Histone H2A

Overview
NameHistone H2A
Smed IDSMED30002436
Length (bp)565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H2A (SMED30002436) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H2A (SMED30002436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H2A (SMED30002436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H2A (SMED30002436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002436

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30002436SMESG000072071.1 SmedASXL_002319SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30002436SMESG000072071.1 SmedASXL_002319SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30002436SMESG000072071.1 SmedASXL_002319SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30002436SMESG000072071.1 dd_Smed_v4_2787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002436SMESG000072071.1 dd_Smed_v4_2787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002436SMESG000072071.1 Contig37830newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002436SMESG000072071.1 Contig37830uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30002436SMESG000072071.1 dd_Smed_v6_2787_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30002436SMESG000072071.1 dd_Smed_v4_2787_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002436SMESG000072071.1 SMED_04153_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30002436SMESG000072071.1 SMED_04153_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H2A vs. Ensembl Human
Match: H2AJ (H2A.J histone [Source:HGNC Symbol;Acc:HGNC:14456])

HSP 1 Score: 174.096 bits (440), Expect = 6.710e-56
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AJ (H2A.J histone [Source:HGNC Symbol;Acc:HGNC:14456])

HSP 1 Score: 174.096 bits (440), Expect = 6.710e-56
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC20 (H2A clustered histone 20 [Source:HGNC Symbol;Acc:HGNC:4738])

HSP 1 Score: 173.711 bits (439), Expect = 1.122e-55
Identity = 83/111 (74.77%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC19 (H2A clustered histone 19 [Source:HGNC Symbol;Acc:HGNC:29668])

HSP 1 Score: 173.326 bits (438), Expect = 1.473e-55
Identity = 83/111 (74.77%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AC18 (H2A clustered histone 18 [Source:HGNC Symbol;Acc:HGNC:4736])

HSP 1 Score: 173.326 bits (438), Expect = 1.473e-55
Identity = 83/111 (74.77%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 165.622 bits (418), Expect = 5.155e-53
Identity = 78/113 (69.03%), Postives = 96/113 (84.96%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKE 429
            SRSSRAGL FPVGR+HR+LRKG + +R+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RIAPRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K   +KE
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK---KTAGDKE 127          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 165.622 bits (418), Expect = 5.155e-53
Identity = 78/113 (69.03%), Postives = 96/113 (84.96%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKE 429
            SRSSRAGL FPVGR+HR+LRKG + +R+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RIAPRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K   +KE
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK---KTAGDKE 127          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-68 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 165.236 bits (417), Expect = 7.638e-53
Identity = 75/103 (72.82%), Postives = 92/103 (89.32%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            SRSSRAGL FPVGR+HR+LRKG + +R+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RIAPRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK 120          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-65 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 165.236 bits (417), Expect = 7.638e-53
Identity = 75/103 (72.82%), Postives = 92/103 (89.32%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            SRSSRAGL FPVGR+HR+LRKG + +R+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RIAPRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK 120          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-61 (Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P09588])

HSP 1 Score: 165.236 bits (417), Expect = 7.638e-53
Identity = 75/103 (72.82%), Postives = 92/103 (89.32%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            SRSSRAGL FPVGR+HR+LRKG + +R+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RIAPRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:   18 SRSSRAGLQFPVGRLHRILRKGNYAQRVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPK 120          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33853 (gene:FBgn0053853 transcript:FBtr0091857)

HSP 1 Score: 166.007 bits (419), Expect = 5.635e-53
Identity = 76/107 (71.03%), Postives = 91/107 (85.05%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS RAGL FPVGR+HRLLRKG + ER+G GAPVY++A++EYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33859 (gene:FBgn0053859 transcript:FBtr0091863)

HSP 1 Score: 166.007 bits (419), Expect = 5.635e-53
Identity = 76/107 (71.03%), Postives = 91/107 (85.05%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS RAGL FPVGR+HRLLRKG + ER+G GAPVY++A++EYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33856 (gene:FBgn0053856 transcript:FBtr0091860)

HSP 1 Score: 166.007 bits (419), Expect = 5.635e-53
Identity = 76/107 (71.03%), Postives = 91/107 (85.05%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS RAGL FPVGR+HRLLRKG + ER+G GAPVY++A++EYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:   16 SRSDRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33850 (gene:FBgn0053850 transcript:FBtr0091854)

HSP 1 Score: 166.007 bits (419), Expect = 5.697e-53
Identity = 76/107 (71.03%), Postives = 92/107 (85.98%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS+RAGL FPVGR+HRLLRKG + ER+G GAPVY++A++EYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33847 (gene:FBgn0053847 transcript:FBtr0091851)

