Transient receptor potential cation channel subfamily M member 2

Overview
NameTransient receptor potential cation channel subfamily M member 2
Smed IDSMED30002434
Length (bp)3361
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member 2 (SMED30002434) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 2 (SMED30002434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member 2 (SMED30002434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 2 (SMED30002434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002434

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002434SMESG000004911.1 dd_Smed_v4_18934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002434SMESG000004911.1 dd_Smed_v6_18934_0_6dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30002434SMESG000078916.1 SMESG000004911.1 Contig9876newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30002434SMESG000078916.1 SMESG000004911.1 Contig9876uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 227.639 bits (579), Expect = 3.525e-60
Identity = 277/1151 (24.07%), Postives = 526/1151 (45.70%), Query Frame = 1
Query:  187 QISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLES--------KDCPYGDLLNDLIIS----------------------------KNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENN----SNSADKFIN------GNSFSTNKEVFKISFASNFYKNN-ENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC-----KTTSCIIQYRTVIFG-------FAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWN---TRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            ++S N+  Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY              +D   G+L  D  IS                             +  FG +   +  LL     I       + +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P       I SL +K++++    S + +  +           +  KE   +   +   +NN E+ R  +     +++K+  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV++      +R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+  D  C     +    IIQ      G        A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  114 RLSRNDI-QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDI------PLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPP------SILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEE--VQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM------ERWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI-DPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1209          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 227.254 bits (578), Expect = 8.328e-60
Identity = 239/1080 (22.13%), Postives = 484/1080 (44.81%), Query Frame = 1
Query:  178 FSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN--CTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFS----EIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI--------------------------ISKN------------------KTFGFQNKTSGNLLD-----------ETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVI---SNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPVFVIFSLIYKSENNSNSADK--------FINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            +S+ IS+ +  +++ ++       +P D FG+I F+        +H +  ++     +T       L+ K W+   P LVISV GG++N     S+ +  F + L +  +T   WII  G++ GVSK VG+ + ++   S    +   +G+   GV++N   LI  +  C Y       +    LN  +  ++  DDG+     N+ +   + EKYL       ++  GVPV+ +++ G    + ++  ++ +  P+++ + +G  +D  +     + ++  +  +  E++  + +   +  +K  K  F+I  +C        +V +D I   ++FD      +D D+              ++  +L++ ++  ++ +  I         KP+ L++ +   L  +++ F++L   + + +   +T   LE LY     +K  P   LL+ L+                          I +                   + +  Q  +SGN  +            T +  +F  ++I+      KS +  VS +   T     Y DL +WA+L    +M++ FW+  ++    A++  I+   M +    K   ++   S +L   SK+F +LA+ ++++A ++++R    +LT  L   +N +CL++AV+G L  F++H+  +    + WMG L      W KI+++I+  P       I +L +KS+   +   +        + +  + S++KE   +    +  + ++ K   N   GL     +   T+K  E FY AP+VKF  Y ++Y+ FL+ F Y  LVE++P       Q    E+ V IYI    ++ V++  I+  GK     + K  IS  WN+ +   I +     V+R+  P  F    R ++ +    +  R + F+ ++   GP V MI KM  ++F+ + I  + ++S+G    ++ +P     +SL  +I + P++  +GE+   E  D      SC        F  A++L +  ++++NLLIA F + + ++++ S  ++   + + +  +H+K
Sbjct:   61 YSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQ------DGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQN-FTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH--SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC--------MVHRDCI---TIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYEQ--HWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELY----NTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEA--KESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPP------TILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVK-EYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYE-FYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-------QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ--KVKVWISEYWNLTETVAIGLFSAGFVLRWGDP-PFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEI-DVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEK 1093          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 227.254 bits (578), Expect = 8.778e-60
Identity = 239/1080 (22.13%), Postives = 484/1080 (44.81%), Query Frame = 1
Query:  178 FSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN--CTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFS----EIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI--------------------------ISKN------------------KTFGFQNKTSGNLLD-----------ETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVI---SNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPVFVIFSLIYKSENNSNSADK--------FINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            +S+ IS+ +  +++ ++       +P D FG+I F+        +H +  ++     +T       L+ K W+   P LVISV GG++N     S+ +  F + L +  +T   WII  G++ GVSK VG+ + ++   S    +   +G+   GV++N   LI  +  C Y       +    LN  +  ++  DDG+     N+ +   + EKYL       ++  GVPV+ +++ G    + ++  ++ +  P+++ + +G  +D  +     + ++  +  +  E++  + +   +  +K  K  F+I  +C        +V +D I   ++FD      +D D+              ++  +L++ ++  ++ +  I         KP+ L++ +   L  +++ F++L   + + +   +T   LE LY     +K  P   LL+ L+                          I +                   + +  Q  +SGN  +            T +  +F  ++I+      KS +  VS +   T     Y DL +WA+L    +M++ FW+  ++    A++  I+   M +    K   ++   S +L   SK+F +LA+ ++++A ++++R    +LT  L   +N +CL++AV+G L  F++H+  +    + WMG L      W KI+++I+  P       I +L +KS+   +   +        + +  + S++KE   +    +  + ++ K   N   GL     +   T+K  E FY AP+VKF  Y ++Y+ FL+ F Y  LVE++P       Q    E+ V IYI    ++ V++  I+  GK     + K  IS  WN+ +   I +     V+R+  P  F    R ++ +    +  R + F+ ++   GP V MI KM  ++F+ + I  + ++S+G    ++ +P     +SL  +I + P++  +GE+   E  D      SC        F  A++L +  ++++NLLIA F + + ++++ S  ++   + + +  +H+K
Sbjct:   61 YSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQ------DGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQN-FTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH--SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC--------MVHRDCI---TIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYEQ--HWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELY----NTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEA--KESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPP------TILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVK-EYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYE-FYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-------QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ--KVKVWISEYWNLTETVAIGLFSAGFVLRWGDP-PFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEI-DVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEK 1093          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 227.254 bits (578), Expect = 9.434e-60
Identity = 239/1080 (22.13%), Postives = 484/1080 (44.81%), Query Frame = 1
Query:  178 FSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN--CTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFS----EIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI--------------------------ISKN------------------KTFGFQNKTSGNLLD-----------ETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVI---SNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPVFVIFSLIYKSENNSNSADK--------FINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            +S+ IS+ +  +++ ++       +P D FG+I F+        +H +  ++     +T       L+ K W+   P LVISV GG++N     S+ +  F + L +  +T   WII  G++ GVSK VG+ + ++   S    +   +G+   GV++N   LI  +  C Y       +    LN  +  ++  DDG+     N+ +   + EKYL       ++  GVPV+ +++ G    + ++  ++ +  P+++ + +G  +D  +     + ++  +  +  E++  + +   +  +K  K  F+I  +C        +V +D I   ++FD      +D D+              ++  +L++ ++  ++ +  I         KP+ L++ +   L  +++ F++L   + + +   +T   LE LY     +K  P   LL+ L+                          I +                   + +  Q  +SGN  +            T +  +F  ++I+      KS +  VS +   T     Y DL +WA+L    +M++ FW+  ++    A++  I+   M +    K   ++   S +L   SK+F +LA+ ++++A ++++R    +LT  L   +N +CL++AV+G L  F++H+  +    + WMG L      W KI+++I+  P       I +L +KS+   +   +        + +  + S++KE   +    +  + ++ K   N   GL     +   T+K  E FY AP+VKF  Y ++Y+ FL+ F Y  LVE++P       Q    E+ V IYI    ++ V++  I+  GK     + K  IS  WN+ +   I +     V+R+  P  F    R ++ +    +  R + F+ ++   GP V MI KM  ++F+ + I  + ++S+G    ++ +P     +SL  +I + P++  +GE+   E  D      SC        F  A++L +  ++++NLLIA F + + ++++ S  ++   + + +  +H+K
Sbjct:   66 YSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQ------DGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQN-FTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH--SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC--------MVHRDCI---TIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYEQ--HWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELY----NTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEA--KESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPP------TILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVK-EYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYE-FYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-------QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ--KVKVWISEYWNLTETVAIGLFSAGFVLRWGDP-PFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEI-DVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEK 1098          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 223.787 bits (569), Expect = 8.638e-59
Identity = 277/1151 (24.07%), Postives = 527/1151 (45.79%), Query Frame = 1
Query:  187 QISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLES--------KDCPYGDLLNDLIIS----------------------------KNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENN----SNSADKFIN------GNSFSTNKEVFKISFASNFYKNN-ENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC-----KTTSCIIQYRTVIFG-------FAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWN---TRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            ++S N+  Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY              +D   G+L  D  IS                             +  FG +   +  LL     I       + +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P +L      SL +K++++    S + +  +           +  KE   +   +   +NN E+ R  +     +++K+  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV++      +R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+  D  C     +    IIQ      G        A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  114 RLSRNDI-QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDI------PLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSIL------SLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEE--VQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKM------ERWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI-DPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHLCCRWRKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1209          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 191.815 bits (486), Expect = 2.958e-49
Identity = 263/1148 (22.91%), Postives = 492/1148 (42.86%), Query Frame = 1
Query:  157 TGVFCFFFSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN--CTYPRASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQ----NILGVPVIRIMLGGERCELETIH--MSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDV------EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY--------------MISLESKDCPYGDLLNDLI---ISKNKTFGFQ----NKTSGNLLDETYKIVQ----FLSENILKSSLTDKSIKNQVSLN------LAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISN----------QLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIF-----------------SLIYKSEN-NSNSADKFINGNSFSTNKEVF--------KISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVE--LKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPN-GEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNL---IYYFLKKIWNTR---NRIFKKSNTRKSSIF---IKYLADCEKMQILAFERI 3279
            T    FF +  +   E  Q  ++T +   + +  D FG+I F+G        H +  ++     ++   +   L+ K+W   +P LVI+V GG+ N   +  +L R F++ + +  +T   WII SGLD GV + V + +      +R ++Q   IG++  GV+K  E+LI  N    Y   S   N     LN+ +  +L  D+G+      D     + E ++     N   VPV+  +L G    +  IH  +++  ++P I+   SG  +D  S  F    IN          EKLR L +M   E    Q+  F   ++C        ++R DL+    +F       +D D +              +   L++ +N  ++ ++ +F   N  +   + L+K +   L  +++ F+E      + +   ++   LE LY              M + +S D P+  L   +I   + K     FQ    +++     D   +I Q         I++  L  K   +Q++ N       A  + DL +WA+LT    M+   W   +D +   ++          + LYK    I+           +L +++ K  E AI ++ +        T  +L   L    N +CL +AV  N   FL H  C+    E W G L         +LT L  P  + +F+ +                  L Y  E+  S +++++         KE          K++  S+  KN+        ++ ++  +  ++   +   AFY +P+ KF  + I++++FL     + L+E  LKP     +Y     E+  +IY +   V+ ++++  +       + K   +  +N++  + +L  ++    R  VP     + R L   +  L+ ++  ++  + P +GP + M  KM+  + +   + L+ ++++G    +L  PN  ++ + LV NIFY+P+F  +GE+   E      +   C   Y        IFLL+ N+LLLNLLIA+F + +N+   +S++I+   + Q + E+H  P +PPPF++   +Y+F+  ++N R    + F+  ++ K S+    +K + D E+  I    RI
Sbjct:  121 TPASTFFSTLPVHLLEKEQ-QTWTIANNTQTSTTDAFGTIVFQG------GAHAHKAQYVRLSYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEE-RLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALDEAGISARMRSQIVTIGIAPWGVIKRKERLIRQNEHVYYDVHSLSVNANVGILNDRHSYFLLADNGTVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIIS--FAARYINSDGTFAAEVGEKLRNLIKMVFPETD--QEEMFRKITEC--------VIRDDLL---RIFRYGQEEEEDVDFVILSTVLQKQNLPPDEQLALTLSWNRVDLAKSCLFS--NGRKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMD-PHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRYKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLA---------IRLYKATAKIAEDEYLDVEEAKRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAI-LFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISS-RKNSGVASVYGSASSMMFKREPQLNKFERFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETSLKP----SKY-----EWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAALLFFLVGYGFRL-VPMYRHSWGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWSMCYICVLLLVPLMAFGVNRQALTEPNVKDWHWLLVRNIFYKPYFMLYGEVYAGEIDTCGDEGIRCFPGYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSPFLPPPFSIFAHVYHFIDYLYNLRRPDTKRFRSEHSIKLSVTEDEMKRIQDFEEDCIDTLTRI 1221          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 109.768 bits (273), Expect = 6.698e-24
Identity = 117/489 (23.93%), Postives = 219/489 (44.79%), Query Frame = 1
Query:  199 NETNQTDS-FTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTF--NLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL----QNILGVPVIRIMLGGERCELETIH--MSLMENLPLILIKNSGGLSDFFSEIFEQEKI--------NIKD--VEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTI---KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQ 1599
            NE N T   ++     E  P D +G+I FEG     +  H  + R      ++  ++   L+ K+W+   P L+I++ GGL  +     +L R F++ + +I K+   WII SGLD GV K +   +  +   +  +N    IG++S G++K   + +  + T   A+   N T    LN+ +  +LF D+G+ N    +       E YL    +    +P++ ++L G    ++ +H  ++ +  +P+I+   SG  +D  +  F  + +        NI++  V  +R +F  +     K  K   E  S  K+L+TI    +  R+DL     V    + + ++     +L  L++ +N  ++  T IF   N ++   + L   ++  LS ++I F+ L     + + + +T   LE LY     +   P   L  +L++                L E  ++V+ L  N+ KS+ T +  KNQ
Sbjct:  173 NEVNLTPGRWSIQSHTEIVPTDAYGNIVFEG-----TAHHAQYARI---SFDSDPRDIVHLMMKVWKLKPPKLIITINGGL-TKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNHT-SKNHVVAIGIASWGMLKQRSRFVGKDSTVTYATNVFNNTRLKELNDNHSYFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILA--FAHQAVSQNGFLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVEC-STNKSLMTIFRLGESSREDL---DHVIMSCLLKGQNLSPPEQL-QLALAWNRADIARTEIFA--NGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLY----NTDKGPQNTLRTNLLVDSKHHIK---------LVEVGRLVENLMGNLYKSNYTKEEFKNQ 629          

HSP 2 Score: 76.2554 bits (186), Expect = 1.351e-13
Identity = 86/377 (22.81%), Postives = 180/377 (47.75%), Query Frame = 1
Query: 2278 KKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLET-----------FYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELM---LDEFQDSVCKT---------------TSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY--FLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            KK +  FYKAP+  + ++  +++ FL+   Y  LV+ + I           E++V+ YI  + ++  +++ +   ++T           F++++ G+        F  +L  +I   +R S   +     R L      ++ L+ + +  +   +GP + ++ +MI  +     +  + + ++G L  S+  P  ++ + LV NIF +P+F  +GE+    +D   D + +T                +C+  Y     G  +F+L TNVLL+N+++A     F +    + +IF   +   V E+   P +PPPF +IY+  +L K+  + +R+F++ N    S+ + +L+  E  ++  FE  S+E +  +TE++
Sbjct: 1067 KKKIMEFYKAPITTYWLWFFAFIWFLILLTYNLLVKTQRIASWS-------EWYVFAYIFVWTLEIGRKVVSTIMMDTSKPVLKQLRVFFFQYRNGLLA------FG-LLTYLIAYFIRLSPTTK--TLGRILIICNSVIWSLKLVDYLSVQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYEDWHWILVRNIFLQPYFMLYGEVYAAEIDTCGDEIWQTHEDENIPISMLNVTHETCVPGYWIAPVGLTVFMLATNVLLMNVMVAGCTYIFEKHIQSTREIFLFERYGQVMEYESTPWLPPPFTIIYHVIWLFKLIKSSSRMFERKNLFDQSLKL-FLSPDEMEKVHTFEEESVEDMKRETEKK 1426          

HSP 3 Score: 64.6994 bits (156), Expect = 4.203e-10
Identity = 36/130 (27.69%), Postives = 62/130 (47.69%), Query Frame = 1
Query: 1624 YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDL 2010
            Y DL +WA+LT   +M+ + W   ++ +  A+V + +   + K   L  G+  +S    E S +F ELA+ V++   +  +  T  +LT  L    + +CL +A       FL H  C+    + W G L
Sbjct:  717 YSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGL 846          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.0409 bits (214), Expect = 6.536e-17
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  259 DMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTF-NLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---QNILG----VPVIRIMLGGERCELETI--HMSLMENLPLILIKNSGGLSDFFS 963
            + FG + F+G        HP   ++     +T       L   +WQ   P L+I+V GG  N   +  +L R F++ L +   T   WII SG D GV K V   +   +   R  N+   IG++  G++K  E  I  + T P     S G F  LN  +  +L  D+G+      +       E Y+   Q I G    VPV+ ++L G  C + ++  +++ +  +P+++   SG  +D  +
Sbjct:  275 NAFGQVEFQG------GPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQ-PKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR--NKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLA 510          

HSP 2 Score: 70.4774 bits (171), Expect = 8.451e-12
Identity = 52/205 (25.37%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 2296 FYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF 2910
            FY AP+  F  + IS+++F+  F Y  LV+  P   V       +E+ +  Y+  F +++V++I  +     + + +  +   WN     TIL  I  +V  F        + R +      L+ ++ + +  + P +GP V M  KMI ++ + + + ++ ++S+G    S+  P+  + + LV NIF +P+F  +GE+  DE 
Sbjct: 1201 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCV---TILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEI 1395          

HSP 3 Score: 63.5438 bits (153), Expect = 8.812e-10
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 1
Query: 1570 SLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEE----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLS-PFFPMWKILLTILFSPFL 2067
            SLT  S  +Q   +    Y +L +WA+LT   +M++  W+  ++    AM  A++  ++ K+L     +  +  ++ E  KK+ E    L++ ++          T  +LT  L   +N +CL +AV  N  HFL H  C+    + W G L        K++L ++  PF+
Sbjct:  834 SLTSASDGSQTEPDFRYPYSELMIWAVLTKRQDMAMCMWQHGEE----AMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1001          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.0409 bits (214), Expect = 7.269e-17
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  259 DMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTF-NLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---QNILG----VPVIRIMLGGERCELETI--HMSLMENLPLILIKNSGGLSDFFS 963
            + FG + F+G        HP   ++     +T       L   +WQ   P L+I+V GG  N   +  +L R F++ L +   T   WII SG D GV K V   +   +   R  N+   IG++  G++K  E  I  + T P     S G F  LN  +  +L  D+G+      +       E Y+   Q I G    VPV+ ++L G  C + ++  +++ +  +P+++   SG  +D  +
Sbjct:  315 NAFGQVEFQG------GPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQ-PKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR--NKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLA 550          

HSP 2 Score: 70.0922 bits (170), Expect = 9.466e-12
Identity = 52/205 (25.37%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 2296 FYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF 2910
            FY AP+  F  + IS+++F+  F Y  LV+  P   V       +E+ +  Y+  F +++V++I  +     + + +  +   WN     TIL  I  +V  F        + R +      L+ ++ + +  + P +GP V M  KMI ++ + + + ++ ++S+G    S+  P+  + + LV NIF +P+F  +GE+  DE 
Sbjct: 1241 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCV---TILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEI 1435          

HSP 3 Score: 63.5438 bits (153), Expect = 1.047e-9
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 1
Query: 1570 SLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEE----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLS-PFFPMWKILLTILFSPFL 2067
            SLT  S  +Q   +    Y +L +WA+LT   +M++  W+  ++    AM  A++  ++ K+L     +  +  ++ E  KK+ E    L++ ++          T  +LT  L   +N +CL +AV  N  HFL H  C+    + W G L        K++L ++  PF+
Sbjct:  874 SLTSASDGSQTEPDFRYPYSELMIWAVLTKRQDMAMCMWQHGEE----AMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1041          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 87.0409 bits (214), Expect = 7.507e-17
Identity = 65/245 (26.53%), Postives = 109/245 (44.49%), Query Frame = 1
Query:  259 DMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTF-NLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---QNILG----VPVIRIMLGGERCELETI--HMSLMENLPLILIKNSGGLSDFFS 963
            + FG + F+G        HP   ++     +T       L   +WQ   P L+I+V GG  N   +  +L R F++ L +   T   WII SG D GV K V   +   +   R  N+   IG++  G++K  E  I  + T P     S G F  LN  +  +L  D+G+      +       E Y+   Q I G    VPV+ ++L G  C + ++  +++ +  +P+++   SG  +D  +
Sbjct:  376 NAFGQVEFQG------GPHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQ-PKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQSAQR--NKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLA 611          

HSP 2 Score: 70.0922 bits (170), Expect = 9.044e-12
Identity = 52/205 (25.37%), Postives = 101/205 (49.27%), Query Frame = 1
Query: 2296 FYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF 2910
            FY AP+  F  + IS+++F+  F Y  LV+  P   V       +E+ +  Y+  F +++V++I  +     + + +  +   WN     TIL  I  +V  F        + R +      L+ ++ + +  + P +GP V M  KMI ++ + + + ++ ++S+G    S+  P+  + + LV NIF +P+F  +GE+  DE 
Sbjct: 1302 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV-------IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCV---TILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTMKLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFGLARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEI 1496          

