Dynamin-type G domain-containing protein

Overview
NameDynamin-type G domain-containing protein
Smed IDSMED30002421
Length (bp)1998
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-type G domain-containing protein (SMED30002421) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30002421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-type G domain-containing protein (SMED30002421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30002421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig4309uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig4309newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig36709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig36709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig5201uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000014746.1 Contig5201newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000077893.1 Contig4309uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000077893.1 Contig4309newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000052829.1 Contig5201uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30002421SMESG000052829.1 Contig5201newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
secretory systemSMED30002421SMESG000014746.1 dd_Smed_v6_3255_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30002421SMESG000014746.1 dd_Smed_v4_3255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 80.4925 bits (197), Expect = 4.627e-15
Identity = 64/264 (24.24%), Postives = 120/264 (45.45%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSER 1048
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E       ++  +K  +++A       ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D +    RI+FVS+ E+ + RI                 +  +FE Q  ER
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSE-------EKRSAKTVNQLAHALHQDKQLHAGSLVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 80.4925 bits (197), Expect = 4.627e-15
Identity = 64/264 (24.24%), Postives = 120/264 (45.45%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSER 1048
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E       ++  +K  +++A       ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D +    RI+FVS+ E+ + RI                 +  +FE Q  ER
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSE-------EKRSAKTVNQLAHALHQDKQLHAGSLVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 73.1738 bits (178), Expect = 3.273e-13
Identity = 66/277 (23.83%), Postives = 126/277 (45.49%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIR------INNNNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            K  II E ++R  MK+  +G  SSGKS +IN +L        +     C +    +      L++ G       S ++   K  +++A       ++    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + +R    +C   L+++L  ++      RI+FVS+ E+   R      +  +   L++     R +EF+ FE    E I +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEG-------SDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEG-FHARLQEFQNFEQIFEECISQ 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 73.1738 bits (178), Expect = 1.061e-12
Identity = 66/277 (23.83%), Postives = 126/277 (45.49%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIR------INNNNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            K  II E ++R  MK+  +G  SSGKS +IN +L        +     C +    +      L++ G       S ++   K  +++A       ++    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + +R    +C   L+++L  ++      RI+FVS+ E+   R      +  +   L++     R +EF+ FE    E I +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEG-------SDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEG-FHARLQEFQNFEQIFEECISQ 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 73.1738 bits (178), Expect = 1.061e-12
Identity = 66/277 (23.83%), Postives = 126/277 (45.49%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIR------INNNNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            K  II E ++R  MK+  +G  SSGKS +IN +L        +     C +    +      L++ G       S ++   K  +++A       ++    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + +R    +C   L+++L  ++      RI+FVS+ E+   R      +  +   L++     R +EF+ FE    E I +
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEG-------SDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEG-FHARLQEFQNFEQIFEECISQ 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 73.9442 bits (180), Expect = 2.120e-13
Identity = 87/359 (24.23%), Postives = 161/359 (44.85%), Query Frame = 2
Query:  281 KIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDR--NYKLISNGFEI---YCGDSGKEFESKYFSEIAEIGINKIVEAFIP--VEEGN-KILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-----LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIK---KRHEEFELFEMQLSERIERP---RPYKMHFYR-NEM-KTLNDDLQKIFTKMAKKIGNI--DIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECN 1282
            K I +   R  MK+  +G  S+GKS  IN +L      + M  T  C +Q   S     + +L  N  +I     G  G    S   S++  +G + +++ F P   E G  ++L+ +V ++DSPG + + E   +   +  DADVFVL+   +  +++ E       A+ ++KP+VFIL    + S  +T+    N   V  Q  +     L+ +L       ++ RI+FVSS E+ + R+            +    R  EF+ FE      I R      ++ H  R +EM   +  +L  + T  A++   +  ++  S R + + ++    F+    +++E+++ E   K+  +
Sbjct:   90 KTIMDTFQRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGSEGEVGHLQLDDNPQKIDMKMLGKIGHAL-SDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETE----NIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRLKARGLVQKAYQAEGHGTRALEFQNFERHFEHCISRSAIHTKFEAHNRRAHEMIGKMRLNLNSVLTSAAEQRSKLQNNLNESTRTFNECRVNFTQFEKAYREQTEQLRAEVHLKVSAD 443          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 74.7146 bits (182), Expect = 1.478e-13
Identity = 80/332 (24.10%), Postives = 148/332 (44.58%), Query Frame = 2
Query:  239 AKYIDK-----FNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKE--FESKYFSEIA------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVA---LNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRI-----NNNNTCLSDANIKKRHEEFELFEMQLSERIERP---RPYKMHFYRNEMKTLNDDLQKIFTKMAKKI 1150
            A+ +DK     F     K   I E + R  MK+  +G  S+GKS +IN +L        +  T  C   FC+         SNG E Y    G E         ++A      ++  + +V  F P E  + +L+ +V  +DSPG + +  + ++  N+  +ADVFVL+   +  ++  E    +  ++ ++KP++FIL    + S  + +     L   +S + + C   L K+L   +     +R++FVS+ E    RI     N  +        + R+ EF+ FE +  E I +      ++ H  R   K+++ D++ +   + ++I
Sbjct:  108 AEIVDKAERELFESYVYKVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNC---FCQVEG------SNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCS-LLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRG--KSVSGDMKSMLDNIYERI 427          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 74.3294 bits (181), Expect = 1.828e-13
Identity = 79/329 (24.01%), Postives = 148/329 (44.98%), Query Frame = 2
Query:  239 AKYIDK-----FNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKE--FESKYFSEIA------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRI-----NNNNTCLSDANIKKRHEEFELFEMQLSERIERP---RPYKMHFYRNEMKTLNDDLQKIFTKMAKKI 1150
            A+ +DK     F     K   I E + R  MK+  +G  S+GKS +IN +L        +  T  C   FC+         SNG E Y    G E         ++A      ++  + +V  F P E  + +L+ +V  +DSPG + +  + ++  N+  +ADVFVL+   +  ++  E    +  ++ ++KP++FIL    + S  + +    + +S + + C   L K+L   +     +R++FVS+ E    RI     N  +        + R+ EF+ FE +  E I +      ++ H  R   K+++ D++ +   + ++I
Sbjct:  108 AEIVDKAERELFESYVYKVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNC---FCQVEG------SNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCS-LLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQ-ESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRG--KSVSGDMKSMLDNIYERI 423          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 74.3294 bits (181), Expect = 1.828e-13
Identity = 79/329 (24.01%), Postives = 148/329 (44.98%), Query Frame = 2
Query:  239 AKYIDK-----FNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKE--FESKYFSEIA------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRI-----NNNNTCLSDANIKKRHEEFELFEMQLSERIERP---RPYKMHFYRNEMKTLNDDLQKIFTKMAKKI 1150
            A+ +DK     F     K   I E + R  MK+  +G  S+GKS +IN +L        +  T  C   FC+         SNG E Y    G E         ++A      ++  + +V  F P E  + +L+ +V  +DSPG + +  + ++  N+  +ADVFVL+   +  ++  E    +  ++ ++KP++FIL    + S  + +    + +S + + C   L K+L   +     +R++FVS+ E    RI     N  +        + R+ EF+ FE +  E I +      ++ H  R   K+++ D++ +   + ++I
Sbjct:  108 AEIVDKAERELFESYVYKVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNC---FCQVEG------SNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCS-LLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQ-ESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRG--KSVSGDMKSMLDNIYERI 423          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 67.0106 bits (162), Expect = 3.322e-11
Identity = 77/325 (23.69%), Postives = 141/325 (43.38%), Query Frame = 2