HSP 1 Score: 166.007 bits (419), Expect = 5.697e-53
Identity = 76/107 (71.03%), Postives = 92/107 (85.98%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS+RAGL FPVGR+HRLLRKG + ER+G GAPVY++A++EYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:   16 SRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: h2ax1 (H2A.X variant histone family member 1 [Source:ZFIN;Acc:ZDB-GENE-041010-42])

HSP 1 Score: 176.407 bits (446), Expect = 6.309e-57
Identity = 84/120 (70.00%), Postives = 99/120 (82.50%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP  +K
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKSK 128          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: h2ax1 (H2A.X variant histone family member 1 [Source:ZFIN;Acc:ZDB-GENE-041010-42])

HSP 1 Score: 176.407 bits (446), Expect = 6.309e-57
Identity = 84/120 (70.00%), Postives = 99/120 (82.50%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP  +K
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKSK 128          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 172.555 bits (436), Expect = 2.300e-55
Identity = 82/120 (68.33%), Postives = 97/120 (80.83%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K    K
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAAKGK 128          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 172.555 bits (436), Expect = 2.300e-55
Identity = 82/120 (68.33%), Postives = 97/120 (80.83%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K    K
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAAKGK 128          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch211-113a14.19 (si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-121214-198])

HSP 1 Score: 172.555 bits (436), Expect = 2.300e-55
Identity = 82/120 (68.33%), Postives = 97/120 (80.83%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K    K
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAAKGK 128          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: h2ac1 (H2A clustered histone 1 [Source:NCBI gene;Acc:594915])

HSP 1 Score: 177.178 bits (448), Expect = 5.947e-57
Identity = 87/139 (62.59%), Postives = 109/139 (78.42%), Query Frame = 1
Query:   67 GKVKKLQ------NSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            G+ KK+Q      +SRS++AGL FPVGR+HRLLRKG + ERIG G+ +Y++A LEYL AE+LELAGNAARDNKKSRI PRHI LA++ND EL++L   VTI+ GGV+PNIQ+ LLPK  +K  A++E   PKV ESQEF
Sbjct:    3 GRGKKVQKAASGKSSRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAEVLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPKKTSKGSASQE---PKVAESQEF 138          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000000447.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:124390910:124391717:1 gene:ENSXETG00000000090.1 transcript:ENSXETT00000000447.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.792 bits (447), Expect = 7.788e-57
Identity = 85/131 (64.89%), Postives = 102/131 (77.86%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQ 459
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ+ LLPK      A K N +     SQ
Sbjct:    9 GKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESTKAAKSNGSSATCCSQ 139          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: lyl1 (lymphoblastic leukemia associated hematopoiesis regulator 1 [Source:Xenbase;Acc:XB-GENE-940268])

HSP 1 Score: 174.866 bits (442), Expect = 5.119e-56
Identity = 85/139 (61.15%), Postives = 107/139 (76.98%), Query Frame = 1
Query:   67 GKVKKLQ------NSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            G+ KK+Q      +SRS++AGL FPVGR+HRLLRKG + ERIG G+ +Y++A LEYL AE+LELAGNAARDNKKSRI PRHI LA++ND EL++L   VTI+ GGV+PNIQ+ LLPK   K V    ++ PK +ESQEF
Sbjct:    3 GRGKKVQKAASGKSSRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAEVLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPK---KTVKGSSSQEPKAVESQEF 138          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: lyl1 (lymphoblastic leukemia associated hematopoiesis regulator 1 [Source:Xenbase;Acc:XB-GENE-940268])

HSP 1 Score: 175.252 bits (443), Expect = 6.123e-56
Identity = 85/139 (61.15%), Postives = 107/139 (76.98%), Query Frame = 1
Query:   67 GKVKKLQ------NSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            G+ KK+Q      +SRS++AGL FPVGR+HRLLRKG + ERIG G+ +Y++A LEYL AE+LELAGNAARDNKKSRI PRHI LA++ND EL++L   VTI+ GGV+PNIQ+ LLPK   K V    ++ PK +ESQEF
Sbjct:   21 GRGKKVQKAASGKSSRSAKAGLQFPVGRIHRLLRKGNYAERIGSGSAIYLAATLEYLCAEVLELAGNAARDNKKSRILPRHIQLAVRNDDELAKLFDGVTIADGGVLPNIQSALLPK---KTVKGSSSQEPKAVESQEF 156          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: trps1 (transcriptional repressor GATA binding 1 [Source:Xenbase;Acc:XB-GENE-1013667])

