GC+IIF+SFY++SLP+SI+  FV+++ +KGIW+G T G +V+V +I +LLECQDWK+QAYLAQRRI         D TE LI S  L +DN+  +   SH+RTPSHPI CST I   S PR  ++KSIIWKR+ I G   LFLLCGIFIH F+P ELYRG+N T+
Sbjct:  190 ARYMQDQ----------------GCLWPPVIAGICGNVFNICFQLLFVTYLQFGFKSAALCHAFSFGIMTLVEALYIWKSKFYLNTWPGFQLEAFYDWFPMLKLGLAGMGHTTFEVLVWEASVFMGGLLGTVQVATQSIMIQILYISFMLYYGCGIASNIRVGQCLGANRPNQAKQAYRAGIFNTAISTIILATSIILLRYQIPLVFTNKKEVLEMTIDTMPYIFVILYCDPFSGVCSGTLRGCARQLSGCMIIFVSFYMISLPVSIVASFVYDLGVKGIWIGPTCGCIVAVSSIFLLLECQDWKNQAYLAQRRIFSKLADIENDETEKLIYS--LEIDNIAENGPDSHIRTPSHPIMCSTEIFDTSAPRTNLEKSIIWKRVAIFGCAILFLLCGIFIHLFVPLELYRGTNFTL 585          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A0H3YJN6 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-7 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.714e-46
Identity = 134/422 (31.75%), Postives = 213/422 (50.47%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLE--CQDWKHQAYLAQRRILYCSVKKTRDGTE---SLISSVHLSVDNVKT-SPSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLC----GIFIHAFLPTELYRG-SNST 1234
             RYMQ+Q +K+                P +I     NIFN+ SQ L V Y + GF  SA+C A +F +   +E+ YI  +K Y  TW G+  +   +WG    L + G   +  E   +E    + G++G +E+A QS+L Q+  + FM+ +G  I+ NIR+GQ LG+ +P QA   YR G   +  + ++  + I+  ++ +PLVFTN         +++P +  + + D+F +V    LRGCGRQ    ++IF SFY+L  P+ I L FV  + ++G+W+G  +   + V  IA++     QDW+HQA L Q+RI     +  ++  E     I S   S   ++    SH R+ S   + S    ++    ++V +    K  I    +F   LC    GI +  +LP ELY   SNST
Sbjct:  175 TRYMQNQ-NKVL---------------PPMIIGIIVNIFNVVSQYLTVYYFKLGFDFSAICQAITFLLFWALELAYILIAKLYEETWDGWTRDVFLEWGLFTKLAIPGAAMVIMECFCFEIGTLLSGVMGPLEMAAQSVLFQLETITFMISFGVGISVNIRVGQYLGSGKPQQALKVYRYGLLVMMSSFVLTSSLILGFKDYLPLVFTNDGEAQKLSSELLPILVGVQFFDAFGTVTMGALRGCGRQKICVLLIFCSFYLLGQPIGISLAFVAQLKVQGLWIGLLVSLAICV-PIAVIYTNFIQDWQHQANLCQKRI--AEARHQQENEEFKNETIESRRNSFQQLEYFKASHRRSISKSFSVSVPGNIMVTKYVEVTEKTYTKAYITKFIIFFSTLCVLIMGILVKLYLPRELYWPLSNST 577          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A1I8JEB7 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.339e-45
Identity = 117/346 (33.82%), Postives = 179/346 (51.73%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPS 1039
            ARY+Q+Q                  ++  ++ A  GN+FN+ SQ L +    +GF +SAVC A +F +M ++ I YI  S  Y+ TW G+ +E+LF+W     L L G+G ++ E   WE   F+ G +G  EL  QSIL Q     FM+  G +IA NIR+GQ LGA   S+AKL + AG   +  +  V     I  R+ +P +FTN  N+      + P + +  + D  S + +  LRGCGRQ  G +++  ++YI+ LP+ I +    ++ + G+WLG  IG  ++      LL  QDW  QA LAQ RI     ++    TE+        +++   SPS
Sbjct:  171 ARYLQNQDR----------------VYAPMLCAVAGNVFNLISQYLCIYVWNFGFVSSAVCQALTFVIMFVLLIGYIVFSHVYVETWNGWDVESLFNWWQFLKLALPGMGMVSLETFCWEVGTFVAGYMGEEELGAQSILFQTETWTFMIALGLSIAVNIRVGQSLGALNGSRAKLVWLAGCCCLLCSATVTTIIFITCRSLLPYMFTNDANIAAIAAGIFPVLGLFQFIDGISCISAGALRGCGRQATGALLVITAYYIIGLPVGIPVALTTSLRVFGLWLGLLIGICITAPTYIFLLCRQDWNRQAELAQERIQVAEERQQVYDTEA-------ELEDSGRSPS 493          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A267DNE9 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026979g1 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.427e-44
Identity = 117/346 (33.82%), Postives = 179/346 (51.73%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPS 1039
            ARY+Q+Q                  ++  ++ A  GN+FN+ SQ L +    +GF +SAVC A +F +M ++ I YI  S  Y+ TW G+ +E+LF+W     L L G+G ++ E   WE   F+ G +G  EL  QSIL Q     FM+  G +IA NIR+GQ LGA   S+AKL + AG   +  +  V     I  R+ +P +FTN  N+      + P + +  + D  S + +  LRGCGRQ  G +++  ++YI+ LP+ I +    ++ + G+WLG  IG  ++      LL  QDW  QA LAQ RI     ++    TE+        +++   SPS
Sbjct:  188 ARYLQNQDR----------------VYAPMLCAVAGNVFNLISQYLCIYVWNFGFVSSAVCQALTFVIMFVLLIGYIVFSHVYVETWNGWDVESLFNWWQFLKLALPGMGMVSLETFCWEVGTFVAGYMGEEELGAQSILFQTETWTFMIALGLSIAVNIRVGQSLGALNGSRAKLVWLAGCCCLLCSATVTTIIFITCRSLLPYMFTNDANIAAIAAGIFPVLGLFQFIDGISCISAGALRGCGRQATGALLVITAYYIIGLPVGIPVALTTSLRVFGLWLGLLIGICITAPTYIFLLCRQDWNRQAELAQERIQVAEERQQVYDTEA-------ELEDSGRSPS 510          
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Match: A0A267DY16 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012118g1 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 6.556e-44
Identity = 117/346 (33.82%), Postives = 179/346 (51.73%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPS 1039
            ARY+Q+Q                  ++  ++ A  GN+FN+ SQ L +    +GF +SAVC A +F +M ++ I YI  S  Y+ TW G+ +E+LF+W     L L G+G ++ E   WE   F+ G +G  EL  QSIL Q     FM+  G +IA NIR+GQ LGA   S+AKL + AG   +  +  V     I  R+ +P +FTN  N+      + P + +  + D  S + +  LRGCGRQ  G +++  ++YI+ LP+ I +    ++ + G+WLG  IG  ++      LL  QDW  QA LAQ RI     ++    TE+        +++   SPS
Sbjct:  188 ARYLQNQDR----------------VYAPMLCAVAGNVFNLISQYLCIYVWNFGFVSSAVCQALTFVIMFVLLIGYIVFSHVYVETWNGWDVESLFNWWQFLKLALPGMGMVSLETFCWEVGTFVAGYMGEEELGAQSILFQTETWTFMIALGLSIAVNIRVGQSLGALNGSRAKLVWLAGCCCLLCSATVTTIIFITCRSLLPYMFTNDANIAAIAAGIFPVLGLFQFIDGISCISAGALRGCGRQATGALLVITAYYIIGLPVGIPVALTTSLRVFGLWLGLLIGICITAPTYIFLLCRQDWNRQAELAQERIQVAEERQQVYDTEA-------ELEDSGRSPS 510          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a2.1 (solute carrier family 47 member 1 [Source:NCBI gene;Acc:103046628])