HSP 3 Score: 63.929 bits (154), Expect = 8.299e-10
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 1
Query: 1570 SLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEE----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLS-PFFPMWKILLTILFSPFL 2067
            SLT  S  +Q   +    Y +L +WA+LT   +M++  W+  ++    AM  A++  ++ K+L     +  +  ++ E  KK+ E    L++ ++          T  +LT  L   +N +CL +AV  N  HFL H  C+    + W G L        K++L ++  PF+
Sbjct:  935 SLTSASDGSQTEPDFRYPYSELMIWAVLTKRQDMAMCMWQHGEE----AMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICPPFI 1102          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 188.734 bits (478), Expect = 2.640e-48
Identity = 239/1072 (22.29%), Postives = 471/1072 (43.94%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP--RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-------LGVPVIRIMLGGE----RCELETIHMSLMENLPLILIKNSGGLSDFFSEIF------EQEKI--NIKD--VEKLRTLFEMNDDELVK-YQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISR--NKDHDMIAKLFDLSIRFNCPNVVETRIF----QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------------------LNDLIISKNKTFG--FQNKTSGNLLDETYKIVQFLSENILKSSLTDK----SIKNQVSLNLAV------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKG-QTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPM-WKILLTILFSPFLLPVFVIFSLIYKSENN-------------SNSADKFINGNSFSTNKEVFKISFASNFYKNNEN-------------KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFF--VYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
             P D +G+I F+G        HP   ++     +T  +   +L  K W    P L+I+V GG K      ++L++  ++ L +  KT   WI   G + GV+K VG+ +    +G +   +   IG++  G+V+   +L+ +N   P    S   +    LN  +  +L  D+G+      +       EK++ N+          PV+ +++ G     R  LE +  S    +P+++   SG  +D  + +       E++ +  +++D  +  ++  FE+  D+  K YQ++      QC   KNL+T+ +I  K     + +   I++      H    +   L++ +N  ++  + IF    + PN +      L + ++  L  ++I F++L     + + + +T   LE LY     +K  P   L                  L+D+ +  NK  G  +++  +       Y  V     N  + S T +    +  N +SL   +             + +L +WA+LT   +M+L+ W   ++ +  ++V   +   M +        T I  +L   +K+FE     ++  +  +     + +LT  L + +N SCL +AV  N    L H   +    + WMG L       +K++L +         F I  L +KS+               + + D   +  S    + +   +++    K +EN             + F N+S      ++  +  KK    FY AP+ KF    I+Y+ FL+ F +  LV++   EQ+ R+Q    E++   YI  LGF  ++V++I ++  +   ++F       WN  D + I++ +I +  RF   +      R ++ +    + LR +    ++  +GP V M+ KM+ ++ +F+ +  + ++S+G    ++  PN +  +SL+  + ++P+F  +GE+   +  D  C        C+  +       +++LL+ N+LL+NLLIA+F + FNE+ + S +++   +  +V E+ QKP++PPPF  + +F
Sbjct:   71 QPTDAYGTIEFQG------GAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL--LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDS--PPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELL-----QCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGA------LDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELY----NTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMP------FYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKM---EQMPRWQ----EWYSIAYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFR--ENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI-DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHF 1098          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 184.882 bits (468), Expect = 6.898e-47
Identity = 246/1070 (22.99%), Postives = 474/1070 (44.30%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP--RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-------LGVPVIRIMLGGE----RCELETIHMSLMENLPLILIKNSGGLSDFFSEIF------EQEKI--NIKD--VEKLRTLFEMNDDELVK-YQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISR--NKDHDMIAKLFDLSIRFNCPNVVETRIF----QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------------------LNDLIISKNKTFG--FQNKTSGNLLDETYKIVQFLSENILKSSLTDK----SIKNQVSLNLAV------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKG-QTVISNQLVESSKKFEE-----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPM-WKILLTILFSPFLLPVFVIFSLIYKSE-------------------NNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFF--VYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
             P D +G+I F+G        HP   ++     +T  +   +L  K W    P L+I+V GG  N     ++L++  ++ L +  KT   WI   G + GV+K VG+ +    +G +   +   IG++  G+V+   +L+ +N   P    S   +    LN  +  +L  D+G+      +       EK++ N+          PV+ +++ G     R  LE +  S    +P+++   SG  +D  + +       E++ +  +++D  +  ++  FE+  D+  K YQ++      QC   KNL+T+ +I  K     + +   I++      H    +   L++ +N  ++  + IF    + PN +      L + ++  L  ++I F++L     + + + +T   LE LY     +K  P   L                  L+D+ +  NK  G  +++  +       Y  V     N  + S T +    +  N +SL   +             + +L +WA+LT   +M+L+ W   ++ +  ++V   +   M +        T I  +L   +K+FE      L  +  Q+A E++QR    +LT  L + +N SCL +AV  N    L H   +    + WMG L       +K++L +         F I  L +KS+                   +N +S     +     T+ +  +     N  + NE K+   +    +K K+YE         FY AP+ KF    I+Y+ FL+ F +  LV++   EQ+ R+Q    E++   YI  LGF  ++V++I ++  +   ++F       WN  D + I++ +I +  RF   +      R ++ +    + LR +    ++  +GP V M+ KM+ ++ +F+ +  + ++S+G    ++  PN +  +SL+  + ++P+F  +GE+   +  D  C        C+  +       +++LL+ N+LL+NLLIA+F + FNE+ + S +++   +  +V E+ QKP++PPPF  + +F
Sbjct:   71 QPTDAYGTIEFQG------GAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKAN-FDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL--LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDS--PPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELL-----QCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGA------LDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELY----NTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDA-EKAQR----LLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMP------FYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSEYNEVKQHQPLR---LKKKFYE---------FYTAPITKFWADSIAYMFFLIMFSFTVLVKM---EQMPRWQ----EWYSIAYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFR--ENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI-DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHF 1079          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339076)

HSP 1 Score: 182.57 bits (462), Expect = 4.451e-46
Identity = 245/1077 (22.75%), Postives = 477/1077 (44.29%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP--RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-------LGVPVIRIMLGGE----RCELETIHMSLMENLPLILIKNSGGLSDFFSEIF------EQEKI--NIKD--VEKLRTLFEMNDDELVK-YQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISR--NKDHDMIAKLFDLSIRFNCPNVVETRIF----QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------------------LNDLIISKNKTFG--FQNKTSGNLLDETYKIVQFLSENILKSSLTDK----SIKNQVSLNLAV------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKG-QTVISNQLVESSKKFEE-----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPM-WKILLTILFSPFLLPVFVIFSLIYKSENN-------------SNSADKFINGNSFSTNKEVFKISFASNFYKNNEN-------------KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFF--VYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
             P D +G+I F+G        HP   ++     +T  +   +L  K W    P L+I+V GG  N   + ++L++  ++ L +  KT   WI   G + GV+K VG+ +    +G +   +   IG++  G+V+   +L+ +N   P    S   +    LN  +  +L  D+G+      +       EK++ N+          PV+ +++ G     R  LE +  S    +P+++   SG  +D  + +       E++ +  +++D  +  ++  FE+  D+  K YQ++      QC   KNL+T+ +I  K     + +   I++      H    +   L++ +N  ++  + IF    + PN +      L + ++  L  ++I F++L     + + + +T   LE LY     +K  P   L                  L+D+ +  NK  G  +++  +       Y  V     N  + S T +    +  N +SL   +             + +L +WA+LT   +M+L+ W   ++ +  ++V   +   M +        T I  +L   +K+FE      L  +  Q+A E++QR    +LT  L + +N SCL +AV  N    L H   +    + WMG L       +K++L +         F I  L +KS+               + + D   +  S    + +   +++    K +EN             + F N+S      ++  +  KK    FY AP+ KF    I+Y+ FL+ F +  LV++   EQ+ R+Q    E++   YI  LGF  ++V++I ++  +   ++F       WN  D + I++ +I +  RF   +      R ++ +    + LR +    ++  +GP V M+ KM+ ++ +F+ +  + ++S+G    ++  PN +  +SL+  + ++P+F  +GE+   +  D  C        C+  +       +++LL+ N+LL+NLLIA+F + FNE+ + S +++   +  +V E+ QKP++PPPF  + +F
Sbjct:   71 QPTDAYGTIEFQG------GAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQ-AKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL--LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDS--PPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELL-----QCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGA------LDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELY----NTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDA-EKAQR----LLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMP------FYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKM---EQMPRWQ----EWYSIAYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFR--ENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI-DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHF 1098          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 182.185 bits (461), Expect = 5.412e-46
Identity = 245/1077 (22.75%), Postives = 477/1077 (44.29%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP--RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-------LGVPVIRIMLGGE----RCELETIHMSLMENLPLILIKNSGGLSDFFSEIF------EQEKI--NIKD--VEKLRTLFEMNDDELVK-YQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISR--NKDHDMIAKLFDLSIRFNCPNVVETRIF----QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------------------LNDLIISKNKTFG--FQNKTSGNLLDETYKIVQFLSENILKSSLTDK----SIKNQVSLNLAV------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKG-QTVISNQLVESSKKFEE-----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPM-WKILLTILFSPFLLPVFVIFSLIYKSENN-------------SNSADKFINGNSFSTNKEVFKISFASNFYKNNEN-------------KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFF--VYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
             P D +G+I F+G        HP   ++     +T  +   +L  K W    P L+I+V GG  N   + ++L++  ++ L +  KT   WI   G + GV+K VG+ +    +G +   +   IG++  G+V+   +L+ +N   P    S   +    LN  +  +L  D+G+      +       EK++ N+          PV+ +++ G     R  LE +  S    +P+++   SG  +D  + +       E++ +  +++D  +  ++  FE+  D+  K YQ++      QC   KNL+T+ +I  K     + +   I++      H    +   L++ +N  ++  + IF    + PN +      L + ++  L  ++I F++L     + + + +T   LE LY     +K  P   L                  L+D+ +  NK  G  +++  +       Y  V     N  + S T +    +  N +SL   +             + +L +WA+LT   +M+L+ W   ++ +  ++V   +   M +        T I  +L   +K+FE      L  +  Q+A E++QR    +LT  L + +N SCL +AV  N    L H   +    + WMG L       +K++L +         F I  L +KS+               + + D   +  S    + +   +++    K +EN             + F N+S      ++  +  KK    FY AP+ KF    I+Y+ FL+ F +  LV++   EQ+ R+Q    E++   YI  LGF  ++V++I ++  +   ++F       WN  D + I++ +I +  RF   +      R ++ +    + LR +    ++  +GP V M+ KM+ ++ +F+ +  + ++S+G    ++  PN +  +SL+  + ++P+F  +GE+   +  D  C        C+  +       +++LL+ N+LL+NLLIA+F + FNE+ + S +++   +  +V E+ QKP++PPPF  + +F
Sbjct:   89 QPTDAYGTIEFQG------GAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQ-AKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL--LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDS--PPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELL-----QCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGA------LDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELY----NTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDA-EKAQR----LLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMP------FYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKM---EQMPRWQ----EWYSIAYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFR--ENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI-DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHF 1116          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 182.185 bits (461), Expect = 5.725e-46
Identity = 245/1077 (22.75%), Postives = 477/1077 (44.29%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP--RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-------LGVPVIRIMLGGE----RCELETIHMSLMENLPLILIKNSGGLSDFFSEIF------EQEKI--NIKD--VEKLRTLFEMNDDELVK-YQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISR--NKDHDMIAKLFDLSIRFNCPNVVETRIF----QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------------------LNDLIISKNKTFG--FQNKTSGNLLDETYKIVQFLSENILKSSLTDK----SIKNQVSLNLAV------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKG-QTVISNQLVESSKKFEE-----LAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPM-WKILLTILFSPFLLPVFVIFSLIYKSENN-------------SNSADKFINGNSFSTNKEVFKISFASNFYKNNEN-------------KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFF--VYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
             P D +G+I F+G        HP   ++     +T  +   +L  K W    P L+I+V GG  N   + ++L++  ++ L +  KT   WI   G + GV+K VG+ +    +G +   +   IG++  G+V+   +L+ +N   P    S   +    LN  +  +L  D+G+      +       EK++ N+          PV+ +++ G     R  LE +  S    +P+++   SG  +D  + +       E++ +  +++D  +  ++  FE+  D+  K YQ++      QC   KNL+T+ +I  K     + +   I++      H    +   L++ +N  ++  + IF    + PN +      L + ++  L  ++I F++L     + + + +T   LE LY     +K  P   L                  L+D+ +  NK  G  +++  +       Y  V     N  + S T +    +  N +SL   +             + +L +WA+LT   +M+L+ W   ++ +  ++V   +   M +        T I  +L   +K+FE      L  +  Q+A E++QR    +LT  L + +N SCL +AV  N    L H   +    + WMG L       +K++L +         F I  L +KS+               + + D   +  S    + +   +++    K +EN             + F N+S      ++  +  KK    FY AP+ KF    I+Y+ FL+ F +  LV++   EQ+ R+Q    E++   YI  LGF  ++V++I ++  +   ++F       WN  D + I++ +I +  RF   +      R ++ +    + LR +    ++  +GP V M+ KM+ ++ +F+ +  + ++S+G    ++  PN +  +SL+  + ++P+F  +GE+   +  D  C        C+  +       +++LL+ N+LL+NLLIA+F + FNE+ + S +++   +  +V E+ QKP++PPPF  + +F
Sbjct:   78 QPTDAYGTIEFQG------GAHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQ-AKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL--LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHAYFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDS--PPVPVVVCDGSGRAADLLAFVHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQELL-----QCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQLSLALTWNRVDIARSEIFVYGQEWPNGA------LDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELY----NTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDA-EKAQR----LLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMP------FYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKM---EQMPRWQ----EWYSIAYITTLGF--EKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFRFR--ENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEVFAGDI-DPPCGEDPSQPGCVTGHWVTPITMSMYLLIANILLINLLIAVFNNIFNEVNSVSHQVWMFQRFTVVMEYQQKPVLPPPFIALCHF 1105          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 235.343 bits (599), Expect = 1.081e-62
Identity = 247/1057 (23.37%), Postives = 484/1057 (45.79%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRG-QNQACLIGVSSCGVVKNIEKLISNNCTYP---RASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-LG-------VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEI--FEQEKINIKDVEKLRTLFEMNDD------ELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDH---DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK--NKTFGFQNKTSGNLLDETYKI-VQFLSENI--LKSSLTD--------KSIKNQVSLNLAV--------------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ--TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYR-FKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCII----------------------QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFL 3159
             P D FG I+F G    +        ++    ++T  +  Y+L+ + W+  SPNL+ISV GG KN  +  + L+  F+R L ++ +T   WI+  G   GV K VG  +  Y   S   + Q  +IGV+  GV+ N   LI     +P      E   G  + L+  +  +L  DDG+      + E     EK +  + LG       +PV+ ++L G    L TI+ S++ + P ++++ SG L+D  + +      K+ +  + +L   F M +       +++++ K   +I  +  +L+T+ +I        D+ + +++     SR+ +H       +  +L++ +N  ++ E+ IF     SQ     L   +   L  ++ +F+ L     + + E + +E  ETL  +        Y  L +   + K   +  G + +     L  + K+ +  +SE +  L  S T         K  K+ V L +                        +DLFLWA++  + E++ I W +C+D +  A+  + I   ++ L    G+  +  + +++E +  +E+ AI V  E +    +  + +L R   +    +CL +A+  +   F+ HS  ++   + W G+LS   P WK+LL ++F P +   F+ F    + E+    A++           E  K++  S F   ++ K   ++     K++   +     L +F K+P VKF   + SY  FL  F  + +++ +     +       E  +Y+++   + +E++Q+ ++     F R  K  I   WN+ D  +I++ I  ++ R       F   + +  + F ++CLR M  + IS ++GPK+I++++M++D+FFF+ +  +++V+YG     +   N E    ++    Y P+   FG    +   +++   +SC +                      ++ T++    ++LL  N+LLLNLLIA+F  TF E+Q+ ++ I+   + +L++E+H +P +PPPF L+ + +
Sbjct:   94 TPTDAFGDISFGGLGQKTG-------KYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKN-FYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDIL-RMPHLLTVFRIDEDKNYDVDVAILQALLKA--SRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEE--SQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLERE--ETLCEL--------YSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKI---LRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFR---RDEDIQRQAER----------TEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWR-------ELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTN-IDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMM-LCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHLI 1102          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm4a (transient receptor potential cation channel, subfamily M, member 4a [Source:ZFIN;Acc:ZDB-GENE-090302-3])

HSP 1 Score: 233.802 bits (595), Expect = 2.377e-62
Identity = 265/1091 (24.29%), Postives = 483/1091 (44.27%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAY--RQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPR---ASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQN----ILG-----VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ-----------------------EKINIKDV--EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK--------------------NKTFGFQNK---TSGNLLDET-YKIVQFLSE--------------NILKSSLTDKSIK--NQVSLNLAVTYQ---------DLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLI-YKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKK------ALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF-----QDSVCKTTSCIIQYRT-----------VIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLI---YYFLKKI 3168
            P D FG + F G    +  +H  F+R      +TP    Y L+   W  P PNLV+S++GG + ++ K   +    ++ L    ++   WI+ SGL  GVS+ VGE +  +     S  Q +   +GV+  G++    +L++   ++P      +  + +  L+  +  +L  DDGS     ++  F  + E ++ +    I G     +PV+ +++ G+   LE + +SL  + P +++  SG  SD  + I +                          I ++D   E++R  F  ++ EL K    A  I+   ++L+TI           D I+ K++       + D     +   L++ +N  ++ +T +F        + E L++++   L  ++  F+ LF    + I   +T   LE+LY  SL   DC   DL++  +  +                    N +F  Q     T     D T Y++ + LSE               +     + K++K  N++ LN + TY+          LF+WA+L    EMSL FW+   ++V  A+ G  I  ++  L   + +T     + E ++ FE LA  V  E  + +++ +  +L R        +CLQ+A + +   F +H   ++   E W GD+     +WK++ +     F LP F+   LI +K E     A+ F  G  F +      ++  +N    +E+   CN   G  K K  +VI KK          F+ APV  F+  ++ Y +FL  F Y+ L++ K            +E  +Y ++     +E++Q    G      R K  I   WN  D + + + ++ ++ R   P  +  F R +  + + ++ LR +  + +   +GPK+I++ KM+ D+FFFL    +++++YG    +L          +   +FYRP+   +G++ LDE       D  C     +I               V+   +++LL+TN+LL+NLLIAMF  TFN++Q  S+  +   +  L+ E+H +P + PPF +I   + F+K++
Sbjct:   83 PTDAFGQLEFVG----AGRRHCPFLRL---SFDTPPDNVYSLMTSQWGLPVPNLVVSMVGGDEKEMAK-PWVREVIRQGLVHAAQSTGAWIMTSGLKEGVSRCVGEAVRHHCAMASSLSQAKVIAVGVAPWGLIYQRHQLVNPQGSFPARYYVHDMPSASSCLDNNHQAFLLVDDGSVGHRGSETSFRANLEDFISHQRTGIWGSGSIEIPVLCVLIAGDATMLERVDLSLKNSTPWLVLAGSGSASDLIAGILKDLSAPLSPPVSPTLQSDSEESSKSSSIELRDRVKERIRKHFP-SETELDKLVDQALSIYHN-RDLITIFHGDEDGSDDFDTIILKALVRAAKRDSNDASEYTEELKLAVAWNRVDIAKTELFNGD--VHWRYEDLEESMTDALVNDKPDFVRLFVESGLNILAYLTYHRLESLYS-SL--SDC---DLVSSFLQRRLQERVGLAASQTRLTPQPDDNSSFKSQATNLTTPSAARDLTLYEVSRVLSEIMEDVCQPFYYTTLGLDHRVNSRKAMKHVNKLLLNES-TYRRQRCTSPWISLFIWAVLQNRREMSLYFWKMTGESVLSALAGCKILRELSKL---ETETETKLSMKELAQTFENLAHDVFSECYQSNEKRSFKLLIRQSPIWGGATCLQMATSADARLFFSHDGVQTLLSEIWWGDMDSNTEVWKLVFS-----FFLPPFIYTKLINFKVEEADEKAEDFGQGKEFDSTDGAETLADMTNM---DEDVEECNALRG--KPKASKVIAKKRPFIFHRWRQFWFAPVTSFLGNVLMYFLFLFLFAYVLLIDFK---PPPPDGPAPLELVLYFWVFTLACEEIRQSFFVGSTTLTQRMKVYIQDIWNKCDITALGLFVLGLLCRM-FPWTYN-FGRAVMCVDYTVFTLRLIHIFAVHKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDSRPGWVARRVFYRPYMHIYGQIPLDEIDADKRHDKRCTDNVTLIHEGAEPCPDSDANWLVLILLSVYLLVTNILLVNLLIAMFSYTFNKVQERSDVYWKFQRYNLIVEYHSRPCLAPPFIIISHLHIFIKRV 1136          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 217.238 bits (552), Expect = 4.456e-57
Identity = 261/1084 (24.08%), Postives = 481/1084 (44.37%), Query Frame = 1
Query:  205 TNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETI--GAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPR---ASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQN------ILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINI-------KDVEKLRTLFEMNDDELVKY-------QKIAFEIFS--QCKNLVTI---KQIVRKDL-ILYKSVFDVIISRN--KDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQ---------NKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNL-AVTYQD---------LFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKN------NEN-KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--INNNGKL-ETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDS-------------------VCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPF-------NLIYYFLKKIWNTRNRIF 3192
            T     + SS      P D +G + F+G       +H  F+R  S  T  P +  ++L+ + W+   PNLV+SV+GG    + K S +    ++ L +  ++   WII  GL  G+S+ VGE +   A    S   N+   IG++  G+V+N ++L++   ++P        S  + +L+  +  +L  DDG++     +  F    E Y+         + +PV+ +++ G+   LE + MSL  + P +++  SGGL++  S+I E  +          +D   +  L E    ++ KY        K+  ++ S  Q K++++I   KQ   +D  I+   V      RN  ++ +  A    L++ +N  ++ ++ +F   N    K E L  ++   L  N+ +F+ L     + I   +T   LE LY  +  S  C    LL   +  +      Q         ++   +LL E      +    +  SS   KS+K    + + +  Y+D         LF+WA+L   +EM++  W  C ++V  A+ G  +   +  L   + +T     + E + KFE +A  V          ++  +L R  +   + +CL++A+  +   F +H   +S   + W GD+    P+W+ILL I+  P     F+ +    ++E   +      +       + VF  SF  N ++N      +EN +R    +   IK K    +  +  + F+ APV  FI  L+ Y +FL  + Y+ LV+ KP            E+ +Y ++   + +E+++  I  N K  +T + +   +   ++V   S  +  + C +  +S     F   R +  + + ++ LR +  + I   +GPK+I++ KMI   FFFL   L+++++YG    +L          +   + YRP+   FG++ ++E                        C+ TS       V+    IFLL+TN+LL+NLLIA F  TF ++Q  S+K +   +  L+ E+H +P + PPF        LI  +L+K+ + + + F
Sbjct:   66 TAVVSQWLSSQHTSEQPTDAYGDLEFDGIGR----RHSYFLRLSS--TTDPAR-VFDLMKEHWKLQQPNLVVSVVGGEGRSVVK-SWVRDVLRQGLVKAAQSTGAWIITGGLRQGISRCVGEAVKDNAAAVSSITLNKVLPIGIAPWGLVENRQQLVNLEGSFPARYMVRNISPDSCSLDNNHKAFLLVDDGTSGRKGGELAFRACLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMSLKNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEEEDASPIMELREQLAAKVKKYFPAENDTDKLVDKVLSIYQNKDIISIYNAKQEGAEDFEIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNG-NID-WKYEELVDSMTDALENNKPQFVRLLIDSGLNILSYLTYGRLEKLY--NSISDTCLAKTLLLHHLDERMHESNVQIYSISLYEVSQLLTDLLGEVCHPFYWTELKLEASSTRRKSMKKACRILMGSCKYRDEMCKHPWFCLFIWAVLQNRSEMAIFCWEMCDESVLTALAGCKL---LLELSKQEIETEAKLSMKELALKFERMAHDVFGTCYLSKASHSYKLLIRKSKLWGDATCLEMAIAADAQIFFSHDGVQSLLSQIWWGDIERGTPLWRILLVIICPPVCYSNFIEYRKTDQAEKEKSVMAPPCSEIDRQYEETVF--SFNDNKHQNEAEHKDSENIRRTAKGAPAFIKPKKSSFVVSR-WKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDG---PAVSEYVLYFWVFTLVCQEIQEAFIAGNKKFPQTLFLYAQDVWNKFDVLAISLFITGLCCRMFSWS-----FNMGRGILCVDYMVFTLRLIYIFAIHKELGPKIIILGKMIKHAFFFLFFLLVWLIAYGVANQALLYQYDPSPARVFRRVLYRPYLHIFGDIPVEEIDTGKHWERDCTDNLTLINEGIEPCRDTS---HNWLVVILLVIFLLVTNILLINLLIATFSYTFTKVQEHSDKYWKFQRYNLIVEYHSRPTLAPPFIIFSHINILIKRYLRKVPSAKTQRF 1120          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm4b.2 (transient receptor potential cation channel, subfamily M, member 4b, transient receptor potential cation channel, subfamily M, member 4b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-061214-2])