HSP 1 Score: 173.711 bits (439), Expect = 1.121e-55
Identity = 83/120 (69.17%), Postives = 99/120 (82.50%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GKV+    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ+ LLPK      A K
Sbjct:    9 GKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESSKAAK 128          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac21 (H2A clustered histone 21 [Source:MGI Symbol;Acc:MGI:2448314])

HSP 1 Score: 174.096 bits (440), Expect = 5.918e-56
Identity = 86/122 (70.49%), Postives = 100/122 (81.97%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK--TPNKPVANK 426
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK    +KP  NK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK 130          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2aj (H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192])

HSP 1 Score: 173.711 bits (439), Expect = 6.395e-56
Identity = 86/121 (71.07%), Postives = 102/121 (84.30%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLP-KTPNKPVANK 426
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLP KT ++ V +K
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESQKVKSK 129          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2aj (H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192])

HSP 1 Score: 173.711 bits (439), Expect = 7.640e-56
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac20 (H2A clustered histone 20 [Source:MGI Symbol;Acc:MGI:2448316])

HSP 1 Score: 173.711 bits (439), Expect = 7.700e-56
Identity = 83/111 (74.77%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac18 (H2A clustered histone 18 [Source:MGI Symbol;Acc:MGI:96097])

HSP 1 Score: 173.326 bits (438), Expect = 1.011e-55
Identity = 83/111 (74.77%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P70082|H2AJ_CHICK (Histone H2A.J OS=Gallus gallus OX=9031 GN=H2A-IX PE=3 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.080e-55
Identity = 84/111 (75.68%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q9BTM1|H2AJ_HUMAN (Histone H2A.J OS=Homo sapiens OX=9606 GN=H2AJ PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.223e-55
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q3ZBX9|H2AJ_BOVIN (Histone H2A.J OS=Bos taurus OX=9913 GN=H2AJ PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.223e-55
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q4R3X5|H2AJ_MACFA (Histone H2A.J OS=Macaca fascicularis OX=9541 GN=H2AJ PE=2 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.294e-55
Identity = 83/111 (74.77%), Postives = 96/111 (86.49%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GKV+    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q64522|H2A2B_MOUSE (Histone H2A type 2-B OS=Mus musculus OX=10090 GN=H2ac21 PE=1 SV=3)

HSP 1 Score: 174.096 bits (440), Expect = 4.139e-55
Identity = 86/122 (70.49%), Postives = 100/122 (81.97%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK--TPNKPVANK 426
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK    +KP  NK
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK 130          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3B4XIT1 (Histone H2A OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.357e-55
Identity = 87/131 (66.41%), Postives = 103/131 (78.63%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQ 459
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP  + E R  K +  Q
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAGDDEGRGKKHVLDQ 139          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3B4VF88 (Histone H2A OS=Seriola dumerili OX=41447 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.357e-55
Identity = 87/131 (66.41%), Postives = 103/131 (78.63%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQ 459
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP  + E R  K +  Q
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAGDDEGRGKKHVLDQ 139          
BLAST of Histone H2A vs. TrEMBL
Match: I3JF64 (Histone H2A OS=Oreochromis niloticus OX=8128 GN=LOC100704896 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.654e-55
Identity = 88/125 (70.40%), Postives = 106/125 (84.80%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            SRSSRAG+TFPVGR+HRLLRKG + +RIG GA VYMS++LEYL AEILELAGNA+RDNKKSRIAPRHILLA+KND EL++LL  VTIS GGV+PNIQ +LLPK   K   +K++ + K ++SQEF
Sbjct:   17 SRSSRAGITFPVGRIHRLLRKGNYAKRIGVGASVYMSSVLEYLCAEILELAGNASRDNKKSRIAPRHILLAVKNDDELNKLLAGVTISDGGVIPNIQASLLPK---KTKTSKDDNSAKDVQSQEF 138          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3Q1IF10 (Histone H2A OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.127e-55
Identity = 87/125 (69.60%), Postives = 105/125 (84.00%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            SRSSRAG+TFPVGR+HRLLRKG + ER+G GA VY+SA+LEYL AEILELAGNA+RDNKK RIAPRHILLA+KND EL++LL  VTIS+GGV+PNIQ +LLPK    P   K++ + K ++SQEF
Sbjct:   17 SRSSRAGITFPVGRIHRLLRKGNYAERVGTGAAVYLSAVLEYLCAEILELAGNASRDNKKHRIAPRHILLAVKNDEELNKLLAGVTISEGGVIPNIQASLLPKKTKAP---KDDSSAKDVQSQEF 138          
BLAST of Histone H2A vs. TrEMBL
Match: A0A3B3Z2X9 (Histone H2A OS=Poecilia mexicana OX=48701 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 2.622e-55
Identity = 85/128 (66.41%), Postives = 104/128 (81.25%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVI 450
            GK +    +RSSRAGL FPVGRVHRLLRKG +GER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP   K+ +  K++
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYGERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKAKQEQTQKIL 136          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000040985.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:27523804:27524807:1 gene:ENSAMXG00000035879.1 transcript:ENSAMXT00000040985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 1.856e-56
Identity = 84/123 (68.29%), Postives = 99/123 (80.49%), Query Frame = 1
Query:   58 GAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            G   K +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP  +K
Sbjct:    8 GFSSKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKSK 130          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000025817.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000522.1:47764:48404:-1 gene:ENSAMXG00000025091.2 transcript:ENSAMXT00000025817.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 5.072e-56
Identity = 83/120 (69.17%), Postives = 98/120 (81.67%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K V  K
Sbjct:   11 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKAK 130          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000050088.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10166233:10171033:1 gene:ENSAMXG00000038836.1 transcript:ENSAMXT00000050088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 9.042e-56
Identity = 83/120 (69.17%), Postives = 98/120 (81.67%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K V  K
Sbjct:   12 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKAVKAK 131          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: ENSAMXT00000026274.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10145526:10150789:1 gene:ENSAMXG00000025549.2 transcript:ENSAMXT00000026274.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 4.898e-55
Identity = 81/115 (70.43%), Postives = 96/115 (83.48%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEK 123          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2ax (H2A.X variant histone [Source:NCBI gene;Acc:394048])