HSP 1 Score: 116.316 bits (290), Expect = 2.104e-27
Identity = 91/345 (26.38%), Postives = 161/345 (46.67%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPSH 1042
            YM    +   ++L+  Y   +G +WP VI    GNI N     +F+  L  G   SA  ++ S   +A+   +YI     + ATW G+  + L +WG+   L    +  +  E   +E   F+ GL+G  EL  QS++ ++  + +M   G A+A ++R+G  LGA    QAKL+ +       + +  +   I  L++ I   FT +Q +I  + +VM         D+ +++    +RG G+Q+ G +   + FY +  P+ + L F  +M I G+W G  +   +  +   IL+   DWK     AQ R   C   + +D + ++ +    + +   T PS 
Sbjct:  176 YMPSLPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYIFLHLLHLGVAGSAAANSISQCSLAVFLYVYIRWKGLHKATWDGWSRDCLQEWGAFIRLAFPSMLMLCVEWWTYEIGGFLAGLIGETELGAQSVIYELATIAYMFPLGFAVAASVRVGNALGAGNTEQAKLSGKVALICGLLVSCGVAALISGLKDVIAYTFTTEQEIIVRVSEVMAMYGFFHLFDATAAITGGIVRGAGKQLVGAMCNIVGFYFVGFPIGVSLMFALSMGIVGLWAGFFVCVFLQSVFFLILICKLDWKKATKEAQVRAGICQT-EMKDESYAMENKSCEADEYQGTKPSK 519          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 104.375 bits (259), Expect = 1.510e-23
Identity = 82/306 (26.80%), Postives = 143/306 (46.73%), Query Frame = 2
Query:   38 FRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVM----PFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            F + + Y   +G +WP VI     N+ N  S  +F+  L  G   SA  +  S  +MA++  IYI     +  TW G+ +E L +W + F+L + G+  +  E   +E   F+ GL+  VEL  QSI+ ++  + +M   G ++A  +R+G  +GA   +QAKL+ +          + L   +   ++ I  +F+N + +   +  VM    PF  +    D+ ++   + +RG G+Q  G +     +Y +  P+ + L F   M I G+W G  I      +    LL   +W+     AQ R
Sbjct:  164 FIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSMECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLL----DATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEAQIR 465          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 104.76 bits (260), Expect = 1.529e-23
Identity = 82/306 (26.80%), Postives = 143/306 (46.73%), Query Frame = 2
Query:   38 FRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVM----PFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            F + + Y   +G +WP VI     N+ N  S  +F+  L  G   SA  +  S  +MA++  IYI     +  TW G+ +E L +W + F+L + G+  +  E   +E   F+ GL+  VEL  QSI+ ++  + +M   G ++A  +R+G  +GA   +QAKL+ +          + L   +   ++ I  +F+N + +   +  VM    PF  +    D+ ++   + +RG G+Q  G +     +Y +  P+ + L F   M I G+W G  I      +    LL   +W+     AQ R
Sbjct:  164 FIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSMECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLL----DATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEAQIR 465          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: ENSAMXT00000033072.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103022207])