Query:   98 ISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGF-EIYCGDSGKEFESKYFSEIAEIGINKIVEAFIP--------VEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDT-NNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFE 1030
            +  K+  Q I+ ++S  +   SN +T LE       L K+ ++ E+L  +  +   I +        ++R  MK+  +G  S+GKS +IN +L        M  T  C   FC+       + +NG  E       +E E    S ++++       A  P         +    IL  +V L+D+PG + T ++ +   +Y  DADVF+L+   + +   +   +    A  +++P++FIL    +++           +  +++ C   L+ +LG   T     +RIY VS+ E   IR  N          ++R++EF  FE
Sbjct:   29 VDAKTELQDIYHDLSNYL---SNFLTILEE----TVLLKDRQMLEHLCAFSSRVEAIAKV-------LSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSC---FCQ-------VQANGSNETEHVKVEQEDEHMELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR--NGQITNPSGQTQQRYQEFLRFE 327          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 80.1073 bits (196), Expect = 7.810e-16
Identity = 69/279 (24.73%), Postives = 131/279 (46.95%), Query Frame = 2
Query:  230 ENLAK--YIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFE 1030
            EN+A    +D+    T K  II+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G       S +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+FVS+ E+ + R+            + R +EF+ FE
Sbjct:   47 ENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEG-------SEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGGALAEGFQDRLKEFQNFE 317          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 80.4925 bits (197), Expect = 3.047e-15
Identity = 77/307 (25.08%), Postives = 140/307 (45.60%), Query Frame = 2
Query:  167 LVTKLENCEKFGELYKEWKIKENLAK--YIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSERI 1051
            LV   E CE   E      + EN+A    +D+    T K  II+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G       S +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+FVS+ E+ + R+            + R +EF+ FE    E I
Sbjct:   27 LVYVQEGCEFVKETCANESL-ENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEG-------SEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGGALAEGFQDRLKEFQNFERSFEECI 324          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 77.0258 bits (188), Expect = 1.034e-14
Identity = 64/256 (25.00%), Postives = 123/256 (48.05%), Query Frame = 2
Query:  230 ENLAK--YIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRI 961
            EN+A    +D+    T K  II+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G E       +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+FVS+ E+ + R+
Sbjct:   47 ENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEGSE-------EEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRM 294          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 77.0258 bits (188), Expect = 3.890e-14
Identity = 74/306 (24.18%), Postives = 140/306 (45.75%), Query Frame = 2
Query:   80 SNFNRKISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAK--YIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRI 961
            S   R +  K    ++F+++         LV   E CE   E      + EN+A    +D+    T K  II+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G       S +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+FVS+ E+ + R+
Sbjct:    7 SPLKRFVLAKKKISEVFEQL---------LVYVQEGCEFVKETCANESL-ENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEG-------SEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRM 294          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 77.0258 bits (188), Expect = 3.890e-14
Identity = 74/306 (24.18%), Postives = 140/306 (45.75%), Query Frame = 2
Query:   80 SNFNRKISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAK--YIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRI 961
            S   R +  K    ++F+++         LV   E CE   E      + EN+A    +D+    T K  II+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G       S +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+FVS+ E+ + R+
Sbjct:    7 SPLKRFVLAKKKISEVFEQL---------LVYVQEGCEFVKETCANESL-ENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAFLKTEG-------SEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHTDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRM 294          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 78.5666 bits (192), Expect = 1.642e-14
Identity = 62/236 (26.27%), Postives = 115/236 (48.73%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G E       ++   K  +++A       ++G   +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   +  +   E    Y   E ++KP++FIL    + S  + +   + ++    +C S L+ +L  +D+    KRI+FVS+ E+ + R++
Sbjct:   86 IGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSE-------EKKSVKTVNQLAHALHMDKDLGAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMH 313          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 78.5666 bits (192), Expect = 2.017e-14
Identity = 62/237 (26.16%), Postives = 116/237 (48.95%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G       S ++   K  +++A       ++G   +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   +  +   E    Y   E ++KP++FIL    + S  + +  + + R  +++ C   L+ +L  +D+    KRI+FVS+ E+ + R++
Sbjct:   78 IGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEG-------SEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEY-MEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMH 305          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 78.1814 bits (191), Expect = 2.196e-14
Identity = 62/236 (26.27%), Postives = 115/236 (48.73%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G E       ++   K  +++A       ++G   +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   +  +   E    Y   E ++KP++FIL    + S  + +   + ++    +C S L+ +L  +D+    KRI+FVS+ E+ + R++
Sbjct:   68 IGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSE-------EKKSVKTVNQLAHALHMDKDLGAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMH 295          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 78.1814 bits (191), Expect = 2.374e-14
Identity = 62/236 (26.27%), Postives = 115/236 (48.73%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G E       ++   K  +++A       ++G   +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   +  +   E    Y   E ++KP++FIL    + S  + +   + ++    +C S L+ +L  +D+    KRI+FVS+ E+ + R++
Sbjct:   83 IGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEGSE-------EKKSVKTVNQLAHALHMDKDLGAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMH 310          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 78.1814 bits (191), Expect = 2.591e-14
Identity = 62/237 (26.16%), Postives = 116/237 (48.95%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G       S ++   K  +++A       ++G   +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   +  +   E    Y   E ++KP++FIL    + S  + +  + + R  +++ C   L+ +L  +D+    KRI+FVS+ E+ + R++
Sbjct:   83 IGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDKAYLMTEG-------SEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEY-MEDVRKQHMERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMH 310          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 78.9518 bits (193), Expect = 8.728e-15
Identity = 65/266 (24.44%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+            L++   + R  EF+ FE Q  E I +
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEG-FQVRMFEFQNFERQFEECISQ 351          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 78.9518 bits (193), Expect = 9.943e-15
Identity = 65/266 (24.44%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+            L++   + R  EF+ FE Q  E I +
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEG-FQVRMFEFQNFERQFEECISQ 351          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 78.9518 bits (193), Expect = 9.943e-15
Identity = 65/266 (24.44%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+            L++   + R  EF+ FE Q  E I +
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEG-FQVRMFEFQNFERQFEECISQ 351          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 78.9518 bits (193), Expect = 9.943e-15
Identity = 65/266 (24.44%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+            L++   + R  EF+ FE Q  E I +
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEG-FQVRMFEFQNFERQFEECISQ 351          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 74.3294 bits (181), Expect = 3.128e-13
Identity = 66/277 (23.83%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIR------INNNNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            K  +I E ++R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G       S ++   K  +++A       ++    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + +R    +C   L+++L  +  +    RI+FVS+ E+ + R      +      L++   + R +EF+ FE    E I +
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEG-------SDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAEG-FQARLQEFQNFEQTFEECISQ 330          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O95140|MFN2_HUMAN (Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 SV=3)