HSP 1 Score: 209.92 bits (533), Expect = 8.056e-55
Identity = 264/1131 (23.34%), Postives = 494/1131 (43.68%), Query Frame = 1
Query:  154 TTGVFCFFFSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETI--GAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQN------ILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINI-------KDVEKLRTLFEMNDDELVKY-------QKIAFEIFS--QCKNLVTIKQIVRK-----DLILYKSVFDVIISRN--KDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIV-----QFL-------------SENILKSSLTDKSIKNQVS-LNLAVTYQD---------LFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLI--YKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNG---LIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYD---FSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSL---QNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGF----------------AIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISME 3288
            +T V   +FS Q SS +                P D +G + F    N S  +   F+R  S  T  P K  ++L+ + W+   PNLV+SV+GG      K+  L+   ++ L +  ++   WII  GL  G+S+ +GE +   A    S   N+   IG++  G+V+N + L+++  ++P A   +  + NL+  +  +L  DDG+T     +  F    E Y+         + +PV+ +++ G+   LE + MSL  + P +++  SGGL++  S+I E  +          +D   +  L E    ++ KY        K+  ++ S  Q K++++I    ++     D+++ K V      RN  ++ +  A    L++ +N  ++ ++ +F        K E LK ++   L  N+ +F+ L     + I+  +T   LE LY            + ++D  ++K       N+     + + YKI      Q L             +E  L+++   K++KN    LN + TY+D         LF+WA+L    EM++ FW  C ++V  A+ G  +   +  L   + +T     + E + KFE++A  V     +    ++  +L R  +   + +CL++A+  +   F +H   +S   + W GD+      W++LL ++  P      + F      K E +  +       + +      FK     N  +N ++      + G    I++     +  +  + F+ APV  FI  L+ Y +FL  + Y+ LV+ KP            E+ +Y ++   + +E+++ +  G  +            WN +D    S  +  + C +  +S     F   R +  + + ++ LR +  + I   +GPK+I++ KMI D FFFL   L+++ +YG    +L    +P+    F     + YRP+   FG++ ++E          C      +  G                  IFLL+TN+LL+NLLIA F  TF+++Q  S+  +   +  L+ E+H +P + PPF ++ +    I     R  +K  + K   F   +   EK +++ +E +  E
Sbjct:   63 STAVVSQWFSTQHSSEQ----------------PTDAYGELDF----NNSRKRDSYFLRLSS--TTDPAK-VFDLMKEHWKLQQPNLVVSVVGGEGRSEVKSWVLDI-LRQGLVKTAQSTGAWIITGGLRQGISRCIGEAVKDNATAVSSITLNKVLPIGIAPWGLVENRQHLVNSEGSFP-AKVTTQDSCNLDNNHKAFLLVDDGTTGRKGGELAFRARLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMSLKNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEKEDASPIMELREQLAAKVKKYFPAEKKTDKLVDKVLSIYQNKDIISIYNAEQEGAEDFDIVMLK-VLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFN--GHIDWKYEELKDSMTDALENNKPQFVRLLIDNGLNISTYLTYNRLEILY------------NSISDTCLAKTLLLHHLNERIHQSIKQIYKISLYEVSQLLTDLFGEVCLPFYKAELKLEATTKRKALKNACDVLNGSCTYRDEKCKHPWLCLFIWAVLQNRREMAIFFWEMCGESVLTALAGCKL---LLELSKQEIETEAKLSMKELALKFEQMAHDVFGTCYQTKASHSYKLLIRKSKLWGDATCLKMAIAADARIFFSHDGVQSLLSQIWWGDIERGTAFWRLLLVMICPPLCYTNCIEFRKTDPAKEEKSMTAPPSSPTDSHYEKTVYSFKDIKHQNEGENEDSNHIRQNTKGEPAFIESMKSSFVVSR-WKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDG---PAVSEYVLYFWVFTLVCEEIREASIAGNKKFPQMLFVYAQDMWNKFDVLAISLFITGLCCRMFSWS-----FNMGRGILCVDYMVFTLRLIHIFAIHRQLGPKIIILGKMIKDAFFFLFFLLVWLSAYGVANQALLYQYDPSPARTFR---RVLYRPYLHIFGQIPVEEIDTGRHWERDCTDNLTLINEGIEPCRDTSHNWLVVVLLVIFLLVTNILLVNLLIATFSYTFSKVQERSDTYWKFQRYNLIVEYHSRPTLAPPFIILSHINLLI----KRKIRKVQSAKVQRFALKIKGQEKKELVKWENLQKE 1134          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 208.764 bits (530), Expect = 1.571e-54
Identity = 239/1067 (22.40%), Postives = 472/1067 (44.24%), Query Frame = 1
Query:  229 SSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQN-QACLIGVSSCGVVKNIEKLIS----NNCTYPRASEFSNGTFNLNEFYDCYLFCDD-----GSTNLCQNDKEFLVDFEKYLQ---------NILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKL--RTLFE-MNDDELVKYQKIAFEIFSQCKNLVTI---KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQ---NKTSGN----LLDETYKIVQFLSENILKSSLTD-------------KSI--KNQVSLNLAV--TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIY---KSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ-INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFG-----------------FAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY-------FLKKIWNTRNRIFKK 3198
            SS + +       G I F G     S     F+R  S   +T   E Y+++ K W    P+LV++++GG +    K   L    ++ L +  ++   WI+ SGL  G++K +G+ +  +   S     +   IG++   +++N + L+S    +  TYP         ++L+  +  ++  D+     G+T       E  V   K++            + +PV+ +++ GE   L+ ++ ++  ++P +++  SGG++D    + ++   +   V++L   T  + ++  E+  + K+   I     +L+T+   +Q    D ++ K++     S++++         L++ +N  ++ ++ IF      Q   + L++ ++  L  ++  F+ LF    + I + +T   L+ LY  S+  K+     LL+ L++ KN+    Q    + SGN    L D  ++        +LK  L D             K++  KN   ++      ++DLFLWA+L    EM+  FW    + V  A+VG  I  +M +L      T   +     + K+E+ A+ +  E    S+     +L R     +  + L IA       F  H   ++   + W G +     + +++LT     F +P  V  SLI    + + + +  + F   +S  T + +          + +      + S   I+      +  +    F+ APV  F+  +I Y  FL+ F Y+ L++ +P      Y     E  +Y ++   +++E++Q    +  +    + K  +   WN  D   I + ++ +  R ++    +   R +  L F ++ LR +  + I   +GPK+I++++MI D+FFFL    +++++YG    +L +PN      +     YRP+   FG++ L+E   +     +C    + +I G                   I+LL+TNVLLLNLLIAMF  TF  +Q  ++  +   +  L+ E+H +P + PPF +I +       F+KK  NT++ + K+
Sbjct:    5 SSERFDKQMAGRLGDIDFTGV----SRTRGKFVRVTS---STDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLK-PWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPKRPGATG------EMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIVQELLINTFPDGLHSTEITSWTKLIQRILDH-GHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFSGD--VQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY-CSVSEKN-----LLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHL-----ATEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLT-----FFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIR------VVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPP---YGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVGLSCRMAM--STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEIDAAKMPDDNCTTDVQEIILGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQENADIFWKFQRYNLIVEYHSRPALAPPFIIISHITQALLSFIKKTENTQDLLGKE 1027          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 249.98 bits (637), Expect = 1.431e-67
Identity = 252/1077 (23.40%), Postives = 473/1077 (43.92%), Query Frame = 1
Query:  220 SFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQG-SRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSN---GTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDV-----EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTI----KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESK------DCPYGDLLNDLIISKNKTFGFQNKTSGN--LLDETYKIVQFLSENILKSSLTD-----KSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLI---------YKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELK--PIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFA-----------------IFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQI 3261
            ++ S+      P D +G + F G    +  +H  F+R      +T     Y LI   W+ P PNLV+SV+GG  +   K + L+   ++ L +  ++   WI+  G+ VG+ K VGE +  +    S  + +   +G++  G+V N + L++   ++P      N    T++L+  Y  +L  DDG+      +  F    E+++         +  + +PV+ +++ GE   L  ++ +    +P +L+  SGG++D  +EI E E I ++ +     EKL+  F   ++ L K      E   + ++LVT+      I   + ++ K++       + D         L++ +N  ++ +T +F        K   L   +   L  N+ KF++LF    + I + +T   LE LY   L++          + +  N      ++    ++   G    L E  KI++ L  ++  +  T      K   N+ +      + DLF+WA+L    EM+  FW    + V  A+    I   +K L   + +   S  + + + KFE+LAI V  E    S+     +L R        +CLQ+A   +  +F      +S   E+W G ++   P+W ++LT    P +    + F+           ++ E + N+ +  +     S  K   K +  +   K  +  R+                  +  + F+ APV  F   ++ Y  FL  F Y+ L+E K  P +          EF +Y +I   + +E++Q    G +    + K  +  +WN  D   + + II ++ R     E F   R +    F ++ LR +  + ++  +GPK+I+++KM+ D+FFFL    +++++YG     L +P       +   +FYRP+ Q FG++  +EF  S   +++C      ++   A                 +FLL+ N+LLLNLLIAMF  TF+++Q  S+  +   +  L+ E+H +P + PPF +I +         N   K+   + +S  I++ ++  +M I
Sbjct:   63 TWNSAEHTTEEPTDAYGDVEFVG----AGRKHSKFIRL---SNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMK-TWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE-ESIALESIRGLIEEKLKHYFP--NENLTKM----VERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEIL--WKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVLGNMKGSVNKRNSGSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKI---LKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLITFNRTLSSEELYFSFREEKDDNAEE--VPLKKMSVKKSKTKKAPEAEIIKEKQRPRWM-----------------QRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD-----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI--------NTFIKRKIRKVASQKIRHFSEYNRMLI 1085          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 248.825 bits (634), Expect = 2.823e-67
Identity = 257/1070 (24.02%), Postives = 473/1070 (44.21%), Query Frame = 1
Query:  220 SFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQG-SRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSN---GTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDV-----EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTI----KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTF-GFQNKTSGNLL-------------DETYKIVQFLSENILKSSLTDK-SIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELK--PIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFA-----------------IFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQI 3261
            ++ S+      P D +G + F G    +  +H  F+R      +T     Y LI   W+ P PNLV+SV+GG  +   K + L+   ++ L +  ++   WI+  G+ VG+ K VGE +  +    S  + +   +G++  G+V N + L++   ++P      N    T++L+  Y  +L  DDG+      +  F    E+++         +  + +PV+ +++ GE   L  ++ +    +P +L+  SGG++D  +EI E E I ++ +     EKL+  F   ++ L K      E   + ++LVT+      I   + ++ K++       + D         L++ +N  ++ +T +F        K   L   +   L  N+ KF++LF    + I + +T   LE LY   L++       LL  L+ SK+      + K    LL              E  KI++ L  ++  +  T + +++          + DLF+WA+L    EM+  FW    + V  A+    I   +K L   + +   S  + + + KFE+LAI V  E    S+     +L R        +CLQ+A   +  +F      +S   E+W G ++   P+W ++LT     F  P  +   LI    NN      ++  +  S +     ++  SN        R       L+  ++ +         F+ APV  F   ++ Y  FL  F Y+ L+E K  P +          EF +Y +I   + +E++Q    G +    + K  +  +WN  D   + + II ++ R     E F   R +    F ++ LR +  + ++  +GPK+I+++KM+ D+FFFL    +++++YG     L +P       +   +FYRP+ Q FG++  +EF  S   +++C      ++   A                 +FLL+ N+LLLNLLIAMF  TF+++Q  S+  +   +  L+ E+H +P + PPF +I +         N   K+   + +S  I++ ++  +M I
Sbjct:   63 TWNSAEHTTEEPTDAYGDVEFVG----AGRKHSKFIRL---SNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMK-TWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE-ESIALESIRGLIEEKLKHYFP--NENLTKM----VERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEIL--WKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNT------LLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHQIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKI---LKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLT-----FFCPPLIYTDLITFKPNN------YMISSHLSIDPTPHTVTINSNLLGREGCCR-------LLPERWKQ---------FWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD-----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI--------NTFIKRKIRKVASQKIRHFSEYNRMLI 1064          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 245.358 bits (625), Expect = 3.498e-66
Identity = 252/1065 (23.66%), Postives = 465/1065 (43.66%), Query Frame = 1
Query:  220 SFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQG-SRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSN---GTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL---------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDV-----EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTI----KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTF-GFQNKTSGNLL-------------DETYKIVQFLSENILKSSLTDK-SIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELK--PIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFA-----------------IFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADC 3246
            ++ S+      P D +G + F G    +  +H  F+R      +T     Y LI   W+ P PNLV+SV+GG  +   K + L+   ++ L +  ++   WI+  G+ VG+ K VGE +  +    S  + +   +G++  G+V N + L++   ++P      N    T++L+  Y  +L  DDG+      +  F    E+++         +  + +PV+ +++ GE   L  ++ +    +P +L+  SGG++D  +EI E E I ++ +     EKL+  F   ++ L K      E   + ++LVT+      I   + ++ K++       + D         L++ +N  ++ +T +F        K   L   +   L  N+ KF++LF    + I + +T   LE LY   L++       LL  L+ SK+      + K    LL              E  KI++ L  ++  +  T + +++          + DLF+WA+L    EM+  FW    + V  A+    I   +K L   + +   S  + + + KFE+LAI V  E    S+     +L R        +CLQ+A   +  +F      +S   E+W G ++   P+W ++LT    P +    + F+ +   E N     + I                     K  +  R+                  +  + F+ APV  F   ++ Y  FL  F Y+ L+E K  P +          EF +Y +I   + +E++Q    G +    + K  +  +WN  D   + + II ++ R     E F   R +    F ++ LR +  + ++  +GPK+I+++KM+ D+FFFL    +++++YG     L +P       +   +FYRP+ Q FG++  +EF  S   +++C      ++   A                 +FLL+ N+LLLNLLIAMF  TF+++Q  S+  +   +  L+ E+H +P + PPF +I +         N   K+   + +S  I++ ++C
Sbjct:   63 TWNSAEHTTEEPTDAYGDVEFVG----AGRKHSKFIRL---SNDTDPASVYSLITYNWKIPPPNLVVSVVGGDGDFKMK-TWLKDILRKGLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE-ESIALESIRGLIEEKLKHYFP--NENLTKM----VERIVENRDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEIL--WKATDLDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVLDNT------LLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHQIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKI---LKELSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLITFNSV---EQNGAPEAEII---------------------KEKQRPRWM-----------------QRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPD-----GPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLLHPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASKIASSNCTNDPIAIMLEEAEPCTNTYANWLVILLLVVFLLVANILLLNLLIAMFSYTFSKVQGNSDIYWKFQRYNLIVEYHNRPALAPPFIIISHI--------NTFIKRKIRKVASQKIRHFSEC 1045          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 235.728 bits (600), Expect = 1.072e-62
Identity = 277/1115 (24.84%), Postives = 506/1115 (45.38%), Query Frame = 1
Query:  217 DSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLE-----------TLYMISLESKDCPYGDLLNDLIIS--------------------KNKTF-GFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTV--ISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTN--KEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----------KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPP---FNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            + ++ S   + +P D FG + F+G        H N   +     ++       L+ K WQ   P L+ISV GGL+N      +L++ F + L +   T   WI   G+  GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  + T P  +  SN    L   N  +  ++  D+G+      + +     EK+  LQ I      GVPV+ +++ G    +  +   L E   +P+++   SG  SD   F+  + +E   I   E LR      D  LV  QK      +Q   L  V ++ + +K+LI   +VF +     +D +M                   L++ +N  ++  ++IF    F    P   L++ ++  L  +++ F++L     + +   +T   LE           TL+ I  + K   +G+L  D  +S                      KTF    N   G   D+         +   +  + D  + +         + +L +WA+L    +M+L  W++ ++ +  A+V   +   M +    + + V  IS  L  +SK F +LA+ ++ ++ +  ++    +LT  L+  +N +CL++AV      F+ H+  +    + WMG L     P  K+++ ILF P       I  L ++S+++           SF T+   E  K     N  +N  +++  +  NG  K K   + TK  +  FY AP+VKF  Y ISY+ +L+ F Y+ LV+++    V+       E+ V  YI+   +++V++I  +  GKL    + K  +   WN+ D   I V +I  ++R    Q +  + R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++ +P+ E  + L  NIFY P++  +GE+  D+  D  C          +   CI          A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH +P++PPP   F+ +Y  LK+I     +I +     +      +L D E  ++  FE   +E  F + E++
Sbjct:   18 EKWSISKHTQLSPTDAFGILEFQG------GGHSNKAMYIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQN-FEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSSKSRGR--ICAIGIAPWGIVENKEDLIGKDVTKPYQT-MSNPLSKLSVLNSSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHKYSEEGGIIS--ESLR------DQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELI---TVFRMGSEGQQDIEMAILTALLKGTNASAPDQLSLALAWNRVDIARSQIFV---FGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIVRDVKKVGFGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLFGPKRDDEPPTKGKKKKKKKEEEI-DMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHES-SESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPP------TILFLEFRSQDDL----------SFHTSKEYEEGKEKEDENMVRNTTSRK-GDEENGNRKQKSIPIGTK--IYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQ-------EWVVISYIVTLALEKVREILMSEPGKLSQ--KVKVWLQEYWNITDLVAISVFLIGAILRLQ-NQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQI-DPPCGENLYDEDGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIIFSHLYIILKRICCRCKKIQEGDQDERDRGLKLFLNDEELKKLYEFEEQCVEEYFQEKEDE 1076          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 230.72 bits (587), Expect = 4.146e-61
Identity = 265/1046 (25.33%), Postives = 482/1046 (46.08%), Query Frame = 1
Query:  385 KLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKD-----CPYGDLLNDLIISK--------------NKTFGFQNKTSGNLL--DETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTV--ISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVC----------KTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPP---FNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            K WQ   P L+ISV GGL+N      +L++ F + L +   T   WI   G+  GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  + T P  +  SN    L   N  +  ++  D+G+      + +     EK+  LQ I      GVPV+ +++ G    +  +   L E   +P+++   SG  SD   F+  + +E   I   E LR      D  LV  QK      +Q   L  V ++ + +K+LI   +VF +     +D +M                   L++ +N  ++  ++IF    F    P   L++ ++  L  +++ F++L     + +   +T   LE LY       D        G +L  L+                 N  FG +   +  LL  ++     +   +   K    D  + +         + +L +WA+L    +M+L  W++ ++ +  A+V   +   M +    + + V  IS  L  +SK F +LA+ ++ ++ +  ++    +LT  L+  +N +CL++AV      F+ H+  +    + WMG L     P  K+++ ILF P       I  L ++S+++           SF T+KE  + + +    + N N++  +I    I TK YE         FY AP+VKF  Y ISY+ +L+ F Y+ LV+++    V+       E+ V  YI+   +++V++I  +  GKL    + K  +   WN+ D   I V +I  ++R    Q +  + R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++ +P+ E  + L  NIFY P++  +GE+  D+  D  C          +   CI          A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH +P++PPP   F+ +Y  LK+I     +I +     +      +L D E  ++  FE   +E  F + E++
Sbjct:    3 KEWQLELPKLLISVHGGLQN-FEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALKDHSSKSRGR--ICAIGIAPWGIVENKEDLIGKDVTKPYQT-MSNPLSKLSVLNSSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHKYSEEGGIIS--ESLR------DQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELI---TVFRMGSEGQQDIEMAILTALLKGTNASAPDQLSLALAWNRVDIARSQIFV---FGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLFGPKRPKALKLLGMEDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHES-SESELVDDISQDLDNNSKDFGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPP------TILFLEFRSQDDL----------SFHTSKEYEEDTTSRKGDEENGNRKQKSIP---IGTKIYE---------FYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWPSVQ-------EWVVISYIVTLALEKVREILMSEPGKLSQ--KVKVWLQEYWNITDLVAISVFLIGAILRLQ-NQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQI-DPPCGENLYDEDGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIIFSHLYIILKRICCRCKKIQEGDQDERDRGLKLFLNDEELKKLYEFEEQCVEEYFQEKEDE 990          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm4 (transient receptor potential cation channel, subfamily M, member 4 [Source:MGI Symbol;Acc:MGI:1915917])