HSP 1 Score: 90.8929 bits (224), Expect = 5.003e-19
Identity = 96/411 (23.36%), Postives = 182/411 (44.28%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTR-----DGTESLISSVHLS--VDNVKTSPSHVRTPSHPITCSTAIVVLSKPR----LKVDKS-IIWKRIIIAGFVFLFLLCGIFIHAFLP 1204
            Y+    +    +L+  Y   +G + P V  A   NI N+ +  + +++L +G   SAV +A +   + +    YI   + +  TW G+ LE+L DWG+   L +     + FE  I+E   F+ G+L  ++LA Q  ++ +    +M   G   A  +R+G  LGA   + A L  +      A+  +V G  +  L+  I  +FT+ + ++  +  ++     L + D    V    L G G+Q    +   I +Y + LPL I L F   + + G WLG  I   +      +++   +W+     A  R    ++ + +     + ++S++ + + S   +N   +      P +P   S A++   +PR    +++  S +I +R +      L L  G  +H  LP
Sbjct:  164 YLPAVPASFLHQLQVAYLQNQGVILPQVYTAIAANIANVLTNYILITWLDFGVYGSAVANAVAEIYICVFLYAYIRWKRLHCETWGGWSLESLQDWGAYMKLAIPSTMMLCFEWWIYEIGGFLAGMLSEMDLAAQHAVLMLATTNYMFNLGMQGATCVRVGNALGAGDTTGAVLTCKVSLTLTALLAVVQGAVLAGLKPVIGFLFTDDRVIVQMVSDILTVYCFLEFFDGLVCVCMGILLGSGQQKIAAVANLIGYYCIGLPLGISLMFAAKLEVVGFWLGLLICVCIQSTFFIVVIFRLNWERVTKEAIERSGKSNLNRRQLDFEGEPSQSIVPANYTSQNSENQNLNGHQAVIPHNPNENSDALLDRERPRETCKVRLSTSQLIIRRGLTTLAAVLILATGTSLHLTLP 574          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Match: slc47a4 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103045605])

HSP 1 Score: 87.4261 bits (215), Expect = 6.690e-18
Identity = 90/349 (25.79%), Postives = 164/349 (46.99%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFS--FGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR--ILYCSVKKTRDGTESLISSVHLSVDNVKTSPSH 1042
            Y+    +   ++L+  Y   +G + P + A+   NI N+ +  + + +L  G   SA  ++F+  F  +AL    YI   K ++ TW G+  E+L DWG+   L +       F+  I+E   F+ G+LG V+LA Q +++ +  +++M+  G   A  +R+G  LGA   + A    +      AI  I+LG  I   +  I  +FT+ +++ + + ++M     L + +    V    L G G+Q    I   + +Y++ LPLSIIL +   + I G WLG  +   +  +   +++   +WK     A  R  +    +   R  +  L  S  L+V N +   S+
Sbjct:  164 YIPAVPAMFLYQLQRSYLQNQGVIMPQMYASVVVNIVNVLANYVLLFWLDLGVHGSAAANSFAPIFSCIALFT--YIRIKKLHVKTWGGWSSESLQDWGAYMKLAIPSTLMACFDWWIYEIGGFLAGMLGEVDLAAQHVVIMLAYIVYMIPLGLQGAACVRVGNALGAGNTAGAIHTSKVSLILAAILAILLGVVIASTKTVIAFIFTSDESIAELVSELMGICCPLQFFNGILCVGMGILLGTGQQKIAAIANLLGYYLIGLPLSIILTYPAKLQIAGFWLGLLVAVFLLAIYFVVIIFRLNWKKMTEEAIERAGMGKTVIHSDRRSSHRLSDSFFLAVTNGENGNSY 510          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Match: YDR338C_mRNA (Putative protein of unknown function; member of the multi-drug and toxin extrusion (MATE) family of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily [Source:SGD;Acc:S000002746])

HSP 1 Score: 67.781 bits (164), Expect = 1.538e-12
Identity = 68/249 (27.31%), Postives = 120/249 (48.19%), Query Frame = 2
Query:  260 WPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAI--AILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISS 1000
            W GF  +A   W  + +L  +G+  +  E + +E         G   LA QS +  +  LL+M+ +   I+ + RI   +GA R   A ++ + G     I   +    ++  RN I  +++    VI  I +V+P + I+   DS ++V  + LRG G Q  G I+  +++Y+  +PL++IL + F+M + G+W+G  IGS + ++ +  A  +   DW      A+  IL  +     D  E L  S
Sbjct:  439 WGGFSRKAFTHWNDLGHLAFSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIANFIGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLVGIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSWFFDMKLYGLWIG--IGSAMLLIGLVEAYYVLFPDWDKIMTYAE--ILKETEDDEVDSDEYLTDS 683          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Match: ERC1 (Member of the multi-drug and toxin extrusion (MATE) family; the MATE family is part of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily; overproduction confers ethionine resistance and accumulation of S-adenosylmethionine [Source:SGD;Acc:S000001074])