HSP 1 Score: 80.4925 bits (197), Expect = 2.222e-14
Identity = 64/264 (24.24%), Postives = 120/264 (45.45%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSER 1048
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E       ++  +K  +++A       ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D +    RI+FVS+ E+ + RI                 +  +FE Q  ER
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSE-------EKRSAKTVNQLAHALHQDKQLHAGSLVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80U63|MFN2_MOUSE (Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 SV=3)

HSP 1 Score: 78.9518 bits (193), Expect = 6.955e-14
Identity = 65/266 (24.44%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+            L++   + R  EF+ FE Q  E I +
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWP-NSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEG-FQVRMFEFQNFERQFEECISQ 351          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.708e-14
Identity = 61/257 (23.74%), Postives = 111/257 (43.19%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSER 1048
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P      +LK  + L+DSPG + T E+  +   +  DADVFVL+   + +  +    + +  +E +++P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+                 +  +FE Q  ER
Sbjct:   88 ISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSLVSVMWP-NSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFER 343          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R4Z9|MFN1_RAT (Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.967e-13
Identity = 67/277 (24.19%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIA-------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            K  +I E ++R  MK+  +G  SSGKS +IN +L        +  T  C +    +      L++ G       S ++   K  +++A       ++    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + +R    +C   L+++L  +       RI+FVS+ E+ + R+N           L++   + R +EF+ FE    E I +
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEG-------SDEKKSVKTVNQLAHALHMDKDLKAGCLVHVFWP-KAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMPEGGGALAEG-FQARLQEFQNFEQTFEECISQ 330          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YU24|MARF_DROME (Transmembrane GTPase Marf OS=Drosophila melanogaster OX=7227 GN=Marf PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.832e-12
Identity = 79/329 (24.01%), Postives = 148/329 (44.98%), Query Frame = 2
Query:  239 AKYIDK-----FNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKE--FESKYFSEIA------EIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRI-----NNNNTCLSDANIKKRHEEFELFEMQLSERIERP---RPYKMHFYRNEMKTLNDDLQKIFTKMAKKI 1150
            A+ +DK     F     K   I E + R  MK+  +G  S+GKS +IN +L        +  T  C   FC+         SNG E Y    G E         ++A      ++  + +V  F P E  + +L+ +V  +DSPG + +  + ++  N+  +ADVFVL+   +  ++  E    +  ++ ++KP++FIL    + S  + +    + +S + + C   L K+L   +     +R++FVS+ E    RI     N  +        + R+ EF+ FE +  E I +      ++ H  R   K+++ D++ +   + ++I
Sbjct:  108 AEIVDKAERELFESYVYKVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNC---FCQVEG------SNGGEAYLMTEGSEEKLNVVNIKQLANALCQEKLCESSLVRIFWPRERCS-LLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQ-ESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECISQSAVKTKFQQHSSRG--KSVSGDMKSMLDNIYERI 423          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0N4W3T9 (Dynamin-type G domain-containing protein OS=Haemonchus placei OX=6290 GN=HPLM_LOCUS4498 PE=3 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 9.856e-17
Identity = 108/457 (23.63%), Postives = 200/457 (43.76%), Query Frame = 2
Query:   89 NRKISNKSNPQQIFDEMSIEIAKR--SNLVTKL-ENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLI----SNGFEI-YCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEG---NKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD--ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQ-VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANI---KKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASV---------RPYEDGKMLLENFKTTISK-------ESEKVKLECKKKIECN----------VIKMLNTTSMKDKEGI 1330
            +R+++  + P   F E     AK+   ++ T L ++ ++  E+YK+  +    A+  D+        K I E   R  MK+  +G  S+GKS  IN +L +    + M  T  C +Q     + N  L+     N   I   G  G    S   S++  +G + ++  F P   G   N++L+ +V ++DSPG + + E   +   +  DADVFVL+   +  +++ E +  Y  A+ ++KP+VFIL    + S  +++ V    Q+ +      L+ +L      ++  RI+FVSS E+ + R+       +   +   + R  EFE+FE Q    I R         R + +  N    +I  +M     N+D+  S          +  +D  ++  N +T  ++       ++E+++ E   K+  +          ++   N   M  KEGI
Sbjct:   22 SRRMNGDAEPLLRFSE-----AKKVLGDIYTDLGKHVDELDEVYKDGSVSLVPAEQADEIALFRDSIKTIMETFRRDNMKVVFFGRTSNGKSTTINAMLHAKILPQGMGHTTCCFLQVQGCDEDNGYLLHEDDPNRIPISQLGKIGHALSSDN-SDLPAMGQDSLLRVFYPKGHGEGENRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVLNAESTLTQAEKSFFYRVAKKLSKPNVFILNNRWDASAAESEHVDDVKQQHLTRFRQFLVNELEVATDRDVKDRIFFVSSREVLESRLKARGLLKNPYQVDGHQVRAMEFEMFEKQFEHCISRSA------IRTKFEAHNRRANEIIARMR---ANVDVVYSAANRNKEFLEKQLQDSTIVFNNCRTNFAQFERAYREQTERLRAEVHLKVSADFSEEIMRLEAIVDRFNMPFMDTKEGI 463          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: W2SMX6 (Fzo-like conserved region OS=Necator americanus OX=51031 GN=NECAME_14398 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.281e-16
Identity = 90/355 (25.35%), Postives = 164/355 (46.20%), Query Frame = 2
Query:  281 KIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCI--VQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSE---IAEIGINKIVEAFIPVEEG---NKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQ-VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANI---KKRHEEFELFEMQLSERIERP---RPYKMHFYR-NEM---KTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECN 1282
            + I E   R  MK+  +G  S+GKS  IN +L +    + M  T  C   VQ C + D  Y L+ +       D   +      S+   +  +G + ++  F P   G   N++L+ +V ++DSPG + + E   +   +  DADVFVL+   + +  +   S+ +  A+ ++KP+VFIL    + S  +++ V    Q+ +      L+ +L      ++  RI+FVSS E+ D R+       +   +   + R  EFE+FE Q  + I R      ++ H  R NE+      N D+       AK+I    ++ S + + D +M    F+    +++E+++ E   K+  +
Sbjct:   71 QTIMETFRRDNMKVVFFGRTSNGKSTTINAMLHAKILPQGMGHTTCCFLQVQGC-NEDVGYLLLEDNPTRISIDQLSKIGHALSSDNSGLPAMGQDSLLRVFYPKGRGDGENRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVLNAESTLTQAEKSFFHRVAKKLSKPNVFILNNRWDASASESEHVEDVRQQHLTRFRQFLVNELEVATDRDVKDRIFFVSSREVLDSRLKARGLIKTPYQMEGHQVRAMEFEMFERQFEQCISRAAIRTKFEAHNRRANEIIARMRANVDVVHAAASKAKQILEQSLQHSTQVFNDCRMNFAQFERAYREQTERLRAEVHLKVSAD 424          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A0N4YBW7 (Transmembrane GTPase fzo-1 (inferred by orthology to a C. elegans protein) OS=Nippostrongylus brasiliensis OX=27835 GN=NBR_LOCUS13997 PE=3 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 4.886e-16
Identity = 95/390 (24.36%), Postives = 165/390 (42.31%), Query Frame = 2
Query:  281 KIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLI----SNGFEI-YCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEG---NKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQ-VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANI---KKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDI----------------EASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECN----------VIKMLNTTSMKDKEGI 1330
            + I +   R  MK+  +G  S+GKS  IN +L +    + M  T  C +Q     + N  L+     N   I   G  G    S   S +  +G + ++  F P   G   N++L+ +V ++DSPG + + E   +   +  DADVFVL+   + +  +   S+ +  A+ ++KP+VFIL    + S  +++ V    Q+ +      L+ +L      ++  RIYFVSS E+ D R+       S   +   + R  EFE+FE    + I +         R + +  N    +I  KM     N+D+                + S   + D +     F+    +++E+V+ E   K+  +          +I   N   M  KEGI
Sbjct:   70 RTIMDTFRRDNMKVVFFGRTSNGKSTTINAMLHAKILPQGMGHTTCCFLQVQGCDEENGYLLLEDDPNRIPIDQLGKIGHALSSDN-SGLPSMGQDSLLRVFYPKGHGEGENRLLQHDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVLNAESTLTQAEKSFFHRVAKKLSKPNVFILNNRWDASASESEHVEDVKQQHLTRFRQFLVNELEVASDRDVKDRIYFVSSREVLDARLKARGLVKSPYQVDGHQVRAMEFEMFEKHFEQCISKSA------IRTKFEAHNRRANEIIAKMR---ANVDVVYTAANRCKEDLENKLQESTVVFNDCRANFAQFERAYREQTERVRAEVHLKVSADFSEEIMRLEAIIDRFNMPFMDTKEGI 449          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A016TQC8 (Dynamin-type G domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0083.g1655 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.171e-15
Identity = 91/354 (25.71%), Postives = 163/354 (46.05%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCI--VQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSE---IAEIGINKIVEAFIPVEEG---NKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQ-VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANI---KKRHEEFELFEMQLSERIERP---RPYKMHFYR-NE----MKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECN 1282
            I E   R  MK+  +G  S+GKS  IN +L +    + M  T  C   VQ C   D  Y L+ +       D   +      S+   +  +G + ++  F P   G   N++L+ +V ++DSPG + + E   +   +  DADVFVL+   + +  +   S+ +  A+ ++KP+VFIL    + S  +++ V    Q+ +      L+ +L      ++  RI+FVSS E+ D R+       +   +   + R  EFE+FE Q  + I R      ++ H  R NE    M+   D +    TK AK+     ++ S + + D +M    F+    +++E+++ E   K+  +
Sbjct:  285 IMETFRRDNMKVVFFGRTSNGKSTTINAMLHAKILPQGMGHTTCCFLQVQGCNE-DTGYLLLEDNPTRIPIDQLSKIGHALSSDNSGLPAMGQDSLLRVFYPKGRGETENRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVLNAESTLTQAEKSFFHRVAKKLSKPNVFILNNRWDASAAESEHVEDVKQQHLTRFRQFLVNELEVATDRDVKDRIFFVSSREMLDSRLKARGLIKTPYQMDGHQVRAMEFEMFERQFEQCISRAAIRTKFEAHNRRANEIIARMRANVDVVHAAATK-AKESLEYSLKRSTQVFNDCRMNFAQFERAYREQTERLRAEVHLKVSAD 636          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A016TS24 (Dynamin-type G domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0083.g1655 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.272e-15
Identity = 91/354 (25.71%), Postives = 163/354 (46.05%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCI--VQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSE---IAEIGINKIVEAFIPVEEG---NKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQ-VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANI---KKRHEEFELFEMQLSERIERP---RPYKMHFYR-NE----MKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECN 1282