HSP 1 Score: 246.899 bits (629), Expect = 1.299e-66
Identity = 264/1126 (23.45%), Postives = 482/1126 (42.81%), Query Frame = 1
Query:  217 DSFTSSPKLEFN--------PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP-----RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-QNILGV-------PVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ---------EKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKS-----VFDVIISR-------NKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK-------NKTFGFQNKTSGN----LLDETYKIVQFLSENILKSSLTDKSIKN----------QVSLNLA---VTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNG------------KLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSV-----CK-------------TTSCIIQYR--TVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKI-WNTRNRIFKKSNTRKSSIFIKY---LADCEKMQILAFERISME 3288
            D+F ++   E+N        P D +G + F      S  +H NF+R       T     Y L+ + W + +PNLV+SVLGG    + + + L+   +R L    ++   WI+  GL  G+ + VG  +  ++  S G ++   +GV+  GVV+N + LI+   ++P     R        F L+  Y  +   DDG+      +  F + FE Y+ Q   GV       PV+ +++ G+   L+ I  +    LP +L+  SGG +D   E  E           +   +D  ++R  F   D E+++         +Q + ++T K++    L +Y S      F+ I+ R       + +         L++ +N  ++ ++ +F+     Q +  HL+ +L+  L  ++ +F+ L     + +   +T   L  LY  S  S +    +LL+    +        N T   +    G     LL ET    ++ + N   S L     +N          Q S + +     + DL +WALL    +M++ FW K  ++V  A+   ++   M  L     +      L  +   FE +++ +  E    S+     +L R        +CLQ+A+  +   F      +S   + W G++    P+W +LL     P +    ++F    KSE      D   + +S S N      +   +     E ++       L   K+      K    F+ APV  F+  ++SY++FLL F ++ LV+ +P       +    E  +Y +    + +E++Q    G            +    +R    +S TWN  D   +   ++ V  R +     F   R +  L F ++ LR +  + ++  +GPK++++ KM+ D+FFFL    +++V+YG     +  P      S++  +FYRP+ Q FG++  +E   ++     C                SC+ QY    V+    +FLL+ N+LLLNLLIAMF  TF+++   S+  + + +  L+ EFH +P + PP  +I +    I W  R R  +++N   S +F  +   L+   + ++L +E +  E
Sbjct:   52 DAFGAAVVTEWNSDEHTTEKPTDAYGDLDF----TYSGRKHSNFLRL---SDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSGGPVLQ-TWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTLAPGSGGLRRGEARD--RIRRYFPKGDPEVLQ---------AQVERIMTRKEL----LTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGD--IQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLY--SAVSPNSLIRNLLDQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCA-PRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAAT---FESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFR---KSEEEPTQKDLDFDMDS-SINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKF-----SKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPT------KPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLT--PGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSKEAERKLLTWESVHKE 1129          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 225.328 bits (573), Expect = 2.059e-59
Identity = 274/1140 (24.04%), Postives = 518/1140 (45.44%), Query Frame = 1
Query:  187 QISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLES--------KDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQF--LSENIL----------KSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNI---SNGL---------IKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF----------------QDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWN---TRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            ++S N+  Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY              +D   G+L  D  IS            G      Y   +F  L  N+           +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P +L      SL +K   N +              ++  +        K+ E+     +   SNG          +++++  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV+++      R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+                 Q   CKT + I+         A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  114 RLSRNDI-QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSIL------SLEFK---NKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME------RWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAI-----MACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1199          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 224.172 bits (570), Expect = 3.526e-59
Identity = 276/1168 (23.63%), Postives = 523/1168 (44.78%), Query Frame = 1
Query:  187 QISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLE-----------TLYMISLESKDCPY---------GDLLNDLIIS----------------------------KNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNI---SNGL---------IKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF----------------QDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWN---TRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            ++S N+  Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE           TLY +  + K   Y         G+L  D  IS                             +  FG +   +  LL     I       + +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P +L      SL +K   N +              ++  +        K+ E+     +   SNG          +++++  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV+++      R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+                 Q   CKT + I+         A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  114 RLSRNDI-QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKREYPGFGWIYFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDI------PLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSIL------SLEFK---NKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME------RWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWIVPAI-----MACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1221          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 224.557 bits (571), Expect = 3.875e-59
Identity = 273/1132 (24.12%), Postives = 513/1132 (45.32%), Query Frame = 1
Query:  211 QTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLES--------KDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQF--LSENIL----------KSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNI---SNGL---------IKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF----------------QDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNT---RNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY              +D   G+L  D  IS            G      Y   +F  L  N+           +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P +L      SL +K   N +              ++  +        K+ E+     +   SNG          +++++  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV+++      R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+                 Q   CKT + I     V    A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  123 QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSIL------SLEFK---NKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME------RWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWI-----VPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1201          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 223.787 bits (569), Expect = 6.721e-59
Identity = 276/1154 (23.92%), Postives = 523/1154 (45.32%), Query Frame = 1
Query:  187 QISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNL---NEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDE------------------------TYKIVQFLSENIL----------KSSLTDKSIKNQVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-----TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFF-PMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNI---SNGL---------IKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF----------------QDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNT---RNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            ++S N+  Q++ ++ S   + +P D FG+I F+G        H N   +     +T       L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E LI  +   P  +  SN    L   N  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY       +  Y  L+ D+   +   FG+     GNL  +                        T K  + L  N+           +   T K  + +V ++L           + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S+ F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L        K++L IL  P +L      SL +K   N +              ++  +        K+ E+     +   SNG          +++++  +   + +  FY AP+VKF  Y ++Y+ +L+ F Y+ LV+++      R+ + T E+ V  YI    ++++++I  +  GKL    + K  +   WNV D   IL+  + +++R    Q F    R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++  PN E  + L  NIFY P++  +GE+  D+                 Q   CKT + I     V    A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP  +I+  +  I+     R R  +     +      ++ D E  ++  FE   +E  F + +++
Sbjct:  116 RLSRNDI-QSEKWSISKHTQLSPTDAFGTIEFQG------GGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLIGRDVVRPYQT-MSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLY-HLVRDVKKREYPGFGWI-YFKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSIL------SLEFK---NKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGRKIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKME------RWPS-TQEWIVISYIFTLGIEKMREILMSEPGKL--LQKVKVWLQEYWNVTDLIAILLFSVGMILRLQ-DQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKTIQLPPCKTGAWI-----VPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL-IIFSHMTMIFQHVCCRWRKHESDQDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDR 1213          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q7TN37|TRPM4_MOUSE (Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 9.087e-66
Identity = 264/1126 (23.45%), Postives = 482/1126 (42.81%), Query Frame = 1
Query:  217 DSFTSSPKLEFN--------PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP-----RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-QNILGV-------PVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ---------EKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKS-----VFDVIISR-------NKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK-------NKTFGFQNKTSGN----LLDETYKIVQFLSENILKSSLTDKSIKN----------QVSLNLA---VTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNG------------KLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSV-----CK-------------TTSCIIQYR--TVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKI-WNTRNRIFKKSNTRKSSIFIKY---LADCEKMQILAFERISME 3288
            D+F ++   E+N        P D +G + F      S  +H NF+R       T     Y L+ + W + +PNLV+SVLGG    + + + L+   +R L    ++   WI+  GL  G+ + VG  +  ++  S G ++   +GV+  GVV+N + LI+   ++P     R        F L+  Y  +   DDG+      +  F + FE Y+ Q   GV       PV+ +++ G+   L+ I  +    LP +L+  SGG +D   E  E           +   +D  ++R  F   D E+++         +Q + ++T K++    L +Y S      F+ I+ R       + +         L++ +N  ++ ++ +F+     Q +  HL+ +L+  L  ++ +F+ L     + +   +T   L  LY  S  S +    +LL+    +        N T   +    G     LL ET    ++ + N   S L     +N          Q S + +     + DL +WALL    +M++ FW K  ++V  A+   ++   M  L     +      L  +   FE +++ +  E    S+     +L R        +CLQ+A+  +   F      +S   + W G++    P+W +LL     P +    ++F    KSE      D   + +S S N      +   +     E ++       L   K+      K    F+ APV  F+  ++SY++FLL F ++ LV+ +P       +    E  +Y +    + +E++Q    G            +    +R    +S TWN  D   +   ++ V  R +     F   R +  L F ++ LR +  + ++  +GPK++++ KM+ D+FFFL    +++V+YG     +  P      S++  +FYRP+ Q FG++  +E   ++     C                SC+ QY    V+    +FLL+ N+LLLNLLIAMF  TF+++   S+  + + +  L+ EFH +P + PP  +I +    I W  R R  +++N   S +F  +   L+   + ++L +E +  E
Sbjct:   52 DAFGAAVVTEWNSDEHTTEKPTDAYGDLDF----TYSGRKHSNFLRL---SDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSGGPVLQ-TWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTLAPGSGGLRRGEARD--RIRRYFPKGDPEVLQ---------AQVERIMTRKEL----LTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGD--IQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLY--SAVSPNSLIRNLLDQASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCA-PRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAARRKDLAAT---FESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFR---KSEEEPTQKDLDFDMDS-SINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKF-----SKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPT------KPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLT--PGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSKEAERKLLTWESVHKE 1129          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q9ESQ5|TRPM4_RAT (Transient receptor potential cation channel subfamily M member 4 OS=Rattus norvegicus OX=10116 GN=Trpm4 PE=1 SV=2)