HSP 1 Score: 52.373 bits (124), Expect = 1.008e-7
Identity = 43/199 (21.61%), Postives = 86/199 (43.22%), Query Frame = 2
Query:  161 GFKASAVCHAFSFGVMALIEIIYIFKSKFY---LATWPGF--QLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQ 742
            G+  + +    ++ +M L  +IY   +K     L  W G   + +A  +W  M  L + GV  +  E + +E        LG   L  QSI+  +  L + V +  +++ + R+   +GA+      +  R       + + +    I   + QI  +F+ +  V+  +   +P +  +   D+F++  +  LRG GRQ
Sbjct:  345 GYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKCWNGIIPKEQAFKNWRKMINLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIASLAYQVPFSISVSTSTRVANFIGASLYDSCMITCRVSLLLSFVCSSMNMFVICRYKEQIASLFSTESAVVKMVVDTLPLLAFMQLFDAFNASTAGCLRGQGRQ 543          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Match: EDO46474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ02])

HSP 1 Score: 83.5741 bits (205), Expect = 2.259e-17
Identity = 54/205 (26.34%), Postives = 97/205 (47.32%), Query Frame = 2
Query:  137 LFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAG 751
            L V  L  G    A+    ++ + +++ ++YI+  K +  TW G+    L DW     L + G+  I  E   +E   F+ G + +  +A   IL Q+  + FM+  G  +A  + +G  LG+N+P +AKL  +         + ++   ++  R  I L FT+ + VI+   + +P +   L  D+   V +  +RG GRQ  G
Sbjct:  173 LLVLTLHLGISGIAISFYVNYYLFSVLLLVYIYIRKIHHLTWKGWSFSCLDDWRQFIGLAVPGMMMICVEWWSFEIGSFLLGRIDDSNVAAHGILFQLATISFMLPIGTGLAATVSVGMALGSNQPDRAKLVTKVSLIITIAFSALVAICVVCARKYIVLAFTDDREVINLTIQTLPIVGTFLVFDASQGVMAGIIRGSGRQKIG 377          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a3 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101163594])

HSP 1 Score: 122.865 bits (307), Expect = 1.168e-29
Identity = 102/350 (29.14%), Postives = 162/350 (46.29%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGT-TIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSV-----KKTRDGTESLISSVHLSVDNVKTSPS 1039
            +M    +   F L + Y   +G +WP VI  F  N+ N     +F+  L+ G   SA+ + FS   MA I   YI     + ATW G+  E L DWGS   L +  +  +  E   +E   F+ GL+  VEL  QSI+ ++  + +M   G ++A N+R+G  LGA    Q KL+ +   F   + ++ +   I  L++ I  VFT  + + + +  V+ F    L  D+ S+  S  +RG G+Q  G I   + +Y +  P+ + L F   + IKG+W G  T  S+  V  I  L+   +WK     AQ R   C        +  D       S    +D++ T P+
Sbjct:  165 FMPALPAAFMFSLLSRYLQNQGIIWPQVITGFLVNLLNALINYIFLFVLKMGVAGSALANTFSQFSMAGILFGYIVCRGLHKATWGGWSKECLHDWGSYIRLAIPSMVMMCVEWWTYEIGGFLAGLISEVELGAQSIVYELANVAYMFPLGFSVAGNVRVGNALGAGETEQGKLSAKLTLFCAGLVSVGMALLIGGLKDHISYVFTYDEKIRERVSDVISFYAPFLLLDAISAACSGIIRGAGKQRVGAICNIVGYYGIGFPVGVPLMFAAKLGIKGLWTGLFTCVSLQCVFLIFYLIR-MNWKDVTIEAQIRAGACETYTETSPEPEDAENYRCPSDTTQLDDIDTLPA 513          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: ENSORLT00000002449.2 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101156384])

HSP 1 Score: 115.161 bits (287), Expect = 4.646e-27
Identity = 96/365 (26.30%), Postives = 172/365 (47.12%), Query Frame = 2
Query:    8 YMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRI-LYCSVKKTRDGTE-----SLISSVHLSVDNVKTSPSHVRTPSHPITCSTAI 1084
            +M    +   ++L++ Y   +G +WP VI    GNIFN     + +  L  G   SA  +A S  ++A++  +YI     + ATW G+ L+ L +WG    L +  +  +  E  I+E   F+ G++G  EL   S+  Q+  + +M+  G + A ++R+G  LGA +  QAKL+ +       I   ++GT +   ++ I  +FT+ Q ++D    V+  +    + D  + +    LRG G+Q+ G +   + +Y+  +P+ + L F  +M++ G+W G TI   +      I L   +WK  A  AQ R  +    +K  + T+     S +S    S D    +   V  P      +T +
Sbjct:  177 FMPSLPASFMYQLQSRYLQNQGIIWPQVITGAIGNIFNAIINYVLLYPLDLGVAGSAAANAISQFLLAVLLFVYICLKGLHKATWDGWSLDCLQEWGPFVKLAIPSMLMLCLEWWIFEVGGFLAGMIGEAELGAHSVAYQLAVIAYMLPLGISAAASVRVGNALGAGKVEQAKLSCKVPIICGFIVAFMMGTILGSTKDVIGYIFTSDQEILDKAPGVVFVLGFTHFFDCIAGITGGILRGAGKQMVGALCNLVGYYVFGVPIGVSLMFAAHMNVVGLWTGLTICVFMQSSFFLIYLWKLNWKKAAEEAQVRAGVQIKDEKEMEITDCNRIHSQVSVTAPSCDGEDHTYEKVNIPEESKAANTTL 541          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165411])