            I E   R  MK+  +G  S+GKS  IN +L +    + M  T  C   VQ C   D  Y L+ +       D   +      S+   +  +G + ++  F P   G   N++L+ +V ++DSPG + + E   +   +  DADVFVL+   + +  +   S+ +  A+ ++KP+VFIL    + S  +++ V    Q+ +      L+ +L      ++  RI+FVSS E+ D R+       +   +   + R  EFE+FE Q  + I R      ++ H  R NE    M+   D +    TK AK+     ++ S + + D +M    F+    +++E+++ E   K+  +
Sbjct:  293 IMETFRRDNMKVVFFGRTSNGKSTTINAMLHAKILPQGMGHTTCCFLQVQGCNE-DTGYLLLEDNPTRIPIDQLSKIGHALSSDNSGLPAMGQDSLLRVFYPKGRGETENRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVLNAESTLTQAEKSFFHRVAKKLSKPNVFILNNRWDASAAESEHVEDVKQQHLTRFRQFLVNELEVATDRDVKDRIFFVSSREMLDSRLKARGLIKTPYQMDGHQVRAMEFEMFERQFEQCISRAAIRTKFEAHNRRANEIIARMRANVDVVHAAATK-AKESLEYSLKRSTQVFNDCRMNFAQFERAYREQTERLRAEVHLKVSAD 644          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 75.485 bits (184), Expect = 1.047e-13
Identity = 56/229 (24.45%), Postives = 106/229 (46.29%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E ++R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P +    +L+ ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +   S+ +   E ++ P++FIL    + S  + +     +R    +C S L+ +LG +D      RI+FVS+ E+   R+ 
Sbjct:   88 IGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNEAFLLTEGSEERKNVKTVNQLAHALHQDEDLDAGSLVCVMWP-KAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHMDRCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQ 315          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 74.7146 bits (182), Expect = 1.797e-13
Identity = 69/279 (24.73%), Postives = 131/279 (46.95%), Query Frame = 2
Query:  269 TRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFES-KYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVN--AEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERI 1051
            +RK + I E + R +MK+  +G  S+GKS +IN +L        +  T  C +   +  D +   ++        ++ +E +S K  +++A        +    +V  F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL+   + +       + +  +E ++KP++FIL  N  ++ +     L+  R  ++  C   L+ +L  +  +    RI+FVS+ E    RI+           L+D   + R +EF+ FE    E I
Sbjct:   62 SRKLEAIWEVLARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFIS-VEGTDGDQAFLTT-------ENSEERKSIKTVNQLAHALHMDRNLDSGCLVRVFWP-KTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFIL-NNRWDASETEPEYLDGVRKQHMDRCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQGMPETGAALADG-FQDRLQEFQSFERTFEEFI 329          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 72.0182 bits (175), Expect = 1.308e-12
Identity = 66/280 (23.57%), Postives = 129/280 (46.07%), Query Frame = 2
Query:  269 TRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            T K  +I+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G E       +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T ++  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +  +++ R  +   C   L+++L  +D       I+FVS+ E+ + R+            L++   + R +EF+ FE    E I +
Sbjct:   62 TEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSE-------EEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEY-MDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEG-FQDRLKEFQSFERTFEECISQ 331          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 71.633 bits (174), Expect = 1.558e-12
Identity = 66/280 (23.57%), Postives = 129/280 (46.07%), Query Frame = 2
Query:  269 TRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIER 1057
            T K  +I+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + +    L + G E       +E   K  +++A        +    +V+ F P +    +L+ ++ L+DSPG++ T ++  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +  +++ R  +   C   L+++L  +D       I+FVS+ E+ + R+            L++   + R +EF+ FE    E I +
Sbjct:   62 TEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSE-------EEKSIKTVNQLAHALHMDESLDAGCLVKVFWP-KTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEY-MDDVRKQHTDRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEG-FQDRLKEFQSFERTFEECISQ 331          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 67.0106 bits (162), Expect = 1.370e-11
Identity = 71/275 (25.82%), Postives = 125/275 (45.45%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRN-YKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGD----ISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVAL-------NNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDA------NIKKRHEEFELFEMQLSERIER 1057
            I E I R +MK+  +G  S+GKS ++N +L        +  T  C +    S   + Y LI    E     +  +     F E  ++  + +V+ + P +   K+L ++V L+DSPG + + ++  +   +  DADVFVL+   +    ++EK      VN + ++KP++FIL    + S  +  V +       + QR+V      L K+L  +D    + R++FVS+ E    R+  +     +           R  EFE FE +  E I +
Sbjct:   87 ITEVIARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPYILIPESDERRNVKTLGQIAHALFEE--KLDHSSLVQVYWP-KSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHK-VN-QKLSKPNIFILNNRWDASAGEPDVEMMELVKKQHLQRNVDF----LSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENFEHKFEECISK 352          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 76.2554 bits (186), Expect = 5.630e-14
Identity = 73/316 (23.10%), Postives = 148/316 (46.84%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEAS 1174
            K  +I+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + D    L + G       S +E   K  +++A        +    +V  F P +    +L+ ++ L+DSPG++ T ++  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+F+S+ E+ + R+            L++   ++R +EF+ FE +  E I +    K  F ++ ++      ++I  K+   + +I IEA+
Sbjct:   75 KLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEG-------SDEEKSIKTVNQMAHALHMDESLDAGCLVRVFWP-KTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEG-FQERLKEFQSFERRFEECISQS-AVKTKFEQHTIRA-----KQITEKVKSIMDDIHIEAA 375          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 76.2554 bits (186), Expect = 6.105e-14
Identity = 73/316 (23.10%), Postives = 148/316 (46.84%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAE-------IGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEAS 1174
            K  +I+E + R  MK+  +G  S+GKS +IN +L        +  T  C +    + D    L + G       S +E   K  +++A        +    +V  F P +    +L+ ++ L+DSPG++ T ++  +   +  DADVFVL+   + +       + +   E ++KP++FIL    + S  + +   + ++    +C + L+++L  +D      RI+F+S+ E+ + R+            L++   ++R +EF+ FE +  E I +    K  F ++ ++      ++I  K+   + +I IEA+
Sbjct:   75 KLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEG-------SDEEKSIKTVNQMAHALHMDESLDAGCLVRVFWP-KTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHTDRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEG-FQERLKEFQSFERRFEECISQS-AVKTKFEQHTIRA-----KQITEKVKSIMDDIHIEAA 375          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 72.7886 bits (177), Expect = 7.531e-13
Identity = 56/230 (24.35%), Postives = 108/230 (46.96%), Query Frame = 2
Query:  287 IEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNA--EDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS--LIKQLGGLDTNNMDKRIYFVSSTELFDIRIN 964
            I E + R  MK+  +G  S+GKS +IN +L        +  T  C ++   +      L++ G E           +    +  ++    +V    P +    +L+ ++ L+DSPG + T E+  +   +  DADVFVL+   + +  +   S+ +   E ++ P++FIL    + S  + +  ++  R  ++  CS  L+++LG +D      RI+FVS+ E+   R+ 
Sbjct:   88 IGEVLARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSEGFLLTEGSEEKKSIKTVNQLAHALHQDQDLDAGSLVCVMWP-KVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEY-MDEVRRQHMDRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQ 315          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.700e-11
Identity = 67/279 (24.01%), Postives = 120/279 (43.01%), Query Frame = 2
Query:  275 KWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIG----------INKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAAS----YVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCS-LIKQLGGLDTNNMDKRIYFVSSTELFDIRINN------NNTCLSDANIKKRHEEFELFEMQLSER 1048
            K   I + + R  MK+  +G  S+GKS +IN +L        +  T  C +    +         +G E Y      E E +  S + ++            + +V+ F P +    +L+ ++ L+DSPG++ T E+  +   +  DADVFVL  VG+     M       +  +E ++KP++FIL    + S  +       ++    +C   L ++LG +  N    RI+F+S+ E+   R+            L++    +R  EF+ FE     R
Sbjct:   62 KLYTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGT---------DGDEAYLTSEASE-ERRSISTVNQLAHALHMDPTLDSSCLVKVFWP-KSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVL--VGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHLDRCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEG-FHERLTEFQRFERTFEVR 326          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014746.1 (SMESG000014746.1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 416/468 (88.89%), Postives = 429/468 (91.67%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECNVIKMLNTTSMKDKEGIHKQIADHHSLIDKAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVKAMNAQQGEMEPQFISFVRMQSDPPGSRAEIRNSAVEVPVNSDDGNDGQNGTGARPQAGWGIKARFYKIYNSPFGLSVRNSANYMIGNTNNKFSDLDQKVHKNDAEINNEVTRCISRIENAFNLKVDELITKLNDKINLRKDYKEILSIHFE 1948
            G NK  E   PVEEGNKILK+NVKLIDSPGS+ T+EMAE FR+YAADADVFVL+F GDISEKEMAASYVNAEDVTKPDVFILM NSEES QDTQ    N RSVY QCCSLI+QLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLS+ANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKES+KVKLECK+KIECNVIKMLNTT+M+DKEGIHKQIADHHSLI KAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVK MNAQQGEME QFISFVRMQSDP G R EIRNSAVEVPVNS  GNDGQNGTGARP AGWGI     KI NSP    VRNSANY+IGNTN K +DLDQKVHKNDAEI NEVTRCISRIENAFNLKVDELITKLNDKINLRKDYKEILSIHFE
Sbjct: 1317 GTNKSDEYLSPVEEGNKILKENVKLIDSPGSDNTNEMAECFRHYAADADVFVLVFAGDISEKEMAASYVNAEDVTKPDVFILMSNSEESEQDTQ----NLRSVYAQCCSLIEQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSNANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESQKVKLECKEKIECNVIKMLNTTNMEDKEGIHKQIADHHSLIGKAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVKPMNAQQGEMELQFISFVRMQSDPSGYRVEIRNSAVEVPVNSAGGNDGQNGTGARPNAGWGI-----KIVNSPIEF-VRNSANYIIGNTNKKLADLDQKVHKNDAEIINEVTRCISRIENAFNLKVDELITKLNDKINLRKDYKEILSIHFE 1774          