HSP 1 Score: 242.662 bits (618), Expect = 2.315e-64
Identity = 254/1078 (23.56%), Postives = 450/1078 (41.74%), Query Frame = 1
Query:  217 DSFTSSPKLEFN--------PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP-----RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-QNILGV-------PVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ---------EKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKL--FDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMI----------------SLESKDCPY-----------GDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSA------DKFING-NSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--------INNN----GKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-----DSVCK-------------TTSCIIQYR--TVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
            D+F ++   E+N        P D +G + F      S  +  NF+R       T     Y L+ + W + +PNLV+SVLGG +  + + + L+   +R L    ++   WI+  GL  G+ + VG  +  ++  S G ++   +GV+  GVV+N + LI+   ++P     R        F L+  Y  +   DDG+      +  F + FE Y+ Q   GV       PV+ +++ G+   L+ I  +    LP +L+  SGG +D   E  E           +   +D  ++R  F   D E+++ Q    E     K L+T+             V   ++      +  A L    L++ +N  ++ ++ +F+     Q +  HL+ +L+  L  ++ +F+ L     + +   +T   L  LY                  +  SK  P            G +L  L+            T  +LL + ++      EN   S L D +   Q +      + DL +WALL    +M++ FW K  ++V  A+   ++   M  L     +      L   + KFE +++ +  E    S+     +L R        +CLQ+A+  +   F      +S   + W G++    P+W +LLT    P +    ++F    KSE            D  +NG       +   K++      +   +   C    G  K   Y          F+ APV  F+  ++SY++FLL F ++ LV+ +P       +    E  +Y +    + +E++Q        + N     GK    +R    +  TWN  D   +   ++ V  R +     F   R +  L F ++ LR +  + ++  +GPK++++ KM+ D+FFFL    +++V+YG     +  P      S++  +FYRP+ Q FG++  +E        S C                SC+ QY    V+    +FLL+ N+LLLNLLIAMF  TFN++   S+  + + +  L+ EFH +P + PP  +I + 
Sbjct:   52 DAFGAAVVTEWNSDEHTTEKPTDAYGDLDF----TYSGRKSSNFLRL---SDRTDPATVYSLVTRSWGFRAPNLVVSVLGGSEGPVLQ-TWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGGSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRMGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIEGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEDTLAPGSGGLRRGEARD--RIRRYFPKGDPEVLQAQ---VERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGD--IQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASHASSSKSPPANGAAELRPPNVGQVLRTLLGETCAPRYPARNTRHSLLGQDHR------EN--DSLLMDWANMQQDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLEWEAEEAARRKDL---AAKFESMSVDLFGECYHNSEYRAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTNPIWALLLTFFCPPLIYTNLILFR---KSEEEPTQKDLDFDMDSSMNGAGPLGPAEPSAKVALERRRRRRPGHTLCC---GGCSKRWSY----------FWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQPT------KPGVFELLLYFWAFTLLCEELRQGLGGGWGTLANGGPGPGKAPLRHRLHLYLLDTWNQCDLLALTCFLLGVGCRLT--PGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILRRVFYRPYLQIFGQIPQEEMDVALMNPSNCSAERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANILLLNLLIAMFSYTFNKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHL 1079          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 2.107e-63
Identity = 257/1118 (22.99%), Postives = 497/1118 (44.45%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISN-NCTYPR--ASEFSNGTFN--LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI----------LGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLF-----------DLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI---ISKNKTFGFQNKTSGNLLDE-------TY---------KIVQFLSENILKSSLTDKSIKNQVSL--NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIY--KSENNSNSADKFINGNSFSTNKEVFKISFASN------FYKNNENKRFCNISNGLIKTK-------------------YYEVITK-------KALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNM-TMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGI--SGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPN-GEFG----FSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCII---QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            +P + +G I FEGY      +   ++R      +T       L+ K W    PNLVISV GG K+ + K  +L   F+R L +  KT   WII  G + GV K VGE +   +       Q  +IG+++ G+V     LIS  N  YP   + E + G     L+  +  +   DDG+      +       E+ +  +          +GVPV+ ++L G    + T++  + + +P ++I  SG  +      +        D + +  +    +DE+       F      K    IK ++  + ++     D  IS++ D  ++  L            +L++ +N  ++ ++ IF      Q   E L   +L  L  ++ +F ELF    + + E ++ + L  LY       + P    +  L+   + K +         G +++E       +Y         ++  +    +LK+  + K +   ++    L   Y D+FLWA+L    E++ + W   ++ +  A++ + +  +M +        T IS+ L + ++ FEE A+ V+ E    ++  ++ +L R L+  + M+ L++AV+     F+ H++C+      WMG ++     WK+L+ +      LPV +IF +IY    E +   A +  +  S +      K     N       Y++ E K   N     + T+                     EVI +         +  FY AP  KF+  ++ Y+ F+  + Y+ L      +  K    +   E  +Y ++   +++E++Q+    K   + + K  +  S TWN  D  ++ V II +++RF      F  +R +  L    + +R++Q + ++  +GPK++MI+KM+ D+  F+ I  +F ++YG   +++  P+ G +     +  + ++   P++Q +GEL LDE Q    K    +    ++ + +   AI+++ TN+LLLNLLIA+F  TF  +Q +S+K++   +  LV+E+H +P+  PP  L+ +   F++ +W    R+ +  +  + S     L+  E  Q+  +E  + E+   Q +++
Sbjct:   90 HPTNAYGEIDFEGY---GGQKRAPYLRM---SHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLK-PRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWNRIDLAKSDIFTEEQ--QWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLY------AEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL-----YLPV-LIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQL--AAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLL-LAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVW----RMCRCGHPPRGSTMKIGLSPAEMEQMDNWEFQAAEMYIHQQQQK 1179          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 235.343 bits (599), Expect = 8.162e-62
Identity = 247/1057 (23.37%), Postives = 484/1057 (45.79%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRG-QNQACLIGVSSCGVVKNIEKLISNNCTYP---RASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI-LG-------VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEI--FEQEKINIKDVEKLRTLFEMNDD------ELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDH---DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK--NKTFGFQNKTSGNLLDETYKI-VQFLSENI--LKSSLTD--------KSIKNQVSLNLAV--------------------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ--TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYR-FKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCII----------------------QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFL 3159
             P D FG I+F G    +        ++    ++T  +  Y+L+ + W+  SPNL+ISV GG KN  +  + L+  F+R L ++ +T   WI+  G   GV K VG  +  Y   S   + Q  +IGV+  GV+ N   LI     +P      E   G  + L+  +  +L  DDG+      + E     EK +  + LG       +PV+ ++L G    L TI+ S++ + P ++++ SG L+D  + +      K+ +  + +L   F M +       +++++ K   +I  +  +L+T+ +I        D+ + +++     SR+ +H       +  +L++ +N  ++ E+ IF     SQ     L   +   L  ++ +F+ L     + + E + +E  ETL  +        Y  L +   + K   +  G + +     L  + K+ +  +SE +  L  S T         K  K+ V L +                        +DLFLWA++  + E++ I W +C+D +  A+  + I   ++ L    G+  +  + +++E +  +E+ AI V  E +    +  + +L R   +    +CL +A+  +   F+ HS  ++   + W G+LS   P WK+LL ++F P +   F+ F    + E+    A++           E  K++  S F   ++ K   ++     K++   +     L +F K+P VKF   + SY  FL  F  + +++ +     +       E  +Y+++   + +E++Q+ ++     F R  K  I   WN+ D  +I++ I  ++ R       F   + +  + F ++CLR M  + IS ++GPK+I++++M++D+FFF+ +  +++V+YG     +   N E    ++    Y P+   FG    +   +++   +SC +                      ++ T++    ++LL  N+LLLNLLIA+F  TF E+Q+ ++ I+   + +L++E+H +P +PPPF L+ + +
Sbjct:   94 TPTDAFGDISFGGLGQKTG-------KYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKN-FYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSKVTMALINRLLKRFFMQEYKNFTELQIIEWTKKIQDIL-RMPHLLTVFRIDEDKNYDVDVAILQALLKA--SRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEE--SQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLERE--ETLCEL--------YSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKI---LRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFR---RDEDIQRQAER----------TEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQTSPSWR-------ELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNWIIRGAVYEPYITIFGNFPTN-IDNTLFDISSCSVNASDPLKPKCPMLNADNTPVFPEWLTIMM-LCVYLLFANILLLNLLIAIFNYTFQEVQDNTDTIWKFQRYELIKEYHSRPALPPPFILLSHLI 1102          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Match: sp|Q9BX84|TRPM6_HUMAN (Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 4.531e-59
Identity = 239/1080 (22.13%), Postives = 484/1080 (44.81%), Query Frame = 1
Query:  178 FSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN--CTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFS----EIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI--------------------------ISKN------------------KTFGFQNKTSGNLLD-----------ETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVI---SNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPVFVIFSLIYKSENNSNSADK--------FINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ--INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            +S+ IS+ +  +++ ++       +P D FG+I F+        +H +  ++     +T       L+ K W+   P LVISV GG++N     S+ +  F + L +  +T   WII  G++ GVSK VG+ + ++   S    +   +G+   GV++N   LI  +  C Y       +    LN  +  ++  DDG+     N+ +   + EKYL       ++  GVPV+ +++ G    + ++  ++ +  P+++ + +G  +D  +     + ++  +  +  E++  + +   +  +K  K  F+I  +C        +V +D I   ++FD      +D D+              ++  +L++ ++  ++ +  I         KP+ L++ +   L  +++ F++L   + + +   +T   LE LY     +K  P   LL+ L+                          I +                   + +  Q  +SGN  +            T +  +F  ++I+      KS +  VS +   T     Y DL +WA+L    +M++ FW+  ++    A++  I+   M +    K   ++   S +L   SK+F +LA+ ++++A ++++R    +LT  L   +N +CL++AV+G L  F++H+  +    + WMG L      W KI+++I+  P       I +L +KS+   +   +        + +  + S++KE   +    +  + ++ K   N   GL     +   T+K  E FY AP+VKF  Y ++Y+ FL+ F Y  LVE++P       Q    E+ V IYI    ++ V++  I+  GK     + K  IS  WN+ +   I +     V+R+  P  F    R ++ +    +  R + F+ ++   GP V MI KM  ++F+ + I  + ++S+G    ++ +P     +SL  +I + P++  +GE+   E  D      SC        F  A++L +  ++++NLLIA F + + ++++ S  ++   + + +  +H+K
Sbjct:   66 YSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQ------DGEHTHHAKYIRTSYDTKLDHLLHLMLKEWKMELPKLVISVHGGIQN-FTMPSKFKEIFSQGLVKAAETTGAWIITEGINTGVSKHVGDALKSH--SSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLKQSKHLFQILMEC--------MVHRDCI---TIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDRVDIAKKHILIYEQ--HWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELY----NTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEA--KESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPP------TILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVK-EYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYE-FYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQP-------QPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ--KVKVWISEYWNLTETVAIGLFSAGFVLRWGDP-PFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWMIYGEVYAGEI-DVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESISNNLWKYNRYRYIMTYHEK 1098          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A267F5R1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006430g1 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.783e-87
Identity = 275/1100 (25.00%), Postives = 515/1100 (46.82%), Query Frame = 1
Query:  259 DMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN----------CTY--PRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILG--------------VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKL-----RTLFEMNDDE---LVKY-QKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQS---PNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY----------MISLESKDCPYGDLLNDLIISKNKTFGF------QNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKS----ENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNG----LIKTKYYEVITK----------KALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELK-PIEQVKRY-QNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF---QDSVCKTTSCI---------------------IQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF---LKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKM 3255
            D +G + FE ++     Q+  ++R      N+     ++L+ K W+ P P L++SV GG K     + ++ +  ++ +  I     TWI+  G ++G +K+VGE I  Y+     +    LIGV   G V++ E L+ +            TY  P  +    G   L   +  +L CDDG+ ++   + +F   FEK +   +                P + +++ G R +++   +S+    P++++K SG  ++  + I E  ++   ++E +      + FE +  E   LV +  K+A   + +  N+   + +   + +    V      R     ++ +L +L++ +N P++    IF S     + QL    L+ ++L  L+RNQ +F+ L F   I I  L+  E L  LY          M+ L  +       L+  +++++KT G+      Q      LL      V   S  +L+S    +   +  +       +DL +W+++   T+M+ I WR+  D +  A+V A++   MK+L   +G    S QL  ++  FE LA  V+     + ++ T   L R L   +  + L +A  G  + F++  A ++   + W+     + P+W+ L+ +L  P L+P  +    +  S    E+    +D+  +     ++ +   +S   +F ++ + ++      G    L K++  + ++           + +  FY +P VKFI  + S VVFLL F ++ LV LK P E  +   Q   +EF +  +++  I +E++QI +  K+    + K   +  W+V+D    L+ I C++VR  V +E+F++ R  + LT  ++ +R MQFY I  ++GPKV+M+ +MI D  FF  I ++F+++YG    +L  PN    + L+ ++ Y P++Q +GEL L +     D V   +  I                     +    VI  FA ++L+TNVLLLNLLIAMF  TF+ +Q  S K+++  + QL+ EFH +P +  P  ++ +    L+++W  R    +K+ TR  +  + Y +  ++M
Sbjct:  158 DAYGVLRFENFEFTRLGQNAKYIRLDC--LNSRPNLLWKLLTKTWRIPEPELIVSVTGGAKKMRPMSDKIIKKLRQGIINIATKTKTWIVTGGFNLGTNKLVGEAIRDYQLAGGSERDVVLIGVCPWGSVRDKECLLVSEDKSLEDDLPVSTYRNPDNTAPVKGQAVLEPHHTHFLLCDDGTESMFGAEIDFRASFEKKVAEQMVRRRSRGDGSDLRSVTPCVHLIIEGGRKDVQAALVSVETGSPVVVVKGSGRAANVIAYICENTELERYEIEAITEEHFSSEFEPDSSEMRSLVDWLMKLAEPAYQRMLNVYDAESMDPNEQL--DRVILTTFLRQTSLSVVTQL-NLAMAWNRPDLAAQEIFSSERKAKWEQLTGRDLEYSMLRALARNQTEFVSLLFDHGINIGTLLNLETLAGLYSSLINKPDPQMMRLREQLDYLSSPLSSWLMTESKTVGYATHNESQTAYQERLLRAVGLYVSAKSGGVLRSPYPRRDRSSYQA-------EDLLIWSIVVQRTDMARIIWRQTSDTIASALVSAMMLRNMKSLAESEGSLEASAQLGAAADSFEGLAAGVLATCYAQDKQKTLDTLVRRLPVWDGQTLLTLADQGECMEFMSQQAVQTKISDIWIAGSKTYLPLWRTLICMLL-PMLIPALIFDKWLLTSPPAGESTGAGSDRHSSVRMKRSSVQPKTVSTRQSFDRHQQQQQQQQKQQGATPSLRKSQQQQQVSSGGHIQNPSFLQCVFMFYTSPQVKFISTVASAVVFLLLFSFVTLVTLKHPNEATEEEPQPSVLEFVLIGWMVSLIAEEIRQIFDRNKVSALEKLKDWFAHAWDVFDLVLNLMMISCILVRVFVTEEYFVWVRMTYALTLTMFYIRFMQFYLIHQTLGPKVVMVTRMINDTVFFFAILVVFLLAYGVAAQALLYPNSPLSWKLIKDVVYLPYWQMYGELQLGDILADDDKVSPDSPPIMPSNVTGRGFEGGGEGEESEAVHSPLVIVLFAFYMLITNVLLLNLLIAMFQHTFDLVQESSRKLWAYSRYQLIFEFHHRPFLCHPLTVLCHIANVLERLW--RAACGRKAPTR-DAFMVDYDSRTQRM 1241          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A267G848 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004998g1 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 4.113e-87
Identity = 275/1100 (25.00%), Postives = 515/1100 (46.82%), Query Frame = 1
Query:  259 DMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNN----------CTY--PRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILG--------------VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKL-----RTLFEMNDDE---LVKY-QKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQS---PNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY----------MISLESKDCPYGDLLNDLIISKNKTFGF------QNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKS----ENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNG----LIKTKYYEVITK----------KALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELK-PIEQVKRY-QNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEF---QDSVCKTTSCI---------------------IQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF---LKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKM 3255
            D +G + FE ++     Q+  ++R      N+     ++L+ K W+ P P L++SV GG K     + ++ +  ++ +  I     TWI+  G ++G +K+VGE I  Y+     +    LIGV   G V++ E L+ +            TY  P  +    G   L   +  +L CDDG+ ++   + +F   FEK +   +                P + +++ G R +++   +S+    P++++K SG  ++  + I E  ++   ++E +      + FE N  E   LV +  K+A   + +  N+   + +   + +    V      R     ++ +L ++++ +N P++    IF S     + QL    L+ ++L  L+RNQ +F+ L F   I I  L+  E L  LY          M+ L  +       L+  +++++KT G+      Q      LL      V   S  +L+S    +   +  +       +DL +W+++   T+M+ I WR+  D +  A+V A++   MK+L   +G    S QL  ++  FE LA  V+     + ++ T   L R L   +  + L +A  G  + F++  A ++   + W+     + P+W+ L+ +L  P L+P  +    +  S    E+     D+  +     ++ +   +S   +F ++ + ++  +   G    L K++  + ++           + +  FY +P VKFI  + S VVFLL F ++ LV LK P E  +   Q   +EF +  +++  I +E++QI +  K+    + K   +  W+V+D    L+ I C++VR  V +E+F++ R  + LT  ++ +R MQFY I  ++GPKV+M+ +MI D  FF  I ++F+++YG    +L  PN    + L+ ++ Y P++Q +GEL L +     D V   +  I                     +    VI  FA ++L+TNVLLLNLLIAMF  TF+ +Q  S K+++  + QL+ EFH +P +  P  ++ +    L+++W  R    +K+ TR  +  + Y +  ++M
Sbjct:  159 DAYGVLRFENFEFTRLGQNAKYIRLDC--LNSRPNLLWKLLTKTWRIPEPELIVSVTGGAKKMRPMSDKIIKKLRQGIINIATKTKTWIVTGGFNLGTNKLVGEAIRDYQLAGGSERDVVLIGVCPWGSVRDKECLLVSEDKSLEDDLPVSTYRNPDNTAPVKGQAVLEPHHTHFLLCDDGTESMFGAEIDFRASFEKKVAEQMVRRRSRGDGSDLRSVTPCVHLIIEGGRKDVQAALVSVETGSPVVVVKGSGRAANVIAYICENTELERYEIEAITEEHFSSEFEPNSSEMRSLVDWLMKLAEPDYQRMLNVYDAESMDPNEQL--DRVILTTFLRQTSLSVVTQL-NMAMAWNRPDLAAQEIFSSERKAKWEQLTGRDLEYSMLRALARNQTEFVSLLFDHGINIGTLLNLETLAGLYSSLINKPDPQMMRLREQLDYLSSPLSSWLMTESKTVGYATHNESQTAYQERLLRAVGLYVSAKSGGVLRSPYPRRDRSSYQA-------EDLLIWSIVVQRTDMARIIWRQTSDTIASALVSAMMLRNMKSLAESEGSLEASAQLGAAADSFEGLAAGVLATCYAQDKQKTLDTLVRRLPVWDGQTLLTLADQGECMEFMSQQAVQTKISDIWIAGSKTYLPLWRTLICMLL-PMLIPALIFDKWLLTSPPAGESTGAGGDRHSSVRMKRSSVQPKTVSTRQSFDRHQQQQQQQHKQQGATPSLRKSQQQQQVSSGGHIQNPSFLQCVFMFYTSPQVKFISTVASAVVFLLLFSFVTLVTLKHPNEATEEEPQPSVLEFVLIGWMVSLIAEEIRQIFDRNKVSALEKLKDWFAHAWDVFDLVLNLMMISCILVRVFVTEEYFVWVRMTYALTLTMFYIRFMQFYLIHQTLGPKVVMVTRMINDTVFFFAILVVFLLAYGVAAQALLYPNSPLSWKLIKDVVYLPYWQMYGELQLGDILADDDKVSPDSPPIMPSNVTGRGFEGGGEGEESEAVHSPLVIVLFAFYMLITNVLLLNLLIAMFQHTFDLVQESSRKVWAYSRYQLIFEFHHRPFLCHPLTVLCHIANVLERLW--RAACGRKAPTR-DAFMVDYDSRTQRM 1242          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A210PMT1 (Transient receptor potential cation channel subfamily M member 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05997 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 5.632e-76
Identity = 289/1122 (25.76%), Postives = 521/1122 (46.43%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISN-NCTYPR-------ASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI------------LGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFS-------EIFEQEKINI-----KDVEKLRTL-FEMNDDELVKYQKIAF-----EIFSQCKNLVTI---KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQ--------------------------------NKTSGNLLDETYKI--VQFLSENILKSSLTDKSIKNQ----VSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVI---TKK-------ALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQD---SVCKT----------TSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEE 3312
            PCD +G I F GY +  ++  P ++R  +   +T  +   ++I   W+ P+P L+ISV GG K    K   LE+ FKR L     +   WII  G   GV +IVGE +  Y      Q     +GV   GV+ N + L  + N  +P         +E    T  L+  +  ++  DDGS +    + EF  + EK + ++            +  PVI +++ G    ++T+  S+   +P+++++ +G  +DF +       +I  +++ +      + +E++ T  FE    E  K  KI+      E   + + ++T+        KDL   K++ + ++  NK +   +    L++ +N  +V    IF S   +      L   +   L +N+  F++LF    +E+ + +T +NL  LY   L  K      L N+LI+   +T+G                                  N   G+  D  +K+  V      I+    T+KS+  +    V  +  +  ++LFLWALL    +++ +FW+  KD++G A++ A +   +  +   + +  +S  L ES+  FE+LA+ V+    + ++     +L R L    N + L +A    L+ F++H++C++     W G ++ +   +KIL  ++  PFL+P     S    +E   +      +    +   E   I   S      E++      +  IK K Y+V    T K       A+  FY APV KF  Y ++Y+ FL  F Y  L  L P   V    N  +E+  + + +  +++EV+Q+    +    ++ ++  S  WN +D    L+ ++ V++RF + ++ F +AR  + +T  +Y LR MQ +F+  +IGPKVIMI+KM+ D+ FF  I  +F++S+G  + +   PN    + L+  + Y P++Q +GEL L+  +    S C T            C      V    A+++LLTN+LL+NLLIAMF  TF ++Q+ S K++   +  LV E++++P V PPF ++ +  + +    ++ F+K N      F  +L+  +  ++  FER ++E     T E
Sbjct:  350 PCDSYGEIEFHGYGH-DTESSP-YIRLAN---DTQPELVLDIILNYWKLPTPKLLISVTGGAKRFDMKPKLLEK-FKRGLINAATSTGAWIITGGTHTGVMEIVGEGVQEYVLTYGKQKDIVCLGVPLWGVIANKDALDEDENGNFPAIYSKEGLDAEKGKKTIPLDHNHTHFVIVDDGSRDKFGGEIEFRANLEKTISHMSCDSEGMSSNLQVNTPVISLIVEGGVGTMKTVSESIKNGIPVLVLEGTGRAADFIAAGYLFTKDIMNEDRSHFPPHYQQTMEEIATNNFEWKPGETNKPAKISLCLKQLESCLKSRRMITVFNLGDAENKDLD--KAILNALLKANKSNQ--SAQLSLALAWNRSDVARNTIFSSSKKTIFGAS-LHDAMTTALIQNKKTFVKLFLENGVELKDFLTVKNLWNLYANCLNDKTDRSAQLFNNLIMYLKQTWGAYLCCRPVEHLGNQPELVELVGKTIVHIVGDEAINPYDGSKTDR-FKVCDVDPCMGYIVDDKATEKSMAGKKWRHVKHDFELPERELFLWALLLNRMDLAKLFWKLGKDHLGTALLAAALLKGLAKVADGEEEIELSVSLEESALMFEKLAVDVLSHCYKHNKALAHQLLVRQLVDYGNTTLLLLADAHELMDFMDHTSCQTKLNSVWKGRMALYTSTYKILAAMVI-PFLIPAIKFTSNKNPTEYLDDDDALDYDNLGEAMAGEGTAIISNSRVAPETESR------SKQIKRKLYQVSLAGTGKDGISLVSAIYHFYTAPVTKFYWYTVAYLAFLAIFSYFVLTNLHPTSSVNSPSN--IEYVTWGWTITMVIEEVRQVLTRDQRSLVHKLRSWYSSVWNRFDLIMYLLFMLSVILRFVLSEDNFTWARMTYSITLAMYFLRFMQAFFVEKNIGPKVIMIRKMLTDLMFFFAILAVFVLSFGIAYQANLFPNDPPSWKLLRQVVYLPYWQMYGELFLENMEGEEPSSCTTNETLWRSGAQARCAENNAIVPLLLAVYMLLTNILLVNLLIAMFSDTFQKVQDNSLKVWRFYKFSLVYEYYERPSVFPPFIILNHAFRGVRWLMHKSFRKLNYHDD--FKLHLSARDNTRLTLFEREAVEDYLHTTRE 1448          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A267EVM8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014651g1 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.452e-72
Identity = 291/1115 (26.10%), Postives = 512/1115 (45.92%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINK--LWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMK-TNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIE--KLISNNCTYPRAS--EFSNGTFN-------LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-----------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSD---FFSEIFEQEKINIKDVEKLRTLFEMNDDELV-KYQKIAFEIFS---QCKNLVT------IKQIVRKD---------LILYKSVFDVIIS--------RNKDH-DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLD-------ETYKIVQFLSENILKSSLTDKSIKN------------QVSLNLA-------------------VTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIY---KSENNSNSADKFINGNSF-STNKEVFKISFA-----------------SNFYKNNEN----KRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQ-------------------VKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNG------EFGF-SLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLK 3162
            P + FG +  +G+  L     P ++R  S   +   +  +EL+     W  P P+LV+SV GG K     +++L +  K+ L  +     TTWI+  G ++G S++VG+ I  Y     G  Q  +IG+ S G V N E  ++ S N    +    E++N T N       +   +  ++FCD+G+      + EF  DFE+Y+           +N    PV+++++ G +  +     S     P+I ++ SG  ++   FF  I              R L    DDE V K  K   E +    +C  L        + Q  ++D         L +Y +  D  ++        ++KD+ D       L + +   ++    IF     S+    +L++ +   L++ Q+ F++LF    I++++ ++ E L  LY     S       LL+ L   K     F++ TS ++ D       ET   V   + N L    T+ ++ N            + +  LA                    T QDLFLW+LLT + E++++FW+  KD +G A++G  I N M      +G+   ++QL   + +FE+LA+ V++E + +++   R +L R L   N  + + IA     +  L  +  ++   + WMG +      W+I+L  LF PFL+PV V         K E   ++ D+        S  KEV  +                    S+F K N      ++  +  +GL +  +       +L  FY AP+ KFI+ +IS V FL+ + Y+ LV+L P+++                   +   Q   +E +++++   ++++E +Q  +  K +   + K G    W+ +D     + ++C+V+R +V  + F + R  + LT  L  +R MQFY+ S ++GPKV+MI  M+ D+ FF+ I L+F+++YG  + SL   N       +F F  ++  + Y P++Q +GEL L+     +    S   +   VI   A ++L TNVLLLNLLIAMFG TF ++Q+ES K ++ I+ +L+ E++ +P++PPPF  I + ++
Sbjct:  237 PTNSFGRMKLQGFGRLGVTHKPFYIRIDSETRD--FEALWELMTSPMYWALPLPDLVLSVNGGAKKMEKMSAKLLKKVKQGLTNVASGVKTTWILTPGFNLGCSQLVGQAIQEYNFAG-GAQQIWVIGLCSWGAVYNRECLEIDSTNSKAEQIDTVEYANCTENPGRGQAAIEPNHTHFIFCDNGTVRYFGTEMEFRADFEQYIVNKLKSLVKNKENAFNPPVVQLVIEGGKKAVLMAGKSAEAGTPVITVQGSGRAANELAFFRNI--------------RNLHSRADDEFVMKKIKDMLERYQPTWKCNELEAKEITHVLMQFSKEDPKSKFDCHMLSVYNTELDEDMAKTILYTFFKHKDYKDSTMTQVRLCMAWQRADIAAAEIFAEARKSKWTGMNLQRAMKEALNKQQVDFVKLFLEHGIDLSKFLSLETLSDLYAKMFRSGSQQADRLLHKL--DKLPCCSFRSVTSQDVWDASNNFNKETDPQVIMQAVNWLIKVYTEHAVDNLYTPENLQENPMKGASPLARPLLRETIFPPYTKNGKRRFTSQDLFLWSLLTHNVELAVLFWKHGKDQIGSALIGYSILNNMAMDAAKRGEMETTDQLTRDAHRFEQLAVGVLEECS-KNRAVCRLLLIRSLPYWNQQTVMAIAEANQCMDMLYQTPVQTVLTQTWMGGMEADTSNWRIIL-CLFLPFLVPVLVFHQHAADQIKGEPEISTGDQPETQRQVKSVMKEVEAVDMRGFHAREAMEDLQVEEVISDFNKQNRREMRLRKMRHQRHGLRRMAFC-----ISLGLFYSAPICKFILNVISTVSFLIFYSYIVLVQLHPVQRSCKINSTYSISPPSDVEPFISFPQPHGIEIYMFLWAFTYVLEEFRQFFS--KQQPLVK-KVGELSYWDKFDMVISALFVLCLVLRLTVACQNFDWVRNAYALTLALCFIRFMQFYYPSQTLGPKVVMIINMLNDVIFFVLILLVFMLAYGVAYFSLMTDNNYNYVNKKFDFHDIMRGVLYIPYWQMYGELELESVDQGMAVGGS---RNWLVIVLMAFYMLGTNVLLLNLLIAMFGHTFEKVQSESNKYYAYIRHELIYEYYTRPVLPPPFVFISHIIR 1319          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Match: A0A4W3H5R4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.693e-72
Identity = 272/1044 (26.05%), Postives = 473/1044 (45.31%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQ-GSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP---RASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL-QNILGV-------PVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEI--FEQEKINIKDVEK-LRTLFE-----MNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVII--SRNKDH---DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTD-------KSIKNQVSLNLAVTY--------------------QDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGI--SGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLD---EFQDSVCKTTSC-----------------IIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFL 3159
            P D FG I FEG  N          ++    + T     YEL+ K W    P+L+ISV GG KN   K S L   F R L ++ K+   WII  G   GV K VGE +  Y    S  + +   IGV++ G+V N E LI+    +P      E + G  + L+  +  ++  DDG+      +     + EKY+ +  +G        P+I ++L G    L TIH ++M  +P ++++ SG  +D  + +      +I I  ++K LRT F       +D  ++ + K   +I    + L   K    ++  L  ++   ++  S N  H   + +     L++ ++  ++ ++ IF      + K  +L + +   L  N+  F+ELF    + + E +T E LE LY       + P   LL   +  +    G + + + + +D   +I+      IL+  L D       K   +Q   +L + +                    +DLFLWA+L     ++ I W +  D++  A+V   I   +K L      T +S  + E ++++E+ AI V  E   +  +  + +L R      N +CL++A+ G+  +F+     +S+  + W GD+S     W++LL ++  P +   F+ F             D+ I        K+  K+  +S+  + +     C                 + L AFY APVV F   +++Y  FL  F Y+ L++ +        Q    E+F+Y+++   + +E++Q+ +N     F++ KA +  S  WN  D + ILV ++ +  R+    E F + R +  L F +YC R M  + ++ ++GPK+IM+K+M+ DIFFFL +  L IV++G     +   N +    +   + Y P+   FGE+ +D    F  + C  T                     ++ TVI    I+LL TN+LLLNLLIAMF  TF  +Q  ++KI+   +  L+EE+H +P  PPPF ++ + +
Sbjct:   87 PTDAFGDIVFEGQRN---------GKYVRVSSGTAPATLYELMTKQWGLNPPHLLISVTGGAKNFYLKPS-LRNLFCRGLIKVAKSTGAWIITGGSHAGVMKHVGEAVRRYTMTSSSKEGEVVAIGVATWGIVHNRECLINKEGMFPVEYTLDEENQGRLSCLDHNHSHFILVDDGTHGKYGVEILLRSNLEKYISKQRMGTEDVGIETPIICVVLEGGEGTLNTIHSAMMNGMPCVIVEGSGRAADVLASVANLPVSQITISLMQKQLRTFFSETFNTFSDRRIISWTKKVQDIVRMHQLLTVFKAEKARNQELDVAILQALLKASSNASHLGKENLEHQLKLAVAWDRVDIAKSEIFTDKK--RWKSSNLHQAMFAALVGNKPGFVELFLENGVNLGEFVTPEILERLY------NNVPQSTLLYKKL--RKAVEGERRRDASDNVDAKQRILLHHVSGILRELLGDFTEPFYEKPKDHQCKKHLKLKHSDSQESEICDDVEQEFEEPARDLFLWAILQKRKMLANILWVQSSDSIASALVATKI---LKKLSSEANDTDLSEAMEELAQEYEDRAIGVFTECYRKDPKRAQKLLIRVSNAWGNTTCLRLAIEGDDQNFMAQGGVQSFLTKIWWGDISVDTQTWQVLLCMVLWPIIHSNFISF-----------RQDEEIR------MKKASKVDSSSDISQKDLKPLSCC----------------ERLRAFYTAPVVVFYWNVLAYFGFLWLFSYVLLIDFQS-------QPSGREYFLYLWLFTLVCEEIRQLFSNPDDLGFWK-KAILYFSDIWNKLDVAAILVFLVGLACRWI--SETFYYGRIILCLDFIIYCFRVMHIFAVNKTLGPKIIMVKRMMKDIFFFLFLLALSIVAFGVAKQGILIHNEDRLDWIFQGVVYHPYRMIFGEIPIDVVSGFDLNQCTLTGSDPYKPKCPEHDSNNNPIFPEWITVIL-LCIYLLFTNILLLNLLIAMFNYTFQLVQENTDKIWKFQRCHLIEEYHSRPSAPPPFIILSHII 1063          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 241.506 bits (615), Expect = 5.313e-65
Identity = 250/1101 (22.71%), Postives = 471/1101 (42.78%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQN--QACLIGVSSCGVVKNIEKLISNNCTYPRA---SEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQ---------NILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ-------------------EKINIKD--VEKLRTLFEMNDDELVKYQKIAFEIFS--QCKNLVTIKQIVRK-----DLILYKSVFDVIISR-NKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFG----FQNKTSGNLLDETYKIVQFLSENILKSSLTD-----------KSIKNQVSL---------NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTI---LVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRT----------------VIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILF 3297
            P D FG + F G     S +H NF+R  S   +TP   AY ++   W  P PNLV+SV+GG+     K  +L    ++ L    ++   WI+  GL  G+ + +GE +  +   +   +  +   IGV+  G+V   ++L++   +YP     +  S  ++ L+  +  +L  DDGST     +  F    E Y+            + +PV+  ++ GE   LE + +SL + +P +++  SGGL+D  +++ E                     KIN+++   EK+   F    D      K+  ++ +  + ++L++I  + ++     D +L K++      R + D  +  +   L++ +N  ++  + +F      Q K E L+  +   L  ++ +F+ LF    + + E +T   LE LY  S+      Y  LL   +  +    G      +   G  L E  ++++ L  ++ +    D           K+IK   ++              +  LF WA+L   +EM++ FW    ++V  A+    +   ++ L   + +T   + L E + KFE LA  V  +  + S+  +  +L +        +CLQ+A+  +  HF +H   ++   + W GD+      WK++LT+   P      + F  + ++E+ +           +   + VF  +         E  RF    N   K+   +       + F+ APV  F   L + +++ L  +    V L   +         ME  +Y ++   + +E++     G +    R +      W+  D   I   L+ + C + R S     F FAR    L + ++ LR +  + I   +GPK+I++ KM+ D+FFFL    +++++YG     L          ++  +FYRP+   FG++  ++         +C                      V+    I+LL+TN+LL+NLLIAMF  TF ++Q  S+  +   + +++ E+H +P + PPF +  +F + I     R  +K  + K   F   L D    +++ +E I  E L 
Sbjct:   86 PTDAFGEVEFGGV----SKRHSNFLRLSS---DTPPATAYTILTSNWGLPKPNLVLSVVGGVGRSKVK-PKLREVLRQGLVRAAQSTGAWILSGGLREGIDRCLGEAVRDHTTAASSDSLTKVVAIGVAPWGLVNLRDELVNPEGSYPAGYFVTNTSRDSYCLDTNHQAFLLVDDGSTGRRGGEARFRAGLENYISQQRTGKLGSGSMDIPVLCTLVSGELYMLERLDLSLKKCIPWMVLAGSGGLADLVTDVLENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFPSEPD----VDKLVDKLLNVHKSQDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLSTEELKLAVTWNRVDIARSELFTGD--IQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELYR-SISDSSVAY-TLLQRHLSERQGVAGTGWPAADPAKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTVLQEGEYRQQRCVFPWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKL---LRELCKLENETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTLFIPPLCYTSLISFREVEEAEDGTPEEAPKARDIDWLYAETVFSFADIKRIQTKQEELRFTPKGNPTKKSPQKQCFLLSRWKQFWYAPVTAF---LGNMLMYFLFLLLFAYVLLVDFKPPPPKGPSPMELLLYFWVFTIVCEEIRGTFFIGNMTVRQRIRQYTQDLWHKCDLIAITLFLIGLCCRMFRRS-----FWFARAALCLDYMVFTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLAVWMMAYGVANQGLIYSFDPSADRILRRVFYRPYLHIFGQIPYEQMDSGFEWNVTCTTNVTEIDENMEPCRDTRYNWMVVILLMIYLLVTNILLINLLIAMFSYTFTKVQERSDVYWKFQRFKVIIEYHSRPCLAPPFIIFSHFHQFI----KRNIRKVPSEKIHQFAVDLIDKANNRMMTWENIQKENLL 1155          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 223.402 bits (568), Expect = 4.219e-59
Identity = 266/1151 (23.11%), Postives = 494/1151 (42.92%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAY--RQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFN---LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQN----ILG-----VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ----EKINIKDVEKLRTLFEMN-DDELVKYQKIAFEIFS----------QCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDET---------------YKIVQFLSE--------------NILKSSLTDKSIK--NQVSLNLAV-------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKR----------------------FCNISNGLIKTKYYEVITKKALEA----------------FYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ---INNNGKLETFYRFKAGISGTWNVYDFSTIL---VSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-----DSVCKTTSCIIQYRT-----------VIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPP---FNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILF 3297
            P D FG + F G    +  +H +F+R      +TP    Y ++   W  P PNLV+SV+GG   +  K S +    ++ L    ++   WI+  GL  GV   VGE +  +     S  Q++   IGV+  G+V N ++L++   ++P      N + +   L+  Y  +L  DDGS      +  F+ + E Y+ N    I G     +PV+ +++ GE   L+ + MSL +  P +++  SG  +D  SE+ +           DV    T    N   E++K    A ++            Q + L+T+    +      D +L K++       + D     +   L++ +N  ++ ++ +F      Q + E LK  +   L  N+ +F+ +F    + I E +T + LE+LY  SL      Y  LL   +  ++        +  +   ++               Y++ + L E              ++   +   K+ K  N++  + A         +  LF+WA+L   +EM++ FW    +  G +++ A+   KM + L   + +T     + E ++KFE LA        + S+  +  +L R       ++CLQ+A+  +   F +H   ++   + W GD++    +WK++ +     FL+P  +  +LI   E+     D  + G S +T      +S A       E+ R                        +I+      + Y  + K    A                F+ APV  F+  ++ Y +FL  F Y+ LVE KP           +E+ +Y ++   + +E +Q   + N G  ++   +   I   WN +D + I+   V ++C +  +S     + F R +  + + ++ LR +  + I+  +GPK+I++ KM+ D+FFFL    +++++YG    +L        + +   +FYRP+   +G++ LDE       D  C     +I               V+   +++LL+TNVLLLNLLIAMF  TF+++Q  S+  +   +  L+ E+H +P + PP   F+ ++ F+K       R  +K  + K   F+  L   +  ++  +E +  EIL 
Sbjct:   84 PTDAFGEVEFAG----AGRRHSHFLRL---SCDTPASLVYSIMTVHWGLPPPNLVVSVMGGGGREKVK-SWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELFNGD--IQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQ-SLSDSSLAY-SLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFW----EMAGESVLSALCACKMLRELCKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVAS-----FLMPPLIYTNLINFREHQVRHTDS-LEGPSTATA----ALSLADLTRHTEEDSRPEDGHHGESDHPDGGGEETPFSLADITQAEEDAEEYAALKKDPKGAKSNLNKHPFMLQRWRQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAH---IEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLY---IQDMWNKFDLTAIMLFCVGLVCRMFPWS-----YEFGRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRPYWVFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIHEGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKFQRYNLIVEYHSRPCLAPPFIIFSHLHLFIK-------RSIRKVPSTKIKHFMLELRGRKASRLNTWEAVQKEILL 1190          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 222.631 bits (566), Expect = 7.586e-59
Identity = 269/1150 (23.39%), Postives = 493/1150 (42.87%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAY--RQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFN---LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQN----ILG-----VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQ----EKINIKDVEKLRTLFEMN-DDELVKYQKIAFEIFS----------QCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDL------LNDLIISKNKTFGFQNKTSGNLLD--------ETYKIVQFLSE--------------NILKSSLTDKSIK--NQVSLNLAV-------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKR----------------------FCNISNGLIKTKYYEVITKKALEA----------------FYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ---INNNGKLETFYRFKAGISGTWNVYDFSTIL---VSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-----DSVCKTTSCIIQYRT-----------VIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPP---FNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILF 3297
            P D FG + F G    +  +H +F+R      +TP    Y ++   W  P PNLV+SV+GG   +  K S +    ++ L    ++   WI+  GL  GV   VGE +  +     S  Q++   IGV+  G+V N ++L++   ++P      N + +   L+  Y  +L  DDGS      +  F+ + E Y+ N    I G     +PV+ +++ GE   L+ + MSL +  P +++  SG  +D  SE+ +           DV    T    N   E++K    A ++            Q + L+T+    +      D +L K++       + D     +   L++ +N  ++ ++ +F      Q + E LK  +   L  N+ +F+ +F    + I E +T + LE+LY  SL      Y  L       + L+     +     K S   L           Y++ + L E              ++   +   K+ K  N++  + A         +  LF+WA+L   +EM++ FW    +  G +++ A+   KM + L   + +T     + E ++KFE LA        + S+  +  +L R       ++CLQ+A+  +   F +H   ++   + W GD++    +WK++ +     FL+P  +  +LI   E+     D  + G S +T      +S A       E+ R                        +I+      + Y  + K    A                F+ APV  F+  ++ Y +FL  F Y+ LVE KP           +E+ +Y ++   + +E +Q   + N G  ++   +   I   WN +D + I+   V ++C +  +S     + F R +  + + ++ LR +  + I+  +GPK+I++ KM+ D+FFFL    +++++YG    +L        + +   +FYRP+   +G++ LDE       D  C     +I               V+   +++LL+TNVLLLNLLIAMF  TF+++Q  S+  +   +  L+ E+H +P + PP   F+ ++ F+K       R  +K  + K   F+  L   +  ++  +E +  EIL 
Sbjct:   84 PTDAFGEVEFAG----AGRRHSHFLRL---SCDTPASLVYSIMTVHWGLPPPNLVVSVMGGGGREKVK-SWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELFNGD--IQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQ-SLSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFW----EMAGESVLSALCACKMLRELCKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVAS-----FLMPPLIYTNLINFREHQVRHTDS-LEGPSTATA----ALSLADLTRHTEEDSRPEDGHHGESDHPDGGGEETPFSLADITQAEEDAEEYAALKKDPKGAKSNLNKHPFMLQRWRQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAH---IEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLY---IQDMWNKFDLTAIMLFCVGLVCRMFPWS-----YEFGRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRPYWVFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIHEGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKFQRYNLIVEYHSRPCLAPPFIIFSHLHLFIK-------RSIRKVPSTKIKHFMLELRGRKASRLNTWEAVQKEILL 1190          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 197.978 bits (502), Expect = 5.306e-51
Identity = 248/1031 (24.05%), Postives = 468/1031 (45.39%), Query Frame = 1
Query:  373 ELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYP---RASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNI-----LGVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDF--FSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNL--VTIKQIVRKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKP-EHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDE------------------------TYKIVQFLSENILKSSLTDKSIKN-----------QVSLNL--------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQT-----VISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWK-ILLTILFSPFLLPVFVIFSL--------------IYKSENNSNSADKFINGNSFSTNKEVFKISFAS---NFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLV--ELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDE---FQDSV------CKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPF 3138
             L+ K WQ   P L+ISV GGL+N   +  +L++ F + L +   T   WI   G++ GV + VG+ +  +   SRG+   C IG++  G+V+N E L+  +   P    ++  S  T  LN  +  ++  D+G+T     + +     EK+  LQ I      GVPV+ +++ G    +  +   L +   +P+++   SG  SD   F   + +E   I   E LR      D  LV  QK      +Q ++L  + ++ + +K+LI   +VF +    ++D D+                   L++ +N  ++  ++IF    + Q  P   L++ +L  L  +++ F++L     + +   +T   LE LY       +  Y  L+ D+  S+   +       GNL  +                        T K  + L  N+      D  I+            +V ++L        +  + +L +WA+L    +M+L FW+  ++    AM  A++  K+   + ++         IS +L  +S++F +LA+ ++ ++ ++ ++    +LT  L+  +N +CLQ+AV      F+ H+  +    + WMG L     M K   L ++    L P  +                   Y  E +S+ ADK       + +K+   + F +   N       K+        ++ ++  +   + +  FY AP+VKF  + ++YV +L+ F Y+ LV  +L P  Q         E+ V  YI    ++++++I  +  GKL    + K  +   WN+ D   IL+  I +V+R   P     + R ++ +    + +R +  + ++  +GP V+MI KM++D+ +F+ I L+ ++S+G    ++ NPN +  + L  NIF+ P++  +GE    +    +D        CKT + I+         A +LL+ N+LL+NLLIA+F +TF E+++ S +++   + QL+  FH++P++PPP 
Sbjct:   17 HLMTKEWQLELPKLLISVHGGLQNFELQ-PKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGK--ICTIGIAPWGIVENQEDLVGKDVVRPYQTMSNPLSKLTV-LNSLHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLIN--ESLR------DQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELI---TVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWNRVDIARSQIFI---YGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLY-HLVRDVKKSEETLY-----LQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFSFPFHELMVWAVLLKRQKMALFFWQHGEE----AMAKALVACKLCKAMAHEASENDMVEDISQELNHNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLR----MRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQEQEAYLQEKDSDEADK------PAKDKDEEDMEFTAMLGNVSSEASRKKVVE----EVQHRHRLIPVGRKIYEFYNAPIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQ---------EWIVIAYIFTNGIEKMREILMSEPGKL--LQKVKVWLQEYWNITDLMAILIFSIGMVLRLQDP-PLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEAPCGQNITTEDGTIVPLPPCKTGAWIVPAI-----MACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPL 988          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:103047602])