HSP 1 Score: 170.629 bits (431), Expect = 1.270e-54
Identity = 80/111 (72.07%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKARAKSKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 3.674e-58
Identity = 85/133 (63.91%), Postives = 104/133 (78.20%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            GK +    SRSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYL+AEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ  LLPK   +  ++      K  +SQE+
Sbjct:    9 GKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTGQAASSGGKAGKKSSQSQEY 141          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 3.251e-55
Identity = 82/122 (67.21%), Postives = 101/122 (82.79%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK--TPNKPVANK 426
            GK +    SRSSRAGL FPVGRVHRLLRKG + +R+G GAPVY++A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL++L+  VTI+QGGV+PNIQ  LLPK  + N P+A K
Sbjct:    9 GKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKKTSQNHPLACK 130          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 2.224e-54
Identity = 78/111 (70.27%), Postives = 95/111 (85.59%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + +R+G GAPVY++A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL++L+  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011166.1 (pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088:1 gene:ENSPMAG00000010139.1 transcript:ENSPMAT00000011166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 3.142e-53
Identity = 77/111 (69.37%), Postives = 94/111 (84.68%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLL KG + +R+G GAPVY++A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL++L+  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKSRAKAKSRSSRAGLQFPVGRVHRLLCKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011165.1 (pep scaffold:Pmarinus_7.0:GL476820:1017376:1017756:1 gene:ENSPMAG00000010138.1 transcript:ENSPMAT00000011165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 2.823e-52
Identity = 76/111 (68.47%), Postives = 93/111 (83.78%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            GK +    SRSSRAGL FPVGRVHRLLRKG + +R+  G PVY++A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL++L+  VTI+QGGV+PNIQ  LLPK
Sbjct:    9 GKSRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVVAGTPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPK 119          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 165.236 bits (417), Expect = 1.888e-53
Identity = 77/107 (71.96%), Postives = 93/107 (86.92%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS++AGLTFPVGRVHRLLR+G + +RIG GAPVY++A+LEYL AEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL +VTI+QGGV+PNI   LLPK   K
Sbjct:   18 SRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAK 124          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 165.236 bits (417), Expect = 1.888e-53
Identity = 77/107 (71.96%), Postives = 93/107 (86.92%), Query Frame = 1
Query:   91 SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            SRS++AGLTFPVGRVHRLLR+G + +RIG GAPVY++A+LEYL AEILELAGNAARDNKK+RI PRH+ LAI+ND EL++LL +VTI+QGGV+PNI   LLPK   K
Sbjct:   18 SRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAK 124          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 113.62 bits (283), Expect = 4.018e-33
Identity = 57/105 (54.29%), Postives = 76/105 (72.38%), Query Frame = 1
Query:  100 SRAGLTFPVGRVHRLLRKGKFGE-RIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            +RAGL FPVGR+ R L++   G  R+G  A +Y++A+LEYLTAE+LELAGNAA+D K  RI PRH+ LAI+ D EL  L+++ TI+ GGV+P+I   LL K   K
Sbjct:   27 ARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRA-TIASGGVLPHINKALLLKVEKK 130          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO49641 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0])