HSP 2 Score: 369.777 bits (948), Expect = 1.512e-111
Identity = 180/197 (91.37%), Postives = 186/197 (94.42%), Query Frame = 2
Query:   77 MSNFNRKISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYF 667
            MSNFN KISNKSNPQQIFDEMSIEIAKR NLVT LENCE+FG+LYKEWKIK+NL KYIDKFNEITRKWKIIEERINRTEMKIYI GNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEI EIGINKIVEAFIPVEEGNKILK+NVKLIDS G+NK+DE    F
Sbjct:    1 MSNFNEKISNKSNPQQIFDEMSIEIAKRQNLVTNLENCEEFGKLYKEWKIKQNLPKYIDKFNEITRKWKIIEERINRTEMKIYICGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIDEIGINKIVEAFIPVEEGNKILKENVKLIDSHGNNKSDEDLSPF 197          

HSP 3 Score: 57.3806 bits (137), Expect = 3.889e-8
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  380 SDFNAREMEETGKCI---VQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            SD +   +EE  K +   V+   SP  N     +  ++   + G +  ++    I   GINK  E   PVEEGNKILK+NVKL+DSPG+NK+DE
Sbjct:  973 SDEDLSPVEEGNKILKENVKLIDSPGTN----KSDEDLSTVEEGNKILTENVKMIDSPGINKSDEDLSPVEEGNKILKENVKLVDSPGTNKSDE 1062          

HSP 4 Score: 55.0694 bits (131), Expect = 1.741e-7
Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLIDSPG NK+DE
Sbjct:  795 GINKSDEDLSPVEEGNKILKENVKLIDSPGINKSDE 830          

HSP 5 Score: 53.9138 bits (128), Expect = 4.633e-7
Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVKLIDSPG+NK+DE
Sbjct:  969 GNNKSDEDLSPVEEGNKILKENVKLIDSPGTNKSDE 1004          

HSP 6 Score: 53.1434 bits (126), Expect = 7.150e-7
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVK+IDSPG NK DE
Sbjct:  853 GINKSDEDLSPVEEGNKILKENVKMIDSPGINKRDE 888          