HSP 1 Score: 183.341 bits (464), Expect = 1.385e-46
Identity = 209/996 (20.98%), Postives = 447/996 (44.88%), Query Frame = 1
Query:  370 YELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQN-QACLIGVSSCGVVKNIEKLISNNCTYPRA---SEFSNGT-FNLNEFYDCYLFCDD-----GSTNLCQNDKEFLVDFEKYLQNILG---VPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKL--RTLFEMNDDELVKYQKIAFEIFSQCKNLVTI---KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGF---QNKTSGN------------LLDETYKIVQ-FL------------SENILKSSL--TDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFS-LIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ-INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFG-----------------FAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
            Y+L+ + W    P+LV++++GG +    K   L    ++ L    ++   WI+ +GL  G++K +G+ +  +   S     +   IG++   ++ N E L++     P A    +  +G+ ++L+  +  ++  ++     G+T   +      +  ++      G   +PV+ +++ GE   L+ ++ ++    P +L+  SGG++D    +  +   + + V++L   T   ++  ++  + K+  +I     +L+T+   +Q    D ++ K++     S++++         L++ +N  ++ ++ IF      +  P+ L++ ++  L  ++  F+ LF    + + E +T   L+ LY  S+  K      LL DL++ K++         +T G              L E  K+++ FL            +E + K  L  + K + + +  +    ++DLFLWA+L    +M+  FW    + V  A+ G  I  +M +L   + +   +  + E+  K+E+ A+ +  E    S+     +L R     +  + L +A   +   F  H   ++   + W G ++    + K++L+    P +    + FS  I +S       ++F   +S  T K +       +  +   +    + S        +     +  + F+ APV  F+  ++ Y  FL+ F Y+ L++ +P            E  +Y ++   +++E++Q    +  +    + K  +   WN  D   + +S+  V V   + +  +   R +  L F ++ LR +  + I   +GPK+I++++M+ D+FFFL    +++++YG    +L +PN      +   + YRP+   FG++ L+E   +  +  +C +  + +I G                   I+LL+TNVLLLNLLIAMF  TF  +Q  ++  +   +  L+ E+H +P + PPF +I + 
Sbjct:   96 YQLLTEQWGLSPPHLVVALVGGDELDQMK-PWLRDTVRKGLVRATQSTGAWILTNGLQFGITKHLGQAVRDHSLASTSSKVRVVAIGIAPWTMIHNKEMLLTAKPDQPAAYPTEDLPHGSVYSLDCHHSHFILVEEEQHRSGATGDMRVKLLKHISLQRTGYGGPGSFEIPVLCLLVHGEPKILQRMYKTIQNATPWLLLAGSGGVADILVTLIYRGCWDTEMVQELLLETFTGLHSTDITSWVKVIQKILEN-GHLLTVHDPEQTADLDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIFNGD--VEWSPQDLEEVMMDALVNDKPDFVRLFVDNGVNLGEFLTYGRLQELY-CSVSEKS-----LLFDLLLKKHQEKQMLLASARTPGPPYMEPVDRRPRFTLHEVSKVLKDFLHDSCKGFYQKLPAERVGKGRLFHSQKDLPD-LDQHCENPWRDLFLWAVLQNRQKMANYFWAMGPEAVAAALAGCKILKEMAHL---ESEAESARSMKEA--KYEQFALDLFSECYSNSEDRAYALLVRKTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTSISKLVLSFFCPPLIWTNLIKFSDEILQSRGG---GEQFAELDSLDTEKALLLSDDDPDDSEAAGDPADQSCSQA------WSQFLLRRWKRFWSAPVTVFLGNVLMYFAFLVLFTYVLLLDFRPPPPDG---PSIAEIILYFWVFTLVLEEIRQSFFTDEDMNILKKCKLYVEDNWNKCDM--VAISLFVVGVSCRMMENTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRLDWVFRRVLYRPYLHIFGQIPLEEIDAAKMQPDNCTMDLQDIITGTLPPCPNIYANWLVILLLVIYLLVTNVLLLNLLIAMFSYTFQVVQGNTDIFWKFQRYNLIVEYHSRPALAPPFIIISHL 1061          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 173.326 bits (438), Expect = 2.665e-44
Identity = 221/1031 (21.44%), Postives = 441/1031 (42.77%), Query Frame = 1
Query:  289 YDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFK-NSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNC----TYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKY--LQNIL----------GVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDFFSEI--------FEQEKINIKDVEKLRTLFE-MNDDELVKYQKIAFEIFSQCKN---LVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIF-QSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY-MISLESKDCPYGDLLNDLIISKNKTFGFQ----NKTSGNLL----DETYKIVQFLSENILKSSLTDKSIKNQVSLN--------LAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTV--ISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPVFVIFSLIYKSEN------NSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGK-------------LETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTT-----------------SCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            Y  +S D  P+ +               +L+ K WQ   P L+ISV GGL+N  F+ + +L++ F + L +   T   WI   G++ GV   VG  +  +   SR  ++ C IG++  GV++N   L+  +      Y   S   +    LN  +  ++  DDG+      + +   + EK+  LQ I           GVPV+ ++  G    + T+   L+E   +P+++ + +G  +D  + +        +     + + +  L+TL E M   ELV  +         C +    ++    V   + L+++      + +      A   +L++ ++  ++ +  +F    ++  L     ++ +L  L  +++ F++L     + + + +T   LE LY  +S    + P   LL +   S++   G          GNLL      T   +Q +     +      +    V+L+         A  + +L  WA+L     M++ FW+  ++++  A+V   +   +      + + V   S +L + S +F +LA+ ++ ++  + +R    +LT  L   +N +CL++AV+     F+ H+  +    + WMG L+     W K++L+IL  P       I  L YKS+        S    +  NG++    +   K           E   +   S   +  + YE         FY AP+VKF    ++Y+ FL+ F Y+ LV+L+ +  V+       E+FV +Y+    ++ V+++++  +                  + K  + G WN+ D   IL+  + V +R        I A+ ++ L    + +R +  + ++ ++GP ++MI KM+ ++F  + I  + ++S+G    ++     +  + L  NI ++P++  FGE+   E  D +C                     C        F  A++L +  ++++NLLIA F + + E +N S+K++   +      +HQK
Sbjct:    1 YARVSYDSRPDLL--------------LQLMVKEWQMELPRLLISVHGGLQN--FELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEH--ASRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGWAHTHRHGQAMHLLQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIALHRTGAAAGTNFSS-----ADQLNLALAWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKRPLLAN---SRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEA-KQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPP------SILMLEYKSKAEMSHIPQSEELHQMGNGSAADGGESGHK----------EEEGIWIRPSGLSLSRRIYE---------FYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ-------EWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGILLFFVAVALRSQ--SHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEI-DGICVAVLAACENIMKNNTDDEYPPCTTGAFITPFLQAVYLFVQYIIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQK 969          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 171.4 bits (433), Expect = 1.065e-43
Identity = 222/1046 (21.22%), Postives = 447/1046 (42.73%), Query Frame = 1
Query:  289 YDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFK-NSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNC----TYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNIL-------GVPVIRIMLGGERCELETIHMSLMEN--LPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIV----RKDLILYKSVFDVIISRNKDHDMI-------------AKLFDLSIRFNCPNVVETRIFQSPNFSQLKPE--HLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDK---------------------------SIKNQVSLNL----------AVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSK-KFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMW-KILLTILFSPFLLPV----FVIFSLIYKSENNSNSADKFINGNSFST---------NKEVFK--ISFASNFYKNNENKRFCNISNGLIKTKYYEVI--------TKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSV------CKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQK 3117
            Y  +S D  P+ +               +L+ K WQ   P L+ISV GGL+N  F+ + +L++ F + L +   T   WI   G++ GV   VG  +  +   SR  ++ C IG++  GV++N   L+  +      Y   S   +    LN  +  ++  DDG+      + +   + EK++  +        GVPV+ ++  G    + T+   L+E   +P+++ + +G  +D  + +        K+ +    L +   DE+V   K  F  FS  + +  ++ ++    RK+LI   +VF      + D D+              A   +L++ ++  ++ +  +F       ++ E    ++ +L  L  +++ F++L     + + + +T   LE LY  S   +       +++L I  ++           L+D    +++FL     +S  T K                           S  + V + L          A  + +L  WA+L     M++ FW+  ++++  A+V   +   +        +  +  + +  ++ KF +LA+ ++ ++  + +R    +LT  L   +N +CL++AV+     F+ H+  +    + WMG L+     W K++L+IL  P +L +        S I +SE       +     + +T         ++ VF   +SFA                 G    K  E I          + +  FY AP+VKF    ++Y+ FL+ F Y+ LV+L+ +  V+       E+FV +Y+    ++ V++I  +  GK     + K  + G WN+ D   IL+  + V +R        I A+ ++ L    + +R +  + ++ ++GP ++MI KM+      + I  + ++S+G    ++     +  + L  NI ++P++  FGE+   E  ++       C T + I  +   ++ F  +     ++++NLLIA F + + E +N S+K++   +      +HQK
Sbjct:    2 YARVSYDSRPDLL--------------LQLMVKEWQMELPRLLISVHGGLQN--FELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKEH--ASRSSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLH-------KNTDDTGELCDGLHDEIVGTIKKTFN-FSHGQAMHLLQTLLECMRRKELI---TVFHTGSEDHSDVDLAILTALLKGTNFSSADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQ-------MSNLRILLHRFSHLPPDYKITLIDVGL-VIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ-------EWFVILYLFMSAIERVREIFMSEPGKFGQ--KIKVWLDGYWNINDSLGILLFFVAVALRSQ--SHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDNNTDDEYPPCTTGAFITPFLQAVYLFVQY-----IIMVNLLIAFFNNIYLEAKNISDKLWKFHRYHFTMYYHQK 994          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 163.696 bits (413), Expect = 3.140e-41
Identity = 255/1093 (23.33%), Postives = 464/1093 (42.45%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNT---TWIIGSGLDVGVSKIVGETIG--AYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRA---SEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLF-EMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLIL--YKSVFDVI---ISR---NKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY----MISL------------ESKDCPYGDLLNDLIISKNKTFGFQ--------NKTSGNLLDETY--KIVQFLSENILKSSLTDKSIKNQVSLNL-AVTY-----------QDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKM-KNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI----NNNGKLETFYRFKAGISGTWNVYDFSTIL---VSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSC------IIQYRTVIFGF--------AIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPP---FNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISME 3288
            P + FG I F G             +F     +T     ++L+ + W    PNL+ISV GG KN   K  QL   F+  L +  ++      WII  G   GV K VGE++   A   GS+ + +   IG+++ G++ N E LI     +P      E   G  + L+  +  ++  D+G+      +       E+Y      +       GGE C   +  + +  N        +  L D    +    KI +  ++    +  E+N   + + Q I F++   C  L  + +I+ + L+   Y     V+    SR   NK  +       L++ +N  ++  + IF      + +   L++ +   L  N+ +F+ LF    + + E +T   LE+LY      SL            +S   P+   ++ L ++  +   F          +  G+     Y  K+ +F    +  SS    S K   SL     TY           +DLF+WA+L    E++  FW + KD     M  A++ +K+ K ++  +  +  ++ ++  +  +E+LAI ++ E  +  +   + +L R L +    +CL +A   N   F +HS  ++   + W G +S     W+++L I+F P L     I++ I                           I+F           R+   ++    T++    T  A    + A VV + I       FL  F Y+ +++ +       Y     E+ +Y ++L  I++E++Q+       G+ +   R+   I   WN  D   +L   + +IC ++  S+ +  F   R +  + + ++CLR M  + ++ ++GPK+I++K+M+ DIFFFL +  +++V+YG     +   N +    +   + Y+P+   FG+        +   TTSC        Q R  + G          ++LL  N+LLLNLLIAMF  TF  +Q+ ++ I+   + +LV E+H +P + PP   F+ +Y F+++       I KK    K   F K  ++ E+ + LA+E I  E
Sbjct:   68 PTNAFGDIQFTGLGQ-------RLGKFVRVGNDTEPSVLFKLMMEHWHLDVPNLLISVTGGAKNFHLK-PQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSK-EGKIVAIGIATWGIIHNKEHLIDAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIVLRARLEQY------ISTQHTGSGGE-CR-SSKAVGVRGNC-------AARLWDMCVRVRHCGKIVLIIMQAXSMVVREINSSVIFEKQNIYFDVLI-C--LFFLGRIISRALLTGTYACAMVVVCISASRGEANKAQESCDHQLRLALAWNRVDIATSEIFTDDR--KWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPASSLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRF--SKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKD----CMAAALMASKLLKAMVQEEDDSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIF-PLL-----IYTRI---------------------------ITF-----------RWVLYAHTCTPTRWRNFWT--APITVFWANVVSYFI-------FLWLFAYVIIMDFQ-------YTPDWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRY---IKDIWNRIDILALLLFTIGVICRLIPNSINESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDWIFRGVVYQPYLLIFGQFP-TRVDSTTFDTTSCTNNGINTSQPRCPVLGVDWLTILLTCLYLLFANILLLNLLIAMFNYTFQLVQDNTDTIWKFQRYELVNEYHSRPSLAPPLIVFSHLYLFVRRF------ILKKPQ-HKHEDFKKGFSESEEREFLAWESIMRE 1054          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 240.35 bits (612), Expect = 8.637e-65
Identity = 257/1118 (22.99%), Postives = 497/1118 (44.45%), Query Frame = 1
Query:  250 NPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISN-NCTYPR--ASEFSNGTFN--LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNI----------LGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLF-----------DLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLI---ISKNKTFGFQNKTSGNLLDE-------TY---------KIVQFLSENILKSSLTDKSIKNQVSL--NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQ-TVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIY--KSENNSNSADKFINGNSFSTNKEVFKISFASN------FYKNNENKRFCNISNGLIKTK-------------------YYEVITK-------KALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNM-TMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGI--SGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPN-GEFG----FSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCII---QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            +P + +G I FEGY      +   ++R      +T       L+ K W    PNLVISV GG K+ + K  +L   F+R L +  KT   WII  G + GV K VGE +   +       Q  +IG+++ G+V     LIS  N  YP   + E + G     L+  +  +   DDG+      +       E+ +  +          +GVPV+ ++L G    + T++  + + +P ++I  SG  +      +        D + +  +    +DE+       F      K    IK ++  + ++     D  IS++ D  ++  L            +L++ +N  ++ ++ IF      Q   E L   +L  L  ++ +F ELF    + + E ++ + L  LY       + P    +  L+   + K +         G +++E       +Y         ++  +    +LK+  + K +   ++    L   Y D+FLWA+L    E++ + W   ++ +  A++ + +  +M +        T IS+ L + ++ FEE A+ V+ E    ++  ++ +L R L+  + M+ L++AV+     F+ H++C+      WMG ++     WK+L+ +      LPV +IF +IY    E +   A +  +  S +      K     N       Y++ E K   N     + T+                     EVI +         +  FY AP  KF+  ++ Y+ F+  + Y+ L      +  K    +   E  +Y ++   +++E++Q+    K   + + K  +  S TWN  D  ++ V II +++RF      F  +R +  L    + +R++Q + ++  +GPK++MI+KM+ D+  F+ I  +F ++YG   +++  P+ G +     +  + ++   P++Q +GEL LDE Q    K    +    ++ + +   AI+++ TN+LLLNLLIA+F  TF  +Q +S+K++   +  LV+E+H +P+  PP  L+ +   F++ +W    R+ +  +  + S     L+  E  Q+  +E  + E+   Q +++
Sbjct:   90 HPTNAYGEIDFEGY---GGQKRAPYLRM---SHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLK-PRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKRNVDGQTINVIDPQYEDEVRAKVVEVFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLKANRSSPVAQLNLALAWNRIDLAKSDIFTEEQ--QWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLY------AEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCL-----YLPV-LIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQL--AAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEKPKEFGEVDPDGRWLSPLL-LAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIFIRWVW----RMCRCGHPPRGSTMKIGLSPAEMEQMDNWEFQAAEMYIHQQQQK 1179          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 123.25 bits (308), Expect = 2.460e-28
Identity = 146/548 (26.64%), Postives = 266/548 (48.54%), Query Frame = 1
Query: 1804 SKKFEELAIAVIQE---ANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDL-SPFFPMWKILLTILFSPFLLPVFVIFSLIYKSE--------NNSNSADKFINGNSFSTNKEVFKISFASNFYKNN-----ENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINN-NGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDS-----VCKTTSCIIQY--RTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKIWNTRNRIFKKSNTRKSSIFIK-YLADCEKMQILAFERISME-------ILFDQTEEQ*CFIITNK 3339
            S++F ++A+ ++ E   AN+   +  R ++  P+      + L +AV      F+ HS C+    E WMG L + +    K+LL ILF P      +IF+L ++S          + +SAD          ++E     +   +  +        K   N    +++ +   +   K +  FY AP+ KF   LI Y++FL+ F ++ L+EL P+  ++       E+ +  ++     +EV+Q+   N    +F+      S  WN+ D   +++  + V +R + P    I    ++ L   L+ +R +  + +S  +GP V+MI +M +D+ +FL I ++F+++YG    ++  P+ +  + L+  IF+RP+FQ +GEL +++   S        +T    +Y  R V    A +LL+ N+LLLNLLIA+F +TF+E+Q  S +I+   +  LV E+ Q+P + PPF LI +     K IW    R      +R++    K +L   E  +++ FE    E       + F+ T+E+    I +K
Sbjct:  592 SREFYDIALGLLDECYKANDVLAQ--RLLIYHPV-YWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVLLGILFPP------LIFALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGL--GKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVPSIE-------EWVLIGFVFSLCAEEVRQVRVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLRLN-PGTLRI-GHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELITKIFFRPYFQVYGELFIEDVDYSSNSRETAFSTPKFDEYGGRLVTVIMAFYLLVANILLLNLLIAIFNNTFSEVQANSNQIWKFQRFSLVMEYRQRPRLVPPFILIAHAHGLAKAIW---KRACGAPASRQADCKFKLFLGKEEYHKLMLFEEQCTETFLKRKALAFNATQEERVRGIVDK 1116          