HSP 1 Score: 90.5077 bits (223), Expect = 6.259e-19
Identity = 99/412 (24.03%), Postives = 170/412 (41.26%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYR-----AGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSH------PITCSTAIVVLSKPRLKV----------DKSIIWKRIIIAGFVFLFLLCGIFIHAF--LPTELYRGSNST 1234
            +G + P + AA   NI N+ +  +F+ +LQ G   SA  +  S   + +    YI+  K +  TW G+ +E+L +WGS   L +       FE  ++E   F  G+L   ELA Q  ++ V  L +M   G   A   R+G  LGA   ++A L+ +     AG F I       G  +   +  I  +FT+ + ++  +  ++     L + D    V +    G G+Q    +   I +Y + LPL + L FV  + + G W+G  I  ++      +++   +WK        ++   +VK+ +  T   +      +DN   + S      H      P+T       L +P   V             +I +R I        L  GI +H    LP   +  +N+T
Sbjct:  192 QGIIMPQMYAAALANIANVATNYIFIYWLQLGVVGSAAANTLSQVYICVFLFGYIWWKKLHTTTWGGWSVESLQEWGSYMKLAIPSTLMTCFEWWVYEFGGFFAGMLSEEELAAQHAVIMVAFLTYMFPLGIQAAACARVGNALGAGDTARAILSSKISLALAGCFAIV-----EGIVLGSTKTVIGFIFTSDERIVGLVSHLINAYCFLQFFDGLVCVCTGIFLGTGKQKIPAVAHLIGYYCIGLPLCVTLMFVAKLRVLGFWIGLLICVILQSTFYIVVIFKLNWK--------KMTEEAVKRAQKNTRMALVDADALLDNTGNNASQASNNGHSVEGYVPVTTENNDGKLEEPERHVVLKQRRDNLSTSQLILRRGITVIAALGLLSVGIIVHFLVPLPETQFAKANTT 590          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a1 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101170536])

HSP 1 Score: 87.8113 bits (216), Expect = 5.602e-18
Identity = 81/292 (27.74%), Postives = 136/292 (46.58%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRR 943
            +G + P +  A   N+FN+ +  L +S L+ G   SA+ ++ S  V+ L+   YI   K +  TW G+    L DWGS   L       I  E  +WE   F+ G LG  +LA Q +L+++  L +M   G + A  +R+G  LGA   ++A +A +       + ++V G  I   +     +FT+  ++++ +   +     L + DS   V S  L G G Q    +   +S+Y + LP+   L F  ++ I G+WLG    S +      +++   DW      AQ R
Sbjct:  207 QGIILPQMYTAGVANVFNLGANYLLISVLKLGVVGSAIANSLSQIVICLLLFGYIRWRKLHEKTWGGWTTNCLQDWGSYMKLATPSALMICLEWWVWEIGGFLAGALGEKDLAAQHVLVEIGSLSYMFPLGISAAVCVRVGNALGAGNITRAFVACKLALVLAGVLSVVQGVVIACCKPVAGSIFTSDIDILEIVSNNLTVYIFLQFFDSILCVSSGILVGSGLQKIAALTNLVSYYCIGLPVGAALMFGAHLRILGLWLGILTCSCIQAAFFLVVIFKIDWNKITLKAQLR 498          
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165658])