HSP 7 Score: 52.373 bits (124), Expect = 1.142e-6
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+N+KLIDSPG+NK+DE
Sbjct:  650 GNNKSDEDLSPVEEGNKILKENLKLIDSPGTNKSDE 685          

HSP 8 Score: 52.373 bits (124), Expect = 1.171e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  244 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 279          

HSP 9 Score: 52.373 bits (124), Expect = 1.171e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  302 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 337          

HSP 10 Score: 52.373 bits (124), Expect = 1.171e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  737 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 772          

HSP 11 Score: 52.373 bits (124), Expect = 1.243e-6
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVK+IDSPG+NK+DE
Sbjct:  418 GNNKSDEDLSPVEEGNKILKENVKMIDSPGNNKSDE 453          

HSP 12 Score: 51.6026 bits (122), Expect = 2.519e-6
Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  +   PVEEGNKILK+NVK+IDSPG NK DE
Sbjct:  563 GINKSDKDLSPVEEGNKILKENVKMIDSPGINKRDE 598          

HSP 13 Score: 50.8322 bits (120), Expect = 3.601e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLIDS G NK+DE
Sbjct:  824 GINKSDEDLSPVEEGNKILKENVKLIDSHGINKSDE 859          

HSP 14 Score: 50.447 bits (119), Expect = 4.417e-6
Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  679 GTNKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 714          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014746.1 (SMESG000014746.1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 403/455 (88.57%), Postives = 416/455 (91.43%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECNVIKMLNTTSMKDKEGIHKQIADHHSLIDKAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVKAMNAQQGEMEPQFISFVRMQSDPPGSRAEIRNSAVEVPVNSDDGNDGQNGTGARPQAGWGIKARFYKIYNSPFGLSVRNSANYMIGNTNNKFSDLDQKVHKNDAEINNEVTRCISRIENAFNLKVDELITKLNDKINL 1909
            G NK  E   PVEEGNKILK+NVKLIDSPGS+ T+EMAE FR+YAADADVFVL+F GDISEKEMAASYVNAEDVTKPDVFILM NSEES QDTQ    N RSVY QCCSLI+QLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLS+ANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKES+KVKLECK+KIECNVIKMLNTT+M+DKEGIHKQIADHHSLI KAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVK MNAQQGEME QFISFVRMQSDP G R EIRNSAVEVPVNS  GNDGQNGTGARP AGWGI     KI NSP    VRNSANY+IGNTN K +DLDQKVHKNDAEI NEVTRCISRIENAFNLKVDELITKLNDKINL
Sbjct: 1317 GTNKSDEYLSPVEEGNKILKENVKLIDSPGSDNTNEMAECFRHYAADADVFVLVFAGDISEKEMAASYVNAEDVTKPDVFILMSNSEESEQDTQ----NLRSVYAQCCSLIEQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSNANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESQKVKLECKEKIECNVIKMLNTTNMEDKEGIHKQIADHHSLIGKAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVKPMNAQQGEMELQFISFVRMQSDPSGYRVEIRNSAVEVPVNSAGGNDGQNGTGARPNAGWGI-----KIVNSPIEF-VRNSANYIIGNTNKKLADLDQKVHKNDAEIINEVTRCISRIENAFNLKVDELITKLNDKINL 1761          

HSP 2 Score: 369.392 bits (947), Expect = 2.811e-111
Identity = 180/197 (91.37%), Postives = 186/197 (94.42%), Query Frame = 2
Query:   77 MSNFNRKISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYF 667
            MSNFN KISNKSNPQQIFDEMSIEIAKR NLVT LENCE+FG+LYKEWKIK+NL KYIDKFNEITRKWKIIEERINRTEMKIYI GNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEI EIGINKIVEAFIPVEEGNKILK+NVKLIDS G+NK+DE    F
Sbjct:    1 MSNFNEKISNKSNPQQIFDEMSIEIAKRQNLVTNLENCEEFGKLYKEWKIKQNLPKYIDKFNEITRKWKIIEERINRTEMKIYICGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIDEIGINKIVEAFIPVEEGNKILKENVKLIDSHGNNKSDEDLSPF 197          

HSP 3 Score: 56.9954 bits (136), Expect = 4.499e-8
Identity = 38/94 (40.43%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  380 SDFNAREMEETGKCI---VQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            SD +   +EE  K +   V+   SP  N     +  ++   + G +  ++    I   GINK  E   PVEEGNKILK+NVKL+DSPG+NK+DE
Sbjct:  973 SDEDLSPVEEGNKILKENVKLIDSPGTN----KSDEDLSTVEEGNKILTENVKMIDSPGINKSDEDLSPVEEGNKILKENVKLVDSPGTNKSDE 1062          

HSP 4 Score: 55.0694 bits (131), Expect = 1.912e-7
Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLIDSPG NK+DE
Sbjct:  795 GINKSDEDLSPVEEGNKILKENVKLIDSPGINKSDE 830          

HSP 5 Score: 53.5286 bits (127), Expect = 5.264e-7
Identity = 27/36 (75.00%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVKLIDSPG+NK+DE
Sbjct:  969 GNNKSDEDLSPVEEGNKILKENVKLIDSPGTNKSDE 1004          

HSP 6 Score: 53.1434 bits (126), Expect = 7.786e-7
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVK+IDSPG NK DE
Sbjct:  853 GINKSDEDLSPVEEGNKILKENVKMIDSPGINKRDE 888          

HSP 7 Score: 52.373 bits (124), Expect = 1.264e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  244 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 279          

HSP 8 Score: 52.373 bits (124), Expect = 1.264e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  302 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 337          

HSP 9 Score: 52.373 bits (124), Expect = 1.264e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  737 GINKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 772          

HSP 10 Score: 52.373 bits (124), Expect = 1.275e-6
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+N+KLIDSPG+NK+DE
Sbjct:  650 GNNKSDEDLSPVEEGNKILKENLKLIDSPGTNKSDE 685          

HSP 11 Score: 52.373 bits (124), Expect = 1.424e-6
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVK+IDSPG+NK+DE
Sbjct:  418 GNNKSDEDLSPVEEGNKILKENVKMIDSPGNNKSDE 453          

HSP 12 Score: 51.2174 bits (121), Expect = 2.718e-6
Identity = 26/36 (72.22%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  +   PVEEGNKILK+NVK+IDSPG NK DE
Sbjct:  563 GINKSDKDLSPVEEGNKILKENVKMIDSPGINKRDE 598          

HSP 13 Score: 50.8322 bits (120), Expect = 3.820e-6
Identity = 27/36 (75.00%), Postives = 29/36 (80.56%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            GINK  E   PVEEGNKILK+NVKLIDS G NK+DE
Sbjct:  824 GINKSDEDLSPVEEGNKILKENVKLIDSHGINKSDE 859          

HSP 14 Score: 50.447 bits (119), Expect = 4.806e-6
Identity = 26/36 (72.22%), Postives = 28/36 (77.78%), Query Frame = 2
Query:  545 GINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDE 652
            G NK  E   PVEEGNKILK+NVKLID PG NK+DE
Sbjct:  679 GTNKSDEDLSPVEEGNKILKENVKLIDLPGINKSDE 714          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000070111.1 (SMESG000070111.1)