HSP 1 Score: 178.333 bits (451), Expect = 4.092e-58
Identity = 86/134 (64.18%), Postives = 106/134 (79.10%), Query Frame = 1
Query:   67 GKVKKLQ-NSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            GK+ K +  +RSSRAGL FPVGR+HR LRKG + ER+G GAPVYM+A+LEYLTAEILELAGNAARDNKKSRI PRH+ LA++ND EL++LL+ VTI+QGGV+PNIQ  LLPK  N   + K  +     +SQE+
Sbjct:    7 GKINKSKVKTRSSRAGLQFPVGRIHRFLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKKSNTGGSGKSKKGLGSSQSQEY 140          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO48283 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJL4])

HSP 1 Score: 170.244 bits (430), Expect = 5.155e-55
Identity = 81/116 (69.83%), Postives = 98/116 (84.48%), Query Frame = 1
Query:   67 GKVKKLQN-SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            GK K  ++ +RSSRAGL FPVGR+HRLLRKG + ER+G GAPVYM+A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL+ LL  VTI+QGGV+PNIQ+ LLPK   K
Sbjct:    7 GKAKGTKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLSGVTIAQGGVLPNIQSVLLPKKTEK 122          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO31130 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SYT5])

HSP 1 Score: 169.859 bits (429), Expect = 7.321e-55
Identity = 81/118 (68.64%), Postives = 96/118 (81.36%), Query Frame = 1
Query:   58 GAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            G  GK +    SRS+RAGL FPVGRVHR LRKG + ER+G GAPVYM+A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:    5 GKGGKSRAKGKSRSARAGLQFPVGRVHRFLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKRSEK 122          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO34611 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SNV0])

HSP 1 Score: 169.088 bits (427), Expect = 1.197e-54
Identity = 81/118 (68.64%), Postives = 95/118 (80.51%), Query Frame = 1
Query:   58 GAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            G  GK +    SRS+RAGL FPVGRVHR LRKG + ER+G GAPVYM+A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL+ LL  VTI+QGGV+PNIQ  LLPK   K
Sbjct:    5 GKGGKSRAKGKSRSARAGLQFPVGRVHRFLRKGNYAERVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKSEK 122          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO46356 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5])

HSP 1 Score: 166.777 bits (421), Expect = 9.649e-54
Identity = 80/118 (67.80%), Postives = 95/118 (80.51%), Query Frame = 1
Query:   58 GAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNK 411
            G  GK +    SRS++AGL FPVGRVHR LRKG + +R+G GAPVYM+A+LEYL+AEILELAGNAARDNKK+RI PRH+ LA++ND EL+ LL  VTISQGGV+PNIQ  LLPK   K
Sbjct:    5 GKGGKSRAKGKSRSAKAGLQFPVGRVHRFLRKGNYAKRVGAGAPVYMAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKKSEK 122          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000027984.1 (pep primary_assembly:ASM223467v1:1:8921530:8926502:-1 gene:ENSORLG00000030081.1 transcript:ENSORLT00000027984.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.333 bits (451), Expect = 1.181e-57
Identity = 84/123 (68.29%), Postives = 100/123 (81.30%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENR 435
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP   K+ R
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKTKQGR 131          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000000203.2 (pep primary_assembly:ASM223467v1:1:3742590:3747233:-1 gene:ENSORLG00000024975.1 transcript:ENSORLT00000000203.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 1.514e-57
Identity = 86/128 (67.19%), Postives = 102/128 (79.69%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVI 450
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP   K NR  + I
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPNGKKTNRQQRNI 136          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000042228.1 (pep primary_assembly:ASM223467v1:23:22958305:22963215:1 gene:ENSORLG00000027073.1 transcript:ENSORLT00000042228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 3.592e-57
Identity = 84/120 (70.00%), Postives = 100/120 (83.33%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANK 426
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KPV +K
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPVKSK 128          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000034627.1 (pep primary_assembly:ASM223467v1:1:1239146:1240518:-1 gene:ENSORLG00000022956.1 transcript:ENSORLT00000034627.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 1.146e-56
Identity = 83/121 (68.60%), Postives = 99/121 (81.82%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKE 429
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP   K+
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKTKK 129          
BLAST of Histone H2A vs. Ensembl Medaka
Match: ENSORLT00000042751.1 (pep primary_assembly:ASM223467v1:1:3319702:3323229:-1 gene:ENSORLG00000023254.1 transcript:ENSORLT00000042751.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 2.582e-56
Identity = 83/122 (68.03%), Postives = 99/122 (81.15%), Query Frame = 1
Query:   67 GKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKEN 432
            GK +    +RSSRAGL FPVGRVHRLLRKG + ER+G GAPVY++A+LEYLTAEILELAGNAARDNKK+RI PRH+ LA++ND EL++LL  VTI+QGGV+PNIQ  LLPK   KP    +N
Sbjct:    9 GKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPKTTGKN 130          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000072071.1 (SMESG000072071.1)