HSP 1 Score: 80.4925 bits (197), Expect = 1.035e-15
Identity = 57/225 (25.33%), Postives = 101/225 (44.89%), Query Frame = 2
Query:   68 KGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQ 742
            +G + P +  A  GN+ N+ +  + + +L  G   SA  +  S   + +   +YI+  K ++ TW G+ +E+L +WGS   L +       FE  ++E   F  G++   ELA Q  ++ V  + +M  +G   A   R+G  LGA   + A L  R          +V G  +   +  I  +FT  + +I  + ++M     L + D    V +    G G+Q
Sbjct:  172 QGIILPQMYTATLGNVANVVTNYILIYWLDLGVGGSAAANTLSQIYICVFLFLYIWWRKIHVKTWGGWSVESLQEWGSYMKLAVPSTLMKCFEWWVYEFGGFFAGMMSEDELAAQHAVIMVSFITYMFPFGIQAAACARVGNALGAGDNTGALLTSRVALTLAGSICVVEGLVLGSTKTVIGFIFTADERIIHLVSQLMTAYCFLQFFDGLVCVCTGIFLGAGKQ 396          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000045551.1 (SMESG000045551.1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 309/412 (75.00%), Postives = 342/412 (83.01%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRIL-YCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNST 1234
            ARYMQDQ                GCLWPAVIA FCGNIFNICSQLLFVSYLQ GFKA+A CHA SFG+M LIE IYIFKSKFY ATWPGFQLEA  DWG++F LGLAGVGH+TFEVIIWE +VFMGGL+GNVELA QSI++Q++ L FM+YYGA IA NIR+GQCLGANRP+QAKLAYRAGT N AI TIVLGT II+LRNQIPLVFTNKQ+VID IQKVMPFMFIL+Y D FS VFSATLRGCGRQVAGCII+F+SFYILSLP SIILGFVFNMSI+GIW+G TIGSVVSV  I ILLECQDWKHQA+LAQRRI    ++ KT + TE LI S HL  ++   SPSH+RTPSHP+TCSTAIV L KP++ VD+SIIWKRIIIAG VFLFLLCGIFIH FLP + Y   NST
Sbjct:  178 ARYMQDQ----------------GCLWPAVIAGFCGNIFNICSQLLFVSYLQLGFKAAAFCHASSFGIMVLIEAIYIFKSKFYEATWPGFQLEAFADWGNLFMLGLAGVGHVTFEVIIWEASVFMGGLIGNVELATQSIMLQILTLTFMMYYGAGIASNIRVGQCLGANRPNQAKLAYRAGTVNTAIATIVLGTLIIILRNQIPLVFTNKQDVIDEIQKVMPFMFILMYCDPFSGVFSATLRGCGRQVAGCIIVFVSFYILSLPSSIILGFVFNMSIQGIWIGNTIGSVVSVTTIGILLECQDWKHQAHLAQRRIQGNITITKTVE-TEYLIKSFHLGFEHENKSPSHIRTPSHPVTCSTAIVELPKPKINVDRSIIWKRIIIAGCVFLFLLCGIFIHVFLPVKKYTKMNST 572          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000045551.1 (SMESG000045551.1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 309/412 (75.00%), Postives = 342/412 (83.01%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRIL-YCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNST 1234
            ARYMQDQ                GCLWPAVIA FCGNIFNICSQLLFVSYLQ GFKA+A CHA SFG+M LIE IYIFKSKFY ATWPGFQLEA  DWG++F LGLAGVGH+TFEVIIWE +VFMGGL+GNVELA QSI++Q++ L FM+YYGA IA NIR+GQCLGANRP+QAKLAYRAGT N AI TIVLGT II+LRNQIPLVFTNKQ+VID IQKVMPFMFIL+Y D FS VFSATLRGCGRQVAGCII+F+SFYILSLP SIILGFVFNMSI+GIW+G TIGSVVSV  I ILLECQDWKHQA+LAQRRI    ++ KT + TE LI S HL  ++   SPSH+RTPSHP+TCSTAIV L KP++ VD+SIIWKRIIIAG VFLFLLCGIFIH FLP + Y   NST
Sbjct:  173 ARYMQDQ----------------GCLWPAVIAGFCGNIFNICSQLLFVSYLQLGFKAAAFCHASSFGIMVLIEAIYIFKSKFYEATWPGFQLEAFADWGNLFMLGLAGVGHVTFEVIIWEASVFMGGLIGNVELATQSIMLQILTLTFMMYYGAGIASNIRVGQCLGANRPNQAKLAYRAGTVNTAIATIVLGTLIIILRNQIPLVFTNKQDVIDEIQKVMPFMFILMYCDPFSGVFSATLRGCGRQVAGCIIVFVSFYILSLPSSIILGFVFNMSIQGIWIGNTIGSVVSVTTIGILLECQDWKHQAHLAQRRIQGNITITKTVE-TEYLIKSFHLGFEHENKSPSHIRTPSHPVTCSTAIVELPKPKINVDRSIIWKRIIIAGCVFLFLLCGIFIHVFLPVKKYTKMNST 567          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000033095.1 (SMESG000033095.1)

HSP 1 Score: 476.478 bits (1225), Expect = 5.965e-164
Identity = 253/414 (61.11%), Postives = 316/414 (76.33%), Query Frame = 2
Query:    2 ARYMQDQVSKIFFRLRNCY*LIKGCLWPAVIAAFCGNIFNICSQLLFVSYLQYGFKASAVCHAFSFGVMALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVIIWEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTS--PSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTI 1237
            ARYMQDQ                GCLWP VIA  CGN+FNIC QLLFV+YLQ+GFK++A+CHAFSFG+M L+E +YI+KSKFYL TWPGFQLEA +DW  M  LGLAG+GH TFEV++WE +VFMGGLLG V++A QSI++Q++ + FM+YYG  IA NIR+GQCLGANRP+QAK AYRAG FN AI+TI+L T+IILLR QIPLVFTNK+ V++     MP++F++LY D FS V S TLRGC RQ++GC+IIF+SFY++SLP+SI+  FV+++ +KGIW+G T G +V+V +I +LLECQDWK+QAYLAQRRI         D TE LI S  L +DN+  +   SH+RTPSHPI CST I   S PR  ++KSIIWKR+ I G   LFLLCGIFIH F+P ELYRG+N T+
Sbjct:  190 ARYMQDQ----------------GCLWPPVIAGICGNVFNICFQLLFVTYLQFGFKSAALCHAFSFGIMTLVEALYIWKSKFYLNTWPGFQLEAFYDWFPMLKLGLAGMGHTTFEVLVWEASVFMGGLLGTVQVATQSIMIQILYISFMLYYGCGIASNIRVGQCLGANRPNQAKQAYRAGIFNTAISTIILATSIILLRYQIPLVFTNKKEVLEMTIDTMPYIFVILYCDPFSGVCSGTLRGCARQLSGCMIIFVSFYMISLPVSIVASFVYDLGVKGIWIGPTCGCIVAVSSIFLLLECQDWKNQAYLAQRRIFSKLADIENDETEKLIYS--LEIDNIAENGPDSHIRTPSHPIMCSTEIFDTSAPRTNLEKSIIWKRVAIFGCAILFLLCGIFIHLFVPLELYRGTNFTL 585          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000033099.1 (SMESG000033099.1)