HSP 1 Score: 276.559 bits (706), Expect = 2.939e-85
Identity = 171/448 (38.17%), Postives = 263/448 (58.71%), Query Frame = 2
Query:  104 NKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFE-----SKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVAL-NNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECNVIKMLNTTSMKDKEGIHKQIADHHSLIDKAIDELLHNLYSEYSWLINNL 1429
            NK   Q I  +   E+ K   L+T+LEN   F EL KEWK+++ + K+ D+F E+  +   I+E I++  +KI+ +G+ SSGK++LIN ILG +F    M  T KC V   KSPD  YK++    E       K  E     S +  E + +   + V+ FIP+ + NKILK NV+LIDSPG+   +E+ E  +N+ +DAD+ + L   D+SE++     +     TKPD+FIL+   ++S QD    L    +++  +C  L+ + GG  T ++DKRI F+S+ E+F  RI N     S+ N K R+ +FE FE Q+ E I+ P+  K   Y+ E+KTL  +L  I  +++K+I NID E+ V+ YE  K     FK    ++ EK++L+CK+ IEC V KMLNT ++ +KE I++QI  H+ LI+K+I +L   L  EYS L +++
Sbjct:   12 NKKMSQNIDSDARQEMRKAKKLLTELENYIGFEELCKEWKVQKKIKKFKDRFVELENQLNDIQEEISKKNIKIFFFGSVSSGKTRLINAILGGEFFMSTMNHTTKCFVHIMKSPDAKYKIVHKNQEFIYESKNKIIEEVEKISTFNKETSSMS-QESVKVFIPIGDDNKILKGNVELIDSPGTGDIEELIECVQNHLSDADICIYLLCNDVSEEDERFFNIRINRTTKPDIFILVNKWDQSDQDQDSRLCETYKNLVGKCFGLVGKFGGPKTKDIDKRIIFISAIEVFGYRIKNKEP--SNRNQKIRYADFERFEDQIEEYIQNPQQLKTRRYKREIKTLLKELNIIIVELSKQINNIDFESCVKRYEGYKTQALIFKEITRRDCEKLQLQCKENIECKVTKMLNTINIDNKE-INEQITQHYDLINKSISDLFQELEREYSKLASDI 455          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014747.1 (SMESG000014747.1)

HSP 1 Score: 258.455 bits (659), Expect = 2.045e-77
Identity = 178/492 (36.18%), Postives = 280/492 (56.91%), Query Frame = 2
Query:  116 PQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKY-----FSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVALNNQ--RSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNTCLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKIFTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIECNVIKMLNTTSMKDKEGIHKQIADHHSLIDKAIDELLHNLYSEYSWLINNLIGNEQGQEIAVEPLAQFYEMVKAMNAQQGEMEP----QFISFVRMQS 1558
             Q   + +S EI     L+TK++N  ++ +LY+E  +KE + ++  + +++  K  I +++  R + KIY +G  SSGKSKLIN ILG D     ++ T  C V   KS +  Y+ I +G + +  D+ KE   K       +E ++   N+ VE FIP+ + NKILK NV+L+DSPGS    E++E  RNYA DA++FV +   DI+E E    +   + VTKPD+FIL    ++  QD +    ++  +++  +C +LIK   G  T ++DKRIYFVS+ EL DIRIN  +  L+ +  K+R+EEF  FE  +SE I+     ++   R E+    ++ + +  K+ K+I  ID ++SV   E  KM  E F   I K  EK K EC +KI+CNV  MLNTT+  DK+ I  +IA H+  I+++   L+  LY +Y  LI  L+G  QG EI+ E +      +   N+ + +++P    +F+SF+ + S
Sbjct:    2 AQNYIENLSNEIDAFKLLLTKIQNNGEYSKLYEELNVKELIDRFTTECDKLQGKMNIFQKKFIREQRKIYFFGRMSSGKSKLINGILGEDLFLSAVKHTTNCFVHIRKSDNEKYR-IRHGGDTFIYDNKKEAMDKVETISTVNEWSKFTENEFVELFIPLGKDNKILKGNVELVDSPGSGIRGEISECIRNYATDANIFVYVLSDDITE-EDERFFEFQKTVTKPDIFILFNKWDQLDQDCESKGIDKTYKALKGRCQNLIKTFMGKQTKDIDKRIYFVSAKELLDIRINKKD--LNGSKEKERYEEFLHFENYISEYIQNYETSEI--CRTEIDIERNNFKNLVEKLKKRINKIDFDSSVGKLEKDKMQTERFTKEIQKICEKFKSECNEKIKCNVTTMLNTTTF-DKKIIQNKIAKHYFGINRSFRALIKELYEKYGSLI-RLLGEAQGAEISTEQIQ--LNDISQNNSMEVDLDPGVATRFLSFIPIIS 483          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000070111.1 (SMESG000070111.1)