HSP 1 Score: 289.271 bits (739), Expect = 1.657e-101
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 1
Query:   37 MTKKENIGAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 465
            MTKKENIGAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF
Sbjct:    1 MTKKENIGAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF 143          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 170.244 bits (430), Expect = 1.281e-54
Identity = 84/127 (66.14%), Postives = 102/127 (80.31%), Query Frame = 1
Query:   58 GAHGKVKKLQN-SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPKTPNKPVANKENR 435
            G  GK  K Q+ +RSSRAGL FPVGR+HR LRKG F ER+G GAPVY++A+LEYL AE+LELAGNAARDNKKSRI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ +LLPK   +   + E+R
Sbjct:    5 GKAGKTTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKKAEEKKRDLEDR 131          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000067932.1 (SMESG000067932.1)

HSP 1 Score: 169.859 bits (429), Expect = 1.344e-54
Identity = 85/122 (69.67%), Postives = 100/122 (81.97%), Query Frame = 1
Query:   58 GAHGKVKKLQN-SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLP-KTPNKPV 417
            G  GK  + Q+ +RSSRAGL FPVGR+HR LRKG F ER+G GAPVY++A+LEYL AE+LELAGNAARDNKKSRI PRH+ LAI+ND EL++LL  VTISQGGV+PNIQ+ LLP KT  KP 
Sbjct:    6 GKAGKTSRNQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKKTEEKPA 127          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000018807.1 (SMESG000018807.1)