HSP 1 Score: 464.922 bits (1195), Expect = 1.104e-163
Identity = 263/266 (98.87%), Postives = 264/266 (99.25%), Query Frame = 2
Query:  449 VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI 1246
            VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAITTIVLGTTIILLRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCIIIFISFYILSLP SIILGFVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDN KTSPSHVRTPSHPITCSTAIVV+SKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI
Sbjct:   33 VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAITTIVLGTTIILLRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCIIIFISFYILSLPSSIILGFVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNEKTSPSHVRTPSHPITCSTAIVVISKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI 298          
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Match: SMESG000033099.1 (SMESG000033099.1)

HSP 1 Score: 464.537 bits (1194), Expect = 1.493e-163
Identity = 263/266 (98.87%), Postives = 264/266 (99.25%), Query Frame = 2
Query:  449 VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAXXXXXXXXXXXXXRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCXXXXXXXXXXXXXXXXXXXXVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPITCSTAIVVLSKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI 1246
            VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAITTIVLGTTIILLRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCIIIFISFYILSLP SIILGFVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDN KTSPSHVRTPSHPITCSTAIVV+SKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI
Sbjct:   35 VYYGAAIACNIRIGQCLGANRPSQAKLAYRAGTFNIAITTIVLGTTIILLRNQIPLVFTNKQNVIDGIQKVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCIIIFISFYILSLPSSIILGFVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYCSVKKTRDGTESLISSVHLSVDNEKTSPSHVRTPSHPITCSTAIVVISKPRLKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI 300          
The following BLAST results are available for this feature:
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC47A21.607e-3030.03solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A26.327e-2729.27solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A15.622e-2126.91solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A15.946e-2126.91solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A11.624e-2026.45solute carrier family 47 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX248108.11.891e-2926.11multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a2.18.013e-2525.99solute carrier family 47 member 2.1 [Source:NCBI g... [more]
slc47a37.655e-2428.77solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
slc47a32.064e-2228.32solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
slc47a11.180e-1926.67solute carrier family 47 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmed64.226e-2728.12transmembrane p24 trafficking protein 6 [Source:Xe... [more]
slc47a25.085e-2127.07solute carrier family 47 (multidrug and toxin extr... [more]
ccdc85a3.912e-2030.08coiled-coil domain containing 85A [Source:Xenbase;... [more]
ccdc85a1.127e-1931.84coiled-coil domain containing 85A [Source:Xenbase;... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc47a15.373e-2223.35solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a21.093e-1923.57solute carrier family 47, member 2 [Source:MGI Sym... [more]
Slc47a26.528e-1923.55solute carrier family 47, member 2 [Source:MGI Sym... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86VL8|S47A2_HUMAN7.717e-3030.03Multidrug and toxin extrusion protein 2 OS=Homo sa... [more]
sp|A7KAU3|S47A2_RABIT3.468e-2731.85Multidrug and toxin extrusion protein 2 OS=Oryctol... [more]
sp|Q5R7E4|S47A2_PONAB5.678e-2729.44Multidrug and toxin extrusion protein 2 OS=Pongo a... [more]
sp|Q5RFD2|S47A1_PONAB5.027e-2426.33Multidrug and toxin extrusion protein 1 OS=Pongo a... [more]
sp|A1L1P9|S47A1_DANRE6.049e-2425.99Multidrug and toxin extrusion protein 1 OS=Danio r... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKK52.145e-16061.11Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A0H3YJN65.714e-4631.75Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A1I8JEB77.339e-4533.82Multidrug and toxin extrusion protein OS=Macrostom... [more]
A0A267DNE96.427e-4433.82Multidrug and toxin extrusion protein OS=Macrostom... [more]
A0A267DY166.556e-4433.82Multidrug and toxin extrusion protein OS=Macrostom... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc47a2.12.104e-2726.38solute carrier family 47 member 1 [Source:NCBI gen... [more]
slc47a31.510e-2326.80multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a31.529e-2326.80multidrug and toxin extrusion protein 1-like [Sour... [more]
ENSAMXT00000033072.15.003e-1923.36multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a46.690e-1825.79multidrug and toxin extrusion protein 1-like [Sour... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDR338C_mRNA1.538e-1227.31Putative protein of unknown function; member of th... [more]
ERC11.008e-721.61Member of the multi-drug and toxin extrusion (MATE... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464742.259e-1726.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc47a31.168e-2929.14multidrug and toxin extrusion protein 1 [Source:NC... [more]
ENSORLT00000002449.24.646e-2726.30multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a46.259e-1924.03multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a15.602e-1827.74multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a41.035e-1525.33multidrug and toxin extrusion protein 1 [Source:NC... [more]
back to top
BLAST of Multidrug and toxin extrusion protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045551.10.000e+075.00SMESG000045551.1[more]
SMESG000045551.10.000e+075.00SMESG000045551.1[more]
SMESG000033095.15.965e-16461.11SMESG000033095.1[more]
SMESG000033099.11.104e-16398.87SMESG000033099.1[more]
SMESG000033099.11.493e-16398.87SMESG000033099.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002443 ID=SMED30002443|Name=Multidrug and toxin extrusion protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1450bp
GGCTAGATATATGCAAGATCAAGTCAGTAAAATATTCTTTCGGTTACGTA
ATTGTTACTAATTAATCAAGGGTTGTTTATGGCCTGCCGTTATTGCTGCC
TTTTGCGGAAATATATTTAATATTTGTAGCCAACTGCTGTTTGTCAGTTA
CCTTCAATATGGATTCAAGGCATCTGCAGTTTGTCATGCGTTCTCATTTG
GAGTGATGGCTTTAATAGAAATCATTTATATTTTTAAATCAAAGTTCTAC
TTGGCGACCTGGCCAGGATTTCAATTAGAAGCACTGTTTGATTGGGGAAG
CATGTTTTATCTTGGTTTAGCCGGCGTTGGGCATATAACATTTGAAGTCA
TTATTTGGGAAGGTACTGTGTTTATGGGAGGTCTTCTTGGAAATGTAGAA
TTGGCAGTTCAGTCGATTTTGATGCAAGTTGTGGGCTTATTATTTATGGT
TTATTACGGAGCTGCAATAGCCTGTAATATCCGCATTGGCCAGTGTTTAG
GAGCAAATCGTCCCAGCCAAGCAAAATTAGCGTATAGAGCTGGAACCTTT
AATATAGCTATAACAACAATAGTACTGGGAACAACAATTATACTTCTACG
AAATCAGATTCCTTTGGTGTTTACTAACAAACAGAATGTAATAGATGGAA
TACAAAAAGTAATGCCATTTATGTTCATCCTTTTGTATTCTGATTCATTT
TCGAGCGTATTTTCAGCTACGCTTCGAGGCTGTGGTCGCCAGGTTGCCGG
TTGCATAATAATATTTATCTCATTTTATATTTTGAGTTTACCGTTATCAA
TTATTCTGGGATTTGTTTTCAATATGAGCATTAAAGGGATTTGGTTAGGC
ACTACGATTGGTTCAGTGGTATCTGTTTTGGCGATTGCGATATTACTGGA
ATGTCAAGACTGGAAGCATCAAGCTTATTTAGCACAAAGACGAATTCTGT
ACTGCAGTGTAAAGAAAACGCGGGATGGAACTGAAAGCCTGATTTCATCT
GTCCATCTGAGTGTTGACAATGTAAAGACATCTCCGTCCCATGTCAGAAC
ACCAAGTCATCCAATAACGTGTTCGACTGCAATTGTTGTGCTATCGAAAC
CGAGATTAAAAGTGGACAAGTCTATAATATGGAAAAGAATAATCATTGCA
GGATTTGTCTTTCTTTTTTTATTGTGTGGAATATTTATTCACGCCTTTCT
TCCCACGGAATTGTACAGAGGATCAAATTCAACAATAATTCGTATTTAGA
GTTGACATGATTTTCCGTGAATTTAAATTAATTAAATATTATTCATTAAA
ATTGAAATTCAATTAATCCAATTTTACAAAATTTACTCGGCCCTCGAATA
AACTGGAAATTATATTCGTTATAACAAGGGGAAAAATTATAACTACCCGT
TTGCAGCAATTTGAATAAATTACAATTACTATTAAACAATCAAATTTCAA
back to top