HSP 1 Score: 149.828 bits (377), Expect = 1.060e-40
Identity = 93/250 (37.20%), Postives = 142/250 (56.80%), Query Frame = 2
Query:  101 SNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKIKENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVILGSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFE-----SKYFSEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNYAADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQVAL 835
            +NK   Q I  +   E+ K   L+T+LEN   F EL KEWK+++ + K+ D+F E+  +   I+E I++  +KI+ +G+ SSGK++LIN ILG +F    M  T KC V   KSPD  YK++    E       K  E     S +  E + +   + V+ FIP+ + NKILK NV+LIDSPG+   +E+ E  +N+ +DAD+ + L   D+SE++     +     TKPD+FIL+   ++S QD    L
Sbjct:   11 NNKKMSQNIDSDARQEMRKAKKLLTELENYIGFEELCKEWKVQKKIKKFKDRFVELENQLNDIQEEISKKNIKIFFFGSVSSGKTRLINAILGGEFFMSTMNHTTKCFVHIMKSPDAKYKIVHKNQEFIYESKNKIIEEVEKISTFNKETSSMS-QESVKVFIPIGDDNKILKGNVELIDSPGTGDIEELIECVQNHLSDADICIYLLCNDVSEEDERFFNIRINRTTKPDIFILVNKWDQSDQDQDSRL 259          
The following BLAST results are available for this feature:
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN24.627e-1524.24mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN24.627e-1524.24mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN13.273e-1323.83mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN11.061e-1223.83mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN11.061e-1223.83mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-12.120e-1324.23Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Marf1.478e-1324.10gene:FBgn0029870 transcript:FBtr0343373[more]
Marf1.828e-1324.01gene:FBgn0029870 transcript:FBtr0070910[more]
Marf1.828e-1324.01gene:FBgn0029870 transcript:FBtr0070909[more]
fzo3.322e-1123.69gene:FBgn0011596 transcript:FBtr0084399[more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn1b7.810e-1624.73mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b3.047e-1525.08mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.034e-1425.00mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b3.890e-1424.18mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b3.890e-1424.18mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn11.642e-1426.27mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn12.017e-1426.16mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn12.196e-1426.27mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn12.374e-1426.27mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn12.591e-1426.16mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn28.728e-1524.44mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn29.943e-1524.44mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn29.943e-1524.44mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn29.943e-1524.44mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn13.128e-1323.83mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95140|MFN2_HUMAN2.222e-1424.24Mitofusin-2 OS=Homo sapiens OX=9606 GN=MFN2 PE=1 S... [more]
sp|Q80U63|MFN2_MOUSE6.955e-1424.44Mitofusin-2 OS=Mus musculus OX=10090 GN=Mfn2 PE=1 ... [more]
sp|Q8R500|MFN2_RAT8.708e-1423.74Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
sp|Q8R4Z9|MFN1_RAT7.967e-1324.19Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 ... [more]
sp|Q7YU24|MARF_DROME1.832e-1224.01Transmembrane GTPase Marf OS=Drosophila melanogast... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N4W3T99.856e-1723.63Dynamin-type G domain-containing protein OS=Haemon... [more]
W2SMX61.281e-1625.35Fzo-like conserved region OS=Necator americanus OX... [more]
A0A0N4YBW74.886e-1624.36Transmembrane GTPase fzo-1 (inferred by orthology ... [more]
A0A016TQC81.171e-1525.71Dynamin-type G domain-containing protein OS=Ancylo... [more]
A0A016TS241.272e-1525.71Dynamin-type G domain-containing protein OS=Ancylo... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn21.047e-1324.45mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
ENSAMXT00000043809.11.797e-1324.73mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
mfn1b1.308e-1223.57mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b1.558e-1223.57mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423791.370e-1125.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b5.630e-1423.10mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b6.105e-1423.10mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn27.531e-1324.35mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
ENSORLT00000009003.21.700e-1124.01pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014746.11.512e-11188.89SMESG000014746.1[more]
SMESG000014746.12.811e-11188.57SMESG000014746.1[more]
SMESG000070111.12.939e-8538.17SMESG000070111.1[more]
SMESG000014747.12.045e-7736.18SMESG000014747.1[more]
SMESG000070111.11.060e-4037.20SMESG000070111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002421 ID=SMED30002421|Name=Dynamin-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1998bp
TTTTTTTTAGATTTAACAACCGTATTTTCGTTTTTTGTTTCTGGTTGTTT
TTATTCCATACTTTTTGTAAAACGCAATGTCTAATTTCAATAGAAAAATA
TCCAATAAAAGTAATCCTCAACAGATATTTGATGAAATGTCTATAGAAAT
AGCAAAAAGGTCAAATCTTGTAACAAAATTAGAAAACTGTGAAAAATTCG
GAGAACTTTACAAAGAATGGAAAATAAAAGAAAATCTGGCTAAATATATA
GATAAATTCAATGAAATAACGAGAAAATGGAAAATAATAGAGGAGAGAAT
TAATAGGACAGAAATGAAAATATATATTTACGGAAACAAATCATCAGGAA
AAAGCAAGCTTATAAATGTAATTTTGGGGAGTGACTTTAATGCACGTGAA
ATGGAGGAAACTGGGAAATGTATTGTGCAGTTTTGCAAGTCTCCAGACAG
AAATTATAAACTGATTTCTAATGGTTTCGAGATTTATTGTGGAGATTCTG
GCAAGGAGTTTGAAAGCAAATATTTTAGTGAAATTGCTGAAATCGGGATT
AATAAAATAGTTGAAGCTTTTATTCCTGTTGAGGAGGGCAATAAAATATT
AAAGAAAAATGTGAAATTGATTGACTCCCCCGGATCGAATAAAACGGATG
AAATGGCCGAATACTTCCGCAATTACGCAGCAGATGCTGATGTTTTTGTT
TTACTGTTTGTAGGTGACATTTCTGAAAAGGAAATGGCAGCCTCCTATGT
GAATGCTGAAGATGTGACAAAGCCGGACGTTTTCATATTGATGAGGAATT
CAGAGGAGAGTGGACAAGATACACAGGTCGCATTGAACAATCAACGTTCT
GTTTATGTTCAATGTTGCTCGCTTATCAAACAATTGGGGGGACTCGATAC
TAATAATATGGACAAAAGAATTTATTTCGTTTCATCAACAGAGCTATTCG
ATATTCGCATAAACAACAACAATACATGTCTGTCCGATGCAAATATCAAA
AAACGACATGAGGAATTTGAACTATTTGAAATGCAGCTTTCAGAACGCAT
TGAAAGGCCAAGGCCATACAAAATGCATTTCTACAGAAATGAAATGAAGA
CATTGAATGATGATTTGCAAAAAATATTTACTAAAATGGCAAAGAAAATT
GGAAACATTGACATCGAGGCCTCAGTGAGACCCTATGAGGACGGCAAAAT
GCTTTTAGAGAACTTCAAAACAACGATCTCGAAAGAATCCGAAAAGGTGA
AGTTAGAATGTAAAAAAAAAATCGAATGCAATGTAATAAAAATGTTGAAT
ACAACAAGTATGAAGGACAAGGAAGGAATACACAAACAAATTGCGGATCA
TCATTCACTTATTGACAAAGCAATAGATGAGTTACTGCACAATTTGTATT
CGGAGTATTCCTGGCTGATAAATAACCTGATAGGAAATGAGCAAGGTCAG
GAAATTGCAGTTGAACCTTTGGCACAATTCTATGAAATGGTTAAGGCAAT
GAATGCACAACAAGGTGAAATGGAACCGCAGTTTATATCATTTGTTCGCA
TGCAATCAGACCCCCCTGGATCTAGAGCAGAAATACGAAATAGTGCAGTG
GAAGTGCCGGTAAACTCAGACGATGGAAATGATGGCCAGAATGGGACAGG
AGCAAGACCTCAAGCTGGATGGGGCATTAAGGCTAGATTTTATAAAATTT
ATAACTCACCATTTGGCCTTTCTGTACGCAACAGTGCAAATTATATGATT
GGAAATACTAACAACAAATTCTCAGATCTGGATCAAAAGGTCCATAAAAA
TGATGCTGAAATTAATAATGAAGTTACAAGATGCATTTCTCGGATTGAAA
ATGCTTTCAATTTGAAAGTAGATGAATTAATAACAAAATTAAATGATAAA
ATTAATCTGCGTAAAGATTACAAAGAAATTTTGTCAATTCATTTTGAATA
ACAATTAAAACAATTTTATATTTTCAATTTTTATTGTTTATTGTGGGA
back to top

protein sequence of SMED30002421-orf-1

>SMED30002421-orf-1 ID=SMED30002421-orf-1|Name=SMED30002421-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=625bp
MSNFNRKISNKSNPQQIFDEMSIEIAKRSNLVTKLENCEKFGELYKEWKI
KENLAKYIDKFNEITRKWKIIEERINRTEMKIYIYGNKSSGKSKLINVIL
GSDFNAREMEETGKCIVQFCKSPDRNYKLISNGFEIYCGDSGKEFESKYF
SEIAEIGINKIVEAFIPVEEGNKILKKNVKLIDSPGSNKTDEMAEYFRNY
AADADVFVLLFVGDISEKEMAASYVNAEDVTKPDVFILMRNSEESGQDTQ
VALNNQRSVYVQCCSLIKQLGGLDTNNMDKRIYFVSSTELFDIRINNNNT
CLSDANIKKRHEEFELFEMQLSERIERPRPYKMHFYRNEMKTLNDDLQKI
FTKMAKKIGNIDIEASVRPYEDGKMLLENFKTTISKESEKVKLECKKKIE
CNVIKMLNTTSMKDKEGIHKQIADHHSLIDKAIDELLHNLYSEYSWLINN
LIGNEQGQEIAVEPLAQFYEMVKAMNAQQGEMEPQFISFVRMQSDPPGSR
AEIRNSAVEVPVNSDDGNDGQNGTGARPQAGWGIKARFYKIYNSPFGLSV
RNSANYMIGNTNNKFSDLDQKVHKNDAEINNEVTRCISRIENAFNLKVDE
LITKLNDKINLRKDYKEILSIHFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: cellular component
TermDefinition
GO:0005741mitochondrial outer membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0008053mitochondrial fusion