HSP 2 Score: 100.523 bits (249), Expect = 2.140e-21
Identity = 94/420 (22.38%), Postives = 180/420 (42.86%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQ------NQACLIGVSSCGVVKNIEKLISNN---CTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFE------KYLQNILGVPVIRIMLGGERCELETI--HMSLMENLPLILIKNSGGLSDF--FSEIF----EQEKINIKDVEKLRTLFEM---------NDDELVKYQKIAFEIFSQC---KNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLY 1407
            P D FG + F+G         P+  ++     +T  +    L+   W    P L+ISV GG KN +  + +++R  +  L +  +T   W+I  G + GV + VGE +  +   SRG+      +Q  LIG++S G+V + E L++       Y   S   +    L+  +  ++  D+G+      +  F    E      K  Q   GVPV+ ++L G    + T+   +S    +P+++ + SG  +D   F+  F      E   + DV + R L             +D L  YQ +      +C   +  VTI  +    L + K++   ++     H  +     L++ ++  ++ +T IF      + +   L+  ++  L  ++++F++L     + +   +T + LE LY
Sbjct:   16 PTDAFGELEFQGAGQ------PSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFIL-SPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSSMQSRGACLDNNHSHFILVDNGTDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCPAVPVVIAEGSGRAADILAFAHRFIAPSNGEMSGVADVVEHRQLLHKIEKSFAECSPEDRLSIYQNVL-----KCVAKREFVTIFCVDDGGLEVDKAILRALL--KSQHSQLEDQLSLALVWDRADIAKTEIFTEDQ--KWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELY 419          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: hrc (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101158642])