protein sequence of SMED30002443-orf-1

>SMED30002443-orf-1 ID=SMED30002443-orf-1|Name=SMED30002443-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MALIEIIYIFKSKFYLATWPGFQLEALFDWGSMFYLGLAGVGHITFEVII
WEGTVFMGGLLGNVELAVQSILMQVVGLLFMVYYGAAIACNIRIGQCLGA
NRPSQAKLAYRAGTFNIAITTIVLGTTIILLRNQIPLVFTNKQNVIDGIQ
KVMPFMFILLYSDSFSSVFSATLRGCGRQVAGCIIIFISFYILSLPLSII
LGFVFNMSIKGIWLGTTIGSVVSVLAIAILLECQDWKHQAYLAQRRILYC
SVKKTRDGTESLISSVHLSVDNVKTSPSHVRTPSHPITCSTAIVVLSKPR
LKVDKSIIWKRIIIAGFVFLFLLCGIFIHAFLPTELYRGSNSTIIRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042908xenobiotic transport
GO:0055085transmembrane transport
GO:0006855drug transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0042910xenobiotic transporter activity
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR002528MATE_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002528Multi antimicrobial extrusion proteinPFAMPF01554MatEcoord: 3..117
e-value: 5.5E-18
score: 65.1
NoneNo IPR availablePANTHERPTHR11206MULTIDRUG RESISTANCE PROTEINcoord: 6..156
NoneNo IPR availableTMHMMTMhelixcoord: 131..150
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 31..50
NoneNo IPR availableTMHMMTMhelixcoord: 99..121