HSP 1 Score: 168.703 bits (426), Expect = 3.261e-54
Identity = 79/114 (69.30%), Postives = 96/114 (84.21%), Query Frame = 1
Query:   58 GAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            G  GK +    SRS RAGL FPVGR+HR+LRKG + ER+G GAPVY++A+LEYL AE+LELAGNAARDNKK+RI PRH+ LAI+ND EL++LL SVTI+QGGV+PNIQ+ LLPK
Sbjct:    5 GKGGKSRNKAKSRSVRAGLQFPVGRIHRMLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGSVTIAQGGVLPNIQSVLLPK 118          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 168.703 bits (426), Expect = 3.568e-54
Identity = 82/115 (71.30%), Postives = 97/115 (84.35%), Query Frame = 1
Query:   58 GAHGKVKKLQN-SRSSRAGLTFPVGRVHRLLRKGKFGERIGHGAPVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELLKSVTISQGGVMPNIQNTLLPK 399
            G  GK  K Q+ +RSSRAGL FPVGR+HR LRKG F ER+G GAPVY++A+LEYL AE+LELAGNAARDNKKSRI PRH+ LAI+ND EL++LL  VTI+QGGV+PNIQ +LLPK
Sbjct:    5 GKAGKTTKSQSKTRSSRAGLQFPVGRIHRKLRKGNFAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPK 119          
The following BLAST results are available for this feature:
BLAST of Histone H2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AJ6.710e-5674.77H2A.J histone [Source:HGNC Symbol;Acc:HGNC:14456][more]
H2AJ6.710e-5674.77H2A.J histone [Source:HGNC Symbol;Acc:HGNC:14456][more]
H2AC201.122e-5574.77H2A clustered histone 20 [Source:HGNC Symbol;Acc:H... [more]
H2AC191.473e-5574.77H2A clustered histone 19 [Source:HGNC Symbol;Acc:H... [more]
H2AC181.473e-5574.77H2A clustered histone 18 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Histone H2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-355.155e-5369.03Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-355.155e-5369.03Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-687.638e-5372.82Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-657.638e-5372.82Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
his-617.638e-5372.82Histone H2A [Source:UniProtKB/Swiss-Prot;Acc:P095... [more]
back to top
BLAST of Histone H2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2A:CG338535.635e-5371.03gene:FBgn0053853 transcript:FBtr0091857[more]
His2A:CG338595.635e-5371.03gene:FBgn0053859 transcript:FBtr0091863[more]
His2A:CG338565.635e-5371.03gene:FBgn0053856 transcript:FBtr0091860[more]
His2A:CG338505.697e-5371.03gene:FBgn0053850 transcript:FBtr0091854[more]
His2A:CG338475.697e-5371.03gene:FBgn0053847 transcript:FBtr0091851[more]
back to top
BLAST of Histone H2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h2ax16.309e-5770.00H2A.X variant histone family member 1 [Source:ZFIN... [more]
h2ax16.309e-5770.00H2A.X variant histone family member 1 [Source:ZFIN... [more]
si:ch211-113a14.192.300e-5568.33si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.192.300e-5568.33si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
si:ch211-113a14.192.300e-5568.33si:ch211-113a14.19 [Source:ZFIN;Acc:ZDB-GENE-12121... [more]
back to top
BLAST of Histone H2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h2ac15.947e-5762.59H2A clustered histone 1 [Source:NCBI gene;Acc:5949... [more]
ENSXETT00000000447.17.788e-5764.89pep primary_assembly:Xenopus_tropicalis_v9.1:3:124... [more]
lyl15.119e-5661.15lymphoblastic leukemia associated hematopoiesis re... [more]
lyl16.123e-5661.15lymphoblastic leukemia associated hematopoiesis re... [more]
trps11.121e-5569.17transcriptional repressor GATA binding 1 [Source:X... [more]
back to top
BLAST of Histone H2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2ac215.918e-5670.49H2A clustered histone 21 [Source:MGI Symbol;Acc:MG... [more]
H2aj6.395e-5671.07H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192][more]
H2aj7.640e-5674.77H2J.A histone [Source:MGI Symbol;Acc:MGI:3606192][more]
H2ac207.700e-5674.77H2A clustered histone 20 [Source:MGI Symbol;Acc:MG... [more]
H2ac181.011e-5574.77H2A clustered histone 18 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Histone H2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70082|H2AJ_CHICK1.080e-5575.68Histone H2A.J OS=Gallus gallus OX=9031 GN=H2A-IX P... [more]
sp|Q9BTM1|H2AJ_HUMAN3.223e-5574.77Histone H2A.J OS=Homo sapiens OX=9606 GN=H2AJ PE=1... [more]
sp|Q3ZBX9|H2AJ_BOVIN3.223e-5574.77Histone H2A.J OS=Bos taurus OX=9913 GN=H2AJ PE=2 S... [more]
sp|Q4R3X5|H2AJ_MACFA3.294e-5574.77Histone H2A.J OS=Macaca fascicularis OX=9541 GN=H2... [more]
sp|Q64522|H2A2B_MOUSE4.139e-5570.49Histone H2A type 2-B OS=Mus musculus OX=10090 GN=H... [more]
back to top
BLAST of Histone H2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4XIT11.357e-5566.41Histone H2A OS=Seriola lalandi dorsalis OX=1841481... [more]
A0A3B4VF881.357e-5566.41Histone H2A OS=Seriola dumerili OX=41447 PE=3 SV=1[more]
I3JF641.654e-5570.40Histone H2A OS=Oreochromis niloticus OX=8128 GN=LO... [more]
A0A3Q1IF102.127e-5569.60Histone H2A OS=Anabas testudineus OX=64144 PE=3 SV... [more]
A0A3B3Z2X92.622e-5566.41Histone H2A OS=Poecilia mexicana OX=48701 PE=3 SV=... [more]
back to top
BLAST of Histone H2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040985.11.856e-5668.29pep primary_assembly:Astyanax_mexicanus-2.0:20:275... [more]
ENSAMXT00000025817.25.072e-5669.17pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050088.19.042e-5669.17pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
ENSAMXT00000026274.24.898e-5570.43pep primary_assembly:Astyanax_mexicanus-2.0:21:101... [more]
h2ax1.270e-5472.07H2A.X variant histone [Source:NCBI gene;Acc:394048... [more]
back to top
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011253.13.674e-5863.91pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000002388.13.251e-5567.21pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
ENSPMAT00000005338.12.224e-5470.27pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000011166.13.142e-5369.37pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088... [more]
ENSPMAT00000011165.12.823e-5268.47pep scaffold:Pmarinus_7.0:GL476820:1017376:1017756... [more]
back to top
BLAST of Histone H2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HTA21.888e-5371.96Histone H2A; core histone protein required for chr... [more]
HTA11.888e-5371.96Histone H2A; core histone protein required for chr... [more]
HTZ14.018e-3354.29Histone variant H2AZ; exchanged for histone H2A in... [more]
back to top
BLAST of Histone H2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496414.092e-5864.18Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RFQ0][more]
EDO482835.155e-5569.83Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RJL4][more]
EDO311307.321e-5568.64Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SYT5][more]
EDO346111.197e-5468.64Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SNV0][more]
EDO463569.649e-5467.80Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQF5][more]
back to top
BLAST of Histone H2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027984.11.181e-5768.29pep primary_assembly:ASM223467v1:1:8921530:8926502... [more]
ENSORLT00000000203.21.514e-5767.19pep primary_assembly:ASM223467v1:1:3742590:3747233... [more]
ENSORLT00000042228.13.592e-5770.00pep primary_assembly:ASM223467v1:23:22958305:22963... [more]
ENSORLT00000034627.11.146e-5668.60pep primary_assembly:ASM223467v1:1:1239146:1240518... [more]
ENSORLT00000042751.12.582e-5668.03pep primary_assembly:ASM223467v1:1:3319702:3323229... [more]
back to top
BLAST of Histone H2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072071.11.657e-101100.00SMESG000072071.1[more]
SMESG000006040.11.281e-5466.14SMESG000006040.1[more]
SMESG000067932.11.344e-5469.67SMESG000067932.1[more]
SMESG000018807.13.261e-5469.30SMESG000018807.1[more]
SMESG000006040.13.568e-5471.30SMESG000006040.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002436 ID=SMED30002436|Name=Histone H2A|organism=Schmidtea mediterranea sexual|type=transcript|length=565bp
TATATCGCAATTTGTTTATCATTTTAAAATTTGAATATGACAAAGAAAGA
AAATATTGGTGCTCATGGAAAAGTCAAGAAGCTACAAAATTCTCGATCTT
CTCGTGCTGGACTAACTTTTCCAGTTGGCCGCGTTCACCGTTTGTTACGA
AAAGGAAAGTTTGGTGAAAGAATTGGACATGGTGCGCCAGTCTATATGTC
AGCTATTCTTGAATATTTAACTGCTGAAATTTTGGAGTTGGCTGGAAACG
CGGCAAGAGATAATAAGAAATCAAGAATTGCTCCTCGTCATATTTTATTG
GCTATTAAAAATGATTCTGAATTGAGCGAGTTGCTGAAATCTGTTACTAT
TTCTCAAGGTGGAGTTATGCCAAATATCCAAAATACTTTGCTACCAAAAA
CACCGAATAAGCCAGTTGCGAACAAAGAGAATCGAGCACCTAAAGTAATC
GAGTCTCAAGAATTTTGAATATTTCATAGATTTTGTAATAGATGTGCTAG
ATTTTGTATGCTACTATTTGGGTTAGCTAGAATAGAATATATGTTTTTTT
GATGTTGAAAAAAAA
back to top