HSP 1 Score: 232.646 bits (592), Expect = 5.167e-62
Identity = 259/1113 (23.27%), Postives = 482/1113 (43.31%), Query Frame = 1
Query:  193 SSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETI--GAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFN---LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL--------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFE------------------QEKINIKD--VEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISR-NKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISK---------------NKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTD-------------------KSIKNQVSLNLAVT----------YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLI-YKSENNSNSADKFINGNS---FSTNKEVFKISFASNFYKNNE--NKRFCNISNGLIKTK--------YYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSL-----QNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-----DSVCK---------TTSCIIQYR--TVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKI 3168
            S+   N  DS   S +L   P D +G + F G    +S +H  F+R       T     Y L+   W  PSPNLV+SV+GG      KN  +    ++ L +  +    WII  G   GV K VGE +   A    S   N+   +G++S G+V N E+LI+   +YP   +  N   +   L+  Y  +L  DDGS      +  F    E ++        ++ + VPV+ +++ G+   L+ + +SL ++LP +++  SGGL++F S++ E                     +++K+   ++++  F  N+ E  K  ++   I+ Q K+L+T+    ++     D +L K++      R + D     +   L++ +N  ++  + +F        K + LK ++   L  ++ +F+ LF      I   +T + LE LY      +  P G LL  L+  +               ++          N      K+  F    +L   L D                   +++K    L +  +          +  LF+WA+L    EM+  FW    ++V  A+ G  +  +M  L   + +T     L E ++ FE LA  +        +     +L +        +CLQ+ + G+   F +H   +S   + W GD+     +WK+LLT     F  P+    SLI ++ +   +  ++     +     +N +     ++    K NE   +     S  +I  K           ++++     F+ APV  F+  ++ Y +FL+ F Y+ LV+ KP      +     E+ +Y ++   + +E+++    G      R ++ I   WN  D   I + I+ ++ R    +  + F R +  + + ++ LR +  + I   +GPK+I++ KM+ D+FFFL    +++++YG    +L      NP+  F       +FYRP+   FG++ ++E       D  C          +  C +++    V+    I+LL+TN++L+NLLIA+F  TF+E+Q  S+  +   +  L+  +H +P + PPF +I +   F+K++
Sbjct:   65 SAAIVNYWDSVRHSSEL---PTDAYGELQFAG----ASKRHSYFLRL---SWGTNPSTIYNLMTVQWSLPSPNLVVSVVGGESQASVKN-WVREVIRKGLVKSSQRAGAWIITEGFREGVGKCVGEAVRDHATAASSGSFNKVVAVGIASWGLVYNKEQLINPEGSYPAKYDIRNSPKDSCCLDNNYQAFLLVDDGSVGRKGGEISFRAKLEDHISHQPTGIQESGINVPVLCMLISGDTSMLKRVEISLKKSLPWLVLAGSGGLAEFLSDVVENLSSSPVVQTPSEADGDLSPIVDLKERVADRVKKYFP-NEKETDKVVELTLSIY-QNKDLITVYNGTQERLNDFDKVLLKALVRASKQRVSVDDSPYIEELRLAVTWNRVDIARSELFNGDIL--WKDKDLKDSMTNALINDKPQFVRLFTENGFNIRSYLTYKKLEKLY------QSVPSGTLLYQLLERRLLIRHGITALSPAHDSQPDSPNQPKESNQCQPVMKVTLFEVSGVLDMLLDDVCQPFYYDVLELGHFSSRRRALKQAAKLLVGESKYREERCVYPWASLFIWAILQRRNEMATFFWEMAGESVLCALSGCKMLREMSKL---ETETEGKLSLKEMAQSFENLAHDIFSSCYHSDENRAFTLLIKKSPVWGGTTCLQMGMGGDTRLFFSHDGVQSLLSQIWWGDMKRNTEVWKLLLT-----FFCPILCYTSLISFRGQEEQDKPEEEEGKPNEELLDSNYDYGTTVYSYPDLKQNEADGQGPTTPSTPMINDKDPPFRPPRRPFIVSR--WRQFWFAPVTSFLGNVLMYFLFLVLFAYVLLVDFKPQPP---WGPAVSEYVLYFWVFTIVCEEIRETAFLGTRNWRQRLRSYIQDVWNKIDIVAITLFIVGLICRMY--ERSYEFGREVLCVDYMVFTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLGVWLIAYGVANQALIYSYDSNPDRIF-----RRVFYRPYLHIFGQIPVEEIDSGKNWDLECTNNMTMIDSGSEPCRVEHSNWVVVVLLIIYLLVTNIVLINLLIAIFSHTFSEVQANSDIYWKFQRYNLIVTYHFRPSLAPPFIIISHINLFIKRV 1136          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 196.823 bits (499), Expect = 1.323e-50
Identity = 244/1087 (22.45%), Postives = 475/1087 (43.70%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPR---ASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL--------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEI--FEQEKINIKDVEKLRTLF------EMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDH---DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----------------YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIF--SLIYKSENNSNSA---DKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAG--ISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFG----ELMLDEFQDSVCKTTS-------CII----------QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERI 3279
            P + FG I F+G    ++       ++    + T  +  Y+L+ + W    PNL+ISV GG KN   K   L   F R L ++ +T   WII  G + GV K VG+ +  Y   +  Q Q   IGV++ GV+ N E LI+    +P      + S G  + L++ +  +L  DDG+      + E     EK +         + + +PV+ ++L G    L TI  ++    P ++ + +G ++D  +++     ++I I  + +L   F      +  +  ++++ K   +I  +  +L+TI ++        D+ + K++     SR+ +    D      +L++ +N  ++ +T IF   +        L + +   L  N+ +F+ L     + + + +  +N ETL  +  E   C +   L   + SK       N T  ++ DE   ++   + +I    +  +   +   L+L+++                   D+FLWA+L  + +++ I W +C+D++  A+    I   +K L   +     + +++  +  +EE AI V  E     +     +L          + L +A+      F+  S  +++    W G+LS    + ++L+ +LF P +   F+ F    +++ E     A    K + GN+                            S G    K      +  L + Y +P VKF   ++SY  FL  F  + +++      V        E  +Y+++   + +E +Q+  N++G     ++ KA   I+  WN+ D  +IL+ ++ +  R +   E F   + +  + F ++CLR M  + IS ++GPK+I++++M+ D+FFF+ +  +++V+YG     +   N      +     Y P+   FG     L   +F    C           C I          ++ T+     ++LL  N+LLLNLLIA+F  TF E+Q+ +++I+   + +L++E+H +P  PPPF +  +    ++ IW  ++    KS   K           E M++L++E +
Sbjct:   89 PTNAFGEIQFDGLQQTTA-------KYARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLK-PHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIV-RMSHLLTIFRVTEDSHGDVDVAILKALLKA--SRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSL--WSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFL--QNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRI---LKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQ------------------------SLGSAPDKPLSCWDR--LVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVP-------ELLLYVWVFSLVCEEFRQLFCNSDG---FGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT--SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITM-LCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIWLCKSHC--KSKDLKDQT--------EAMELLSWEAL 1108          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 196.052 bits (497), Expect = 2.232e-50
Identity = 245/1087 (22.54%), Postives = 475/1087 (43.70%), Query Frame = 1
Query:  253 PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPR---ASEFSNGTFN-LNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYL--------QNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEI--FEQEKINIKDVEKLRTLF------EMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRK-----DLILYKSVFDVIISRNKDH---DMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVT-----------------YQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIF--SLIYKSENNSNSA---DKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQI--NNNGKLETFYRFKAG--ISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFG----ELMLDEFQDSVCKTTS-------CII----------QYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYY---FLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERI 3279
            P + FG I F+G    ++       ++    + T  +  Y+L+ + W    PNL+ISV GG KN   K   L   F R L ++ +T   WII  G + GV K VG+ +  Y   +  Q Q   IGV++ GV+ N E LI+    +P      + S G  + L++ +  +L  DDG+      + E     EK +         + + +PV+ ++L G    L TI  ++    P ++ + +G ++D  +++     ++I I  + +L   F      +  +  ++++ K   +I  +  +L+TI ++        D+ + K++     SR+ +    D      +L++ +N  ++ +T IF     S      L + +   L  N+ +F+ L     + + + +  +N ETL  +  E   C +   L   + SK       N T  ++ DE   ++   + +I    +  +   +   L+L+++                   D+FLWA+L  + +++ I W +C+D++  A+    I   +K L   +     + +++  +  +EE AI V  E     +     +L          + L +A+      F+  S  +++    W G+LS    + ++L+ +LF P +   F+ F    +++ E     A    K + GN+                            S G    K      +  L + Y +P VKF   ++SY  FL  F  + +++      V        E  +Y+++   + +E +Q+  N++G     ++ KA   I+  WN+ D  +IL+ ++ +  R +   E F   + +  + F ++CLR M  + IS ++GPK+I++++M+ D+FFF+ +  +++V+YG     +   N      +     Y P+   FG     L   +F    C           C I          ++ T+     ++LL  N+LLLNLLIA+F  TF E+Q+ +++I+   + +L++E+H +P  PPPF +  +    ++ IW  ++    KS   K           E M++L++E +
Sbjct:   89 PTNAFGEIQFDGLQQTTA-------KYARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLK-PHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRDYSLSNSIQGQIVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIAQVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVIEWTKKIQDIV-RMSHLLTIFRVTEDSHGDVDVAILKALLKA--SRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTED--SLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFL--QNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRI---LKKLAGGESDAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQ------------------------SLGSAPDKPLSCWDR--LVSLYGSPQVKFYWNIVSYFFFLNLFAGVLMMDFHATPSVP-------ELLLYVWVFSLVCEEFRQLFCNSDG---FGFKIKAKLYITDLWNILDVLSILLFLLGLAFRLT--SELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILIHNDTRLDWIFRGAIYEPYLIIFGNFPENLAEAKFSLDSCSMNGTDPLKPKCPILNENHAPVFPEWLTITM-LCVYLLFANILLLNLLIAIFNFTFQEVQDNTDRIWKFQRYELIKEYHSRPAAPPPFIIFSHLSLLIRSIWLCKSHC--KSKDLKDQT--------EAMELLSWEAL 1108          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 166.392 bits (420), Expect = 2.926e-41
Identity = 200/992 (20.16%), Postives = 427/992 (43.04%), Query Frame = 1
Query:  328 RFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQN-QACLIGVSSCGVVKNIEKLISNNCTYP---RASEFSNGT-FNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQ---------NILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEM-----NDDELVKYQKIAFEIFSQCKNLVTI----KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLN-----DLIISKNKTFGF-------QNKTSGNLLDETYKIVQFLSEN---ILKSSLTDKSIKN---QVSLNLAV-------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ-INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
            +F   ++NT   + Y+++ + W    P+LV++V+GG +    K   L    ++ L +  ++   WI+ +GL  G++K +G+ +  +   S     +   IG++   ++ N E L+S     P      +  +G+ ++L+  +  ++  ++          E  V   K++              +PV+ +++ GE    + + +S+  + P +++  SGG++D    +  +   +   V +L  L +      +  ++  + K+  +I     +L+T+    ++    D ++ K++     S++++         L++ +N  ++ ++ IF      + K   L++ ++  L  ++  F+ LF    + + E +T   L+ LY  S+  K   +  LL       L++   +T G        Q K    L +    +  FL ++     +   T+K  K    Q   NL          ++DLFLWA+L    +M+  FW    + V  A+ G  I  +M  L   + +   +  + E+  K+E+ A+ V  E    S+     +L R     +  + L +A   +   F  H   ++   + W G ++    + K++++    P +    + FS   +  +N +S  +F+  +S  T K +  +                 + + LI    +     +    F+ APV  F+  +I Y  FL  F Y+ L++ K   Q         E  +Y ++   +++E++Q    + ++    +FK  +   WN  D   IL+ ++ V  R +     +   R +  + F ++ LR +  + I   +GPK+I++++M+ D+FFFL    +++++YG    +L +PN      +     YRP+   FG++ L+E  D +     C   Y   +            +LL++  A  GS    +Q  ++  +   +  L+ E++ +P + PPF +I + 
Sbjct:   58 KFVKVRSNTEPVQIYQMLTQEWGLSPPHLVVAVVGGDELAQMK-PWLRDTLRKGLVKAAQSTGAWILTNGLRFGITKHLGQAVRDHSLASTSSTVRVVAIGIAPWNMIHNREALLSAKVDEPVVYTPQDLPHGSVYSLDNNHSHFVLVEEDPARPGATS-EMRVKLLKHISLQRTGYGGAGSFEIPVLCLLVHGEP---KILKVSIANSTPWLILAGSGGVADILVTLMNRGCWDTDSVHEL--LLDTFPNAHHSADISNWVKLIQKILDH-GHLLTVHDPEQETSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSDIFNGD--VEWKACDLEEVMMDALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYW-SVSEKSLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRLFQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEMARL---ESEAESARSMKEA--KYEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIWWGAMTTDTAISKLVVSFFCPPLIWTNLIKFS--DEELDNRSSNKQFVELDSLDTEKALIFL-----------------LRSILICASVWWRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQ----GPGVPEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKLYVEDNWNKCDMVAILLFVVGVSCRMAAGT--YEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEI-DVMGLLPPCPNIYANWLV-----------ILLSVRAADLGSRTKVVQGNTDIFWKFQRYNLIVEYYSRPALAPPFIIISHL 996          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 143.665 bits (361), Expect = 2.949e-34
Identity = 211/1010 (20.89%), Postives = 429/1010 (42.48%), Query Frame = 1
Query:  328 RFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQN-QACLIGVSSCGVVKNIEKLISNN---CTYPRASEFSNGTFNLNEFYDCYLFCDD-----GSTNLCQND--KEFLVDFEKYLQNILGVPVIRIMLGGERCEL---ETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEM-----NDDELVKYQKIAFEIFSQCKNLVTI----KQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLN-----DLIISKNKTFGF-------QNKTSGNLLDETYKIVQFLSEN---ILKSSLTDKSIKN---QVSLNLAV-------TYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSAC-RSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQ-INNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGF-----------------AIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYF 3156
            +F   ++NT   + Y+++ + W    P+LV++V+GG  ++L +     R+  R        +T WI+ +GL  G++K +G+ +  +   S     +   IG++   ++ N E L+S       Y          ++L+  +  ++  ++     G+T+  +    K   +    Y      +PV+ +++ GE   L   + ++  +  + P +++  SGG++D    +  +   +   V +L  L +      +  ++  + K+  +I     +L+T+    ++    D ++ K++        +  D + +L  L++ +N  ++ ++ IF      + K   L++ ++  L  ++  F+ LF    + + E +T   L+ LY  S+  K   +  LL       L++   +T G        Q K    L +    +  FL ++     +   T+K  K    Q   NL          ++DLFLWA+L    +M+  FW    + V  A+ G  I  +M  L   + +   +  + E+  K+E+ A+ V  E    S+     +L R     +  + L +A   +   F  H    ++   + W G ++    + K++++    P +    + F              +F+  +S  T K +                        ++          +    F+ APV  F+  +I Y  FL  F Y+ L++ K   Q         E  +Y ++   +++E++Q    + ++    +FK  +   WN  D   IL+ ++ V    +   E     R +  + F ++ LR +  + I   +GPK+I++++M+ D+FFFL    +++++YG    +L +PN      +     YRP+   FG++ L+E  D+     +C      ++ G                   IFLL+TNVLLLNLLIAMF  TF  +Q  ++  +   +  L+ E++ +P + PPF +I + 
Sbjct:   51 KFVKVRSNTEPVQIYQMLTQEWGLSPPHLVVAVVGG--DELAQMKPWLRDTLRKGLVKAAQSTAWILTNGLRFGITKHLGQAVRDHSLASTSSTVRVVAIGIAPWNMIHNREALLSAKDEPVVYTPQDLPHGSVYSLDNNHSHFVLVEEDPARPGATSEMRVKLLKHISLQRTGYGAGSFEIPVLCLLVHGEPKILKFLQRMYKGIANSTPWLILAGSGGVADILVTLMNRGCWDTDSVHEL--LLDTFPNAHHSADISNWVKLIQKILDH-GHLLTVHDPEQETSELDTVILKALVKCKSQSQEAQDFLDEL-KLAVAWNRVDIAKSDIFNGD--VEWKACDLEEVMMDALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYW-SVSEKSLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRLFQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEMARL---ESEAESARSMKEA--KYEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQQALLTKIWWGAMTTDTAISKLVVSFFCPPLIWTNLIKF--------------QFVELDSLDTEKAL------------------------MLTDDDDPRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQ----GPGVPEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKLYVEDNWNKCDMVAILLFVVGVSCMAAGTYE---AGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEI-DARMPKINCTDDSNEIVMGLLPPCPNIYANWLVILLLVIFLLVTNVLLLNLLIAMF-YTFQVVQGNTDIFWKFQRYNLIVEYYSRPALAPPFIIISHL 999          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 2015.74 bits (5221), Expect = 0.000e+0
Identity = 1039/1071 (97.01%), Postives = 1045/1071 (97.57%), Query Frame = 1
Query:  103 MSIEKIRSLIRKLVYFITTGVFCFFFSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            MSIEKIRSLIR               +FQISSNETNQTDSFTSSPKLEFNPCDMFG+ITFEG DNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKT+TTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQ+IAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELIT ENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVS NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSY KEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNS DKFINGNSFSTNKEVFKISFAS   KNNENKRF NISNGLIKTKYYEVITKK+LEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFI ARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPN EFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFER+SMEILFDQTEEQ
Sbjct:    1 MSIEKIRSLIR---------------NFQISSNETNQTDSFTSSPKLEFNPCDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTSTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSHNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFAS---KNNENKRFSNISNGLIKTKYYEVITKKSLEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPNCEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERMSMEILFDQTEEQ 1053          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 2011.11 bits (5209), Expect = 0.000e+0
Identity = 1039/1071 (97.01%), Postives = 1044/1071 (97.48%), Query Frame = 1
Query:  103 MSIEKIRSLIRKLVYFITTGVFCFFFSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            MSIEKIRSLIR               +FQISSNETNQTDSFTSSPKLEFNPCDMFG+ITFEG DNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKT TTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQ+IAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELIT ENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVS NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSY KEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNS DKFINGNSFSTNKEVFKISFAS   KNNENKRF NISNGLIKTKYYEVITKK+LEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFI ARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPN EFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFER+SMEILFDQTEEQ
Sbjct:    1 MSIEKIRSLIR---------------NFQISSNETNQTDSFTSSPKLEFNPCDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKT-TTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSHNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFAS---KNNENKRFSNISNGLIKTKYYEVITKKSLEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPNCEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERMSMEILFDQTEEQ 1052          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 2009.19 bits (5204), Expect = 0.000e+0
Identity = 1030/1047 (98.38%), Postives = 1035/1047 (98.85%), Query Frame = 1
Query:  175 FFSFQISSNETNQTDSFTSSPKLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISMEILFDQTEEQ 3315
            F SFQISSNETNQTDSFTSSPKLEFNPCDMFG+ITFEG DNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKT+TTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQ+IAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELIT ENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVS NLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSY KEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNS DKFINGNSFSTNKEVFKISFAS   KNNENKRF NISNGLIKTKYYEVITKK+LEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFI ARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPN EFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFER+SMEILFDQTEEQ
Sbjct:   19 FDSFQISSNETNQTDSFTSSPKLEFNPCDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTSTTWIIGSGLDVGVSKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSHNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFAS---KNNENKRFSNISNGLIKTKYYEVITKKSLEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQNPNCEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQYRTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERMSMEILFDQTEEQ 1062          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 469/1037 (45.23%), Postives = 676/1037 (65.19%), Query Frame = 1
Query:  217 DSFTSSP-KLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHK---EAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYR-QGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQN--KTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFAS-----NFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-DSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISME 3288
            D+ +S+P K   + C  FG I F GY+++S + +P F+RF+    N   +    AYELI K W +P P L+IS+ GG K   FKN+Q ++NFK+ L E+M+ +TTWIIG G  VG+ K+V E +  +R      +NQ  LI +S+ GVVKN   L    C Y  ++    G   L+  YDCYLFCDDG+      + +F +DFE+ +++I G   ++I+  G +  +E+I+ SL +++PL++IK SG  +D   EI E +K+N++ V+K      + DD+ ++  +I  +I+S  K  +TI  ++ +++ L K + D IIS  +D ++  K  +L++RFNC ++ + ++FQS   S L  + L      +LS+NQ + L+LF + N  I E + +ENL+ LYM SL S  C   ++++DLI+ ++K+F   N      NLL   YKI+  LS+NILK    +    N  + N   +Y++LFLW+L++G+TEM+LIFW   K+NVG A++G+II +KMK+ I  KG   +S+ L+++S KF+ELA  +I +A + +Q  T  +LTRPL   NN++CLQIA+ GNLL FLN +ACRSY +E WMGDLSPF P WKIL+TI FSP L+  F+I  +  K   ++ S +K  +   F   K    I   S     +++  ++   FC                 +AL  FY+AP+VKF+IYL+SY+ FL+ F YLNLVELKPI++VK  QN+T E  VYI+ILGFIV+E+ QINN  K    Y+ K+ +SG+WN+YD  TI + II +++RF+V  + FIF RC + +T  L+ LRTMQFYFIS SIGPKVIMI+KMIVD+FFFL IF LFI+SYGTL +S+QNPN ++   L++ +FYRP+FQT+GELMLD+F+  S C TT CI+Q  T+I GF IFLL+TN+LLLNLLIAMFG TFN+IQ ESEK FS IQIQLV+EFH KP++PPP N+ YY L+K+W +   IF   + RK++  IKYL D + ++I  FE + ME
Sbjct:    4 DNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-GAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNL-EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNAN-QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFC-----------------RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCME 1019          
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 469/1037 (45.23%), Postives = 676/1037 (65.19%), Query Frame = 1
Query:  217 DSFTSSP-KLEFNPCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHK---EAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGVSKIVGETIGAYR-QGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDVEKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQN--KTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQVSLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFAS-----NFYKNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGLTFCLYCLRTMQFYFISPSIGPXXXXXXXXXXDXXXXXXXXXXXXVSYGTLFNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQ-DSVCKTTSCIIQYRTVIFGFAIFXXXXXXXXXXXXIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEKMQILAFERISME 3288
            D+ +S+P K   + C  FG I F GY+++S + +P F+RF+    N   +    AYELI K W +P P L+IS+ GG K   FKN+Q ++NFK+ L E+M+ +TTWIIG G  VG+ K+V E +  +R      +NQ  LI +S+ GVVKN   L    C Y  ++    G   L+  YDCYLFCDDG+      + +F +DFE+ +++I G   ++I+  G +  +E+I+ SL +++PL++IK SG  +D   EI E +K+N++ V+K      + DD+ ++  +I  +I+S  K  +TI  ++ +++ L K + D IIS  +D ++  K  +L++RFNC ++ + ++FQS   S L  + L      +LS+NQ + L+LF + N  I E + +ENL+ LYM SL S  C   ++++DLI+ ++K+F   N      NLL   YKI+  LS+NILK    +    N  + N   +Y++LFLW+L++G+TEM+LIFW   K+NVG A++G+II +KMK+ I  KG   +S+ L+++S KF+ELA  +I +A + +Q  T  +LTRPL   NN++CLQIA+ GNLL FLN +ACRSY +E WMGDLSPF P WKIL+TI FSP L+  F+I  +  K   ++ S +K  +   F   K    I   S     +++  ++   FC                 +AL  FY+AP+VKF+IYL+SY+ FL+ F YLNLVELKPI++VK  QN+T E  VYI+ILGFIV+E+ QINN  K    Y+ K+ +SG+WN+YD  TI + II +++RF+V  + FIF RC + +T  L+ LRTMQFYFIS SIGPKVIMI+KMIVD+FFFL IF LFI+SYGTL +S+QNPN ++   L++ +FYRP+FQT+GELMLD+F+  S C TT CI+Q  T+I GF IFLL+TN+LLLNLLIAMFG TFN+IQ ESEK FS IQIQLV+EFH KP++PPP N+ YY L+K+W +   IF   + RK++  IKYL D + ++I  FE + ME
Sbjct:   19 DNNSSAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRDI-GAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILETDKMNVEIVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNL-EKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFESFNLRSSNSHNAN-QNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSCSNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQVSFC-----------------RALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSKWNLFLISELFYRPYFQTYGELMLDDFKIPSPCNTTVCIVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGFEHLCME 1034          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM33.525e-6024.07transient receptor potential cation channel subfam... [more]
TRPM68.328e-6022.13transient receptor potential cation channel subfam... [more]
TRPM68.778e-6022.13transient receptor potential cation channel subfam... [more]
TRPM69.434e-6022.13transient receptor potential cation channel subfam... [more]
TRPM38.638e-5924.07transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-22.958e-4922.91Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gtl-16.698e-2423.93GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gon-26.536e-1726.53Transient receptor potential channel [Source:UniP... [more]
gon-27.269e-1726.53Transient receptor potential channel [Source:UniP... [more]
gon-27.507e-1726.53Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm2.640e-4822.29gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm6.898e-4722.99gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm4.451e-4622.75gene:FBgn0265194 transcript:FBtr0339076[more]
Trpm5.412e-4622.75gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm5.725e-4622.75gene:FBgn0265194 transcript:FBtr0339079[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.081e-6223.37transient receptor potential cation channel, subfa... [more]
trpm4a2.377e-6224.29transient receptor potential cation channel, subfa... [more]
hrc4.456e-5724.08histidine rich calcium binding protein [Source:ZFI... [more]
trpm4b.28.056e-5523.34transient receptor potential cation channel, subfa... [more]
trpm51.571e-5422.40transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shc21.431e-6723.40SHC (Src homology 2 domain containing) transformin... [more]
shc22.823e-6724.02SHC (Src homology 2 domain containing) transformin... [more]
shc23.498e-6623.66SHC (Src homology 2 domain containing) transformin... [more]
TRPM11.072e-6224.84transient receptor potential cation channel subfam... [more]
TRPM14.146e-6125.33transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm41.299e-6623.45transient receptor potential cation channel, subfa... [more]
Trpm32.059e-5924.04transient receptor potential cation channel, subfa... [more]
Trpm33.526e-5923.63transient receptor potential cation channel, subfa... [more]
Trpm33.875e-5924.12transient receptor potential cation channel, subfa... [more]
Trpm36.721e-5923.92transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7TN37|TRPM4_MOUSE9.087e-6623.45Transient receptor potential cation channel subfam... [more]
sp|Q9ESQ5|TRPM4_RAT2.315e-6423.56Transient receptor potential cation channel subfam... [more]
sp|A7T1N0|TMP2L_NEMVE2.107e-6322.99Transient receptor potential cation channel subfam... [more]
sp|A0A0R4IMY7|TRPM2_DANRE8.162e-6223.37Transient receptor potential cation channel subfam... [more]
sp|Q9BX84|TRPM6_HUMAN4.531e-5922.13Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5R11.783e-8725.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G8484.113e-8725.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A210PMT15.632e-7625.76Transient receptor potential cation channel subfam... [more]
A0A267EVM81.452e-7226.10Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4W3H5R41.693e-7226.05Uncharacterized protein OS=Callorhinchus milii OX=... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrc5.313e-6522.71transient receptor potential cation channel subfam... [more]
trpm4a4.219e-5923.11transient receptor potential cation channel subfam... [more]
trpm4a7.586e-5923.39transient receptor potential cation channel subfam... [more]
trpm35.306e-5124.05transient receptor potential cation channel, subfa... [more]
trpm51.385e-4620.98transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm72.665e-4421.44transient receptor potential cation channel, subfa... [more]
trpm71.065e-4321.22transient receptor potential cation channel, subfa... [more]
trpm23.140e-4123.33transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301358.637e-6522.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476582.460e-2826.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrc5.167e-6223.27transient receptor potential cation channel subfam... [more]
trpm21.323e-5022.45transient receptor potential cation channel subfam... [more]
trpm22.232e-5022.54transient receptor potential cation channel subfam... [more]
trpm52.926e-4120.16transient receptor potential cation channel subfam... [more]
trpm52.949e-3420.89transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004911.10.000e+097.01SMESG000004911.1[more]
SMESG000004911.10.000e+097.01SMESG000004911.1[more]
SMESG000004911.10.000e+098.38SMESG000004911.1[more]
SMESG000004955.10.000e+045.23SMESG000004955.1[more]
SMESG000004955.10.000e+045.23SMESG000004955.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002434 ID=SMED30002434|Name=Transient receptor potential cation channel subfamily M member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3361bp
ATTAATTAAAAAAAACAATTTTGTTTTACTATTACAAATTATTTTTATGA
AATTTTGATTATATAATAATTATGGAGAAATTTATTAAATCAAAGTTTAC
AAATGTCCATCGAAAAAATCCGAAGTTTGATTCGTAAGTTGGTTTATTTT
ATTACAACTGGAGTCTTTTGTTTTTTTTTCAGTTTTCAGATTTCGTCAAA
CGAAACTAATCAAACAGATTCTTTTACTTCTTCTCCCAAATTGGAATTCA
ACCCCTGTGATATGTTTGGCTCAATTACATTTGAAGGATATGACAACCTT
TCATCAGATCAACATCCCAATTTTATGCGCTTCTATTCTCCGAAAACAAA
TACTCCACACAAAGAAGCGTATGAATTAATTAACAAATTATGGCAATACC
CATCTCCAAATTTGGTGATTTCAGTACTTGGAGGTCTGAAAAATCAACTT
TTCAAAAATAGTCAACTTGAAAGAAACTTCAAAAGAAATTTATGTGAGAT
AATGAAAACAAATACAACTTGGATTATTGGATCTGGGCTAGATGTCGGTG
TAAGTAAGATAGTTGGCGAAACTATCGGTGCATATAGGCAAGGATCTCGA
GGTCAAAACCAAGCTTGCCTTATCGGGGTGAGTTCTTGCGGAGTTGTGAA
AAATATTGAAAAGTTAATTTCAAACAATTGCACGTATCCTAGAGCTTCTG
AGTTCTCTAATGGGACATTTAATTTAAACGAATTTTATGATTGTTATTTG
TTCTGCGATGACGGATCTACAAACTTATGCCAAAATGATAAGGAATTTCT
GGTAGACTTTGAAAAATATTTGCAAAATATATTAGGAGTTCCAGTAATAC
GGATAATGCTTGGTGGAGAAAGGTGCGAGCTGGAAACTATTCACATGTCA
TTAATGGAAAATTTACCATTAATTTTAATTAAAAACTCTGGTGGATTGTC
TGATTTTTTCAGTGAAATATTTGAACAAGAAAAGATAAACATTAAAGATG
TTGAAAAATTAAGAACTCTCTTTGAAATGAATGATGACGAACTTGTGAAG
TATCAAAAAATTGCTTTTGAAATATTTTCTCAATGCAAAAACTTGGTAAC
AATAAAACAAATTGTTAGGAAAGATTTAATATTATATAAATCAGTTTTTG
ATGTTATTATTTCCCGAAACAAAGATCATGATATGATAGCAAAACTGTTT
GACTTAAGCATCCGATTTAACTGTCCAAATGTGGTGGAAACTCGAATTTT
TCAATCGCCAAATTTTTCGCAATTAAAGCCAGAACATTTGAAAAAAAACT
TATTGGGAATTTTAAGCAGAAATCAAATTAAATTTTTGGAATTATTTTTT
ATGTTTAATATTGAAATTACAGAACTAATTACTAAGGAAAACCTTGAAAC
ATTATATATGATATCTTTGGAATCTAAAGATTGTCCCTATGGAGATTTAC
TAAATGATCTAATAATCAGCAAAAATAAAACATTTGGGTTTCAAAATAAA
ACGTCCGGAAATTTGCTTGATGAAACCTACAAAATTGTTCAATTTTTATC
AGAAAATATTCTAAAATCAAGTCTCACAGATAAGAGCATAAAGAATCAGG
TTTCCCTTAATCTGGCCGTTACGTATCAAGATCTTTTTCTATGGGCCTTA
CTTACAGGTCACACCGAAATGTCACTAATATTTTGGAGAAAATGCAAAGA
CAATGTTGGCTTGGCTATGGTTGGAGCAATAATAAAAAATAAAATGAAAA
ATTTGATTTTATACAAGGGTCAAACTGTTATTTCAAATCAACTTGTCGAG
AGTTCAAAAAAATTTGAAGAATTGGCTATTGCTGTTATTCAAGAAGCTAA
CGAAAGAAGCCAAAGAAATACTCGTTGCATTCTCACAAGGCCATTAGAAA
CATTGAATAATATGTCATGTTTGCAAATTGCAGTCACTGGAAATCTTTTG
CATTTTTTAAATCACAGCGCTTGTCGGTCTTACGCAAAGGAACATTGGAT
GGGAGATTTATCACCTTTTTTCCCAATGTGGAAAATATTACTTACAATTC
TGTTTAGTCCATTTTTATTACCAGTTTTTGTAATTTTTTCACTTATATAC
AAAAGCGAAAATAATTCAAACTCTGCTGATAAATTTATAAATGGCAATTC
ATTTTCAACCAATAAGGAAGTGTTTAAAATTTCATTTGCTTCCAATTTTT
ATAAAAACAATGAAAATAAAAGATTCTGTAATATTAGCAATGGATTGATT
AAAACAAAATATTATGAAGTCATTACGAAAAAGGCACTTGAAGCCTTTTA
TAAAGCGCCGGTTGTGAAATTTATTATTTATTTAATTTCCTATGTTGTGT
TTTTATTAGCATTTATTTATTTGAATTTGGTAGAATTGAAACCAATTGAA
CAGGTAAAACGTTATCAGAACATGACCATGGAATTCTTCGTTTACATTTA
TATTTTGGGGTTTATAGTCAAAGAAGTTAAACAGATAAATAACAACGGAA
AATTAGAGACATTTTACAGGTTCAAAGCCGGTATATCTGGAACTTGGAAT
GTTTATGATTTTTCGACGATATTAGTATCAATTATATGTGTTGTTGTGAG
GTTTTCGGTGCCACAGGAATTTTTTATTTTTGCCCGTTGTTTGTTCGGCT
TAACATTTTGCTTATATTGTCTAAGAACAATGCAATTTTATTTTATCAGT
CCTTCTATTGGCCCGAAAGTTATAATGATTAAAAAAATGATTGTTGACAT
ATTTTTCTTTCTGTGTATATTTTTATTATTTATCGTTTCCTATGGAACTC
TATTCAATTCTTTACAAAATCCAAATGGTGAATTCGGGTTTTCACTAGTG
GCAAATATTTTTTATCGCCCGTTTTTTCAAACTTTTGGAGAACTTATGTT
GGATGAGTTCCAAGATTCTGTATGCAAAACTACAAGTTGTATTATTCAGT
ACAGAACTGTTATTTTTGGATTTGCAATTTTTCTGTTACTGACAAATGTT
CTTTTGTTGAATTTATTAATAGCTATGTTTGGTAGCACTTTCAATGAAAT
TCAAAATGAATCCGAAAAAATATTTTCATCAATCCAAATTCAGTTAGTTG
AAGAATTCCACCAAAAACCGATGGTTCCACCGCCTTTTAATTTAATTTAT
TATTTTTTAAAAAAGATATGGAATACCAGAAATAGGATTTTCAAAAAGAG
CAATACCCGAAAAAGCTCGATTTTTATTAAATATTTAGCCGATTGTGAAA
AAATGCAAATATTAGCATTCGAGAGAATATCTATGGAAATTTTGTTTGAT
CAAACAGAAGAGCAATAATGTTTTATAATTACTAATAAATTTTATTAATT
TTGAAAAAAAA
back to top

protein sequence of SMED30002434-orf-1

>SMED30002434-orf-1 ID=SMED30002434-orf-1|Name=SMED30002434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1072bp
MSIEKIRSLIRKLVYFITTGVFCFFFSFQISSNETNQTDSFTSSPKLEFN
PCDMFGSITFEGYDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYP
SPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTNTTWIIGSGLDVGV
SKIVGETIGAYRQGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASE
FSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIR
IMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFEQEKINIKDV
EKLRTLFEMNDDELVKYQKIAFEIFSQCKNLVTIKQIVRKDLILYKSVFD
VIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNL
LGILSRNQIKFLELFFMFNIEITELITKENLETLYMISLESKDCPYGDLL
NDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQV
SLNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKN
LILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLET
LNNMSCLQIAVTGNLLHFLNHSACRSYAKEHWMGDLSPFFPMWKILLTIL
FSPFLLPVFVIFSLIYKSENNSNSADKFINGNSFSTNKEVFKISFASNFY
KNNENKRFCNISNGLIKTKYYEVITKKALEAFYKAPVVKFIIYLISYVVF
LLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGK
LETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFIFARCLFGL
TFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTL
FNSLQNPNGEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQY
RTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVE
EFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCEK
MQILAFERISMEILFDQTEEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0016787hydrolase activity
GO:0005216ion channel activity
GO:0005227calcium activated cation channel activity
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0002724regulation of T cell cytokine production
GO:0006812cation transport
GO:0034220ion transmembrane transport
GO:0042310vasoconstriction
GO:0042391regulation of membrane potential
GO:0061337cardiac conduction
GO:0098655cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
IPR005821Ion_trans_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 693..931
e-value: 1.6E-9
score: 37.3
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 30..240
e-value: 8.1E-35
score: 120.5
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 2..1014
NoneNo IPR availableTMHMMTMhelixcoord: 823..845
NoneNo IPR availableTMHMMTMhelixcoord: 590..612
NoneNo IPR availableTMHMMTMhelixcoord: 753..775
NoneNo IPR availableTMHMMTMhelixcoord: 716..733
NoneNo IPR availableTMHMMTMhelixcoord: 679..701
NoneNo IPR availableTMHMMTMhelixcoord: 897..919
NoneNo IPR availableTMHMMTMhelixcoord: 855..877
NoneNo IPR availableTMHMMTMhelixcoord: 785..802