protein sequence of SMED30002436-orf-1

>SMED30002436-orf-1 ID=SMED30002436-orf-1|Name=SMED30002436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MTKKENIGAHGKVKKLQNSRSSRAGLTFPVGRVHRLLRKGKFGERIGHGA
PVYMSAILEYLTAEILELAGNAARDNKKSRIAPRHILLAIKNDSELSELL
KSVTISQGGVMPNIQNTLLPKTPNKPVANKENRAPKVIESQEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042742defense response to bacterium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR032454Histone_H2A_C
IPR009072Histone-fold
IPR007125Histone_H2A/H2B/H3
IPR032458Histone_H2A_CS
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0000786nucleosome
GO:0005694chromosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 60..73
score: 90.95
coord: 45..60
score: 68.63
coord: 74..88
score: 71.62
coord: 102..120
score: 64.91
coord: 16..38
score: 67.74
IPR002119Histone H2ASMARTSM00414h2a4coord: 6..125
e-value: 2.9E-68
score: 242.8
IPR002119Histone H2ACDDcd00074H2Acoord: 11..121
e-value: 2.03382E-62
score: 185.231
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 95..125
e-value: 1.0E-14
score: 53.9
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 6..130
e-value: 1.4E-56
score: 191.7
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 10..128
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 15..91
e-value: 1.1E-15
score: 58.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 123..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR23430HISTONE H2Acoord: 11..129
NoneNo IPR availablePANTHERPTHR23430:SF20CORE HISTONE MACRO-H2A.1coord: 11..129
IPR032458Histone H2A conserved sitePROSITEPS00046HISTONE_H2Acoord: 24..30