Delta-like protein

Overview
NameDelta-like protein
Smed IDSMED30002414
Length (bp)3432
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-like protein (SMED30002414) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-like protein (SMED30002414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-like protein (SMED30002414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-like protein (SMED30002414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30002414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30002414SMESG000022173.1 dd_Smed_v4_13823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30002414SMESG000022173.1 dd_Smed_v4_13823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30002414SMESG000022173.1 dd_Smed_v4_13823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30002414SMESG000022173.1 dd_Smed_v4_13823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30002414SMESG000022173.1 dd_Smed_v4_13823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL1 (delta like canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:2908])

HSP 1 Score: 295.819 bits (756), Expect = 7.974e-86
Identity = 173/525 (32.95%), Postives = 256/525 (48.76%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRER------WKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNI 1710
            S GVFE+ ++++     L  N+ C         C+  C  F  +CL  YQ +      C  G        + +++L D    D +     R      W   F++I++  H D    L T+    +++  +++  +     W     S+ +    L  S+R+ C ++Y+GE C   C+P  +  G + C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ GA CE     C  + C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C      G+ C+CP G+ G NCE   D CSS PC NG  C+D    +LC C  GFSG  C  N +DC    C NG  C D  N   C C  G+TGR C+  ++ C  + PC N   C +    Y C+C   + G   N + ++P +
Sbjct:   21 SSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCA--CRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRT--DLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENS--YSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCE-HAPCHNGATCHERGHRYVCECARGYGGP--NCQFLLPEL 523          

HSP 2 Score: 124.405 bits (311), Expect = 2.499e-28
Identity = 91/321 (28.35%), Postives = 133/321 (41.43%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C   W G +C   I L  C      C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G  CE+  DEC   PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ + PC N   C+D   +Y C+CQA +SG+ C+  +           C  +PC N G C        VN             ++C C PG+TG  C   +
Sbjct:  212 CNPGWKGPYCTEPICLPGCDEQHGFCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCS-SSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNV---------DDCASSPCANGGTCR-----DGVND------------FSCTCPPGYTGRNCSAPV 482          

HSP 3 Score: 70.4774 bits (171), Expect = 1.491e-11
Identity = 80/266 (30.08%), Postives = 106/266 (39.85%), Query Frame = 1
Query: 1177 KYICDCPESFYGDRCQ---------FNQTSCDD------NPCVGNSECIT-------DKTSGF-----KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC-QKLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +++CD  E +YG+ C          F   +C +      NP      C         D+  GF     +CKC  G+ GR C    DEC   P    G C  +P  + C C  G+ G  C  + N C     C NGA C +       C C  G+TG  C   I+EC  + PC N G C D   SY C C   + G+ C L  +          C   PC N G C  +               P GG Y+C+C  G++G  CEK I
Sbjct:  176 RFVCD--EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYC----DECIRYPGCLHGTC-QQP--WQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPS-PCKNGGSCTDLENSYSCTCPPGFYGKICELSAMT---------CADGPCFNGGRCSDS---------------PDGG-YSCRCPVGYSGFNCEKKI 406          
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL1 (delta like canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:2908])

HSP 1 Score: 295.819 bits (756), Expect = 7.974e-86
Identity = 173/525 (32.95%), Postives = 256/525 (48.76%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRER------WKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNI 1710
            S GVFE+ ++++     L  N+ C         C+  C  F  +CL  YQ +      C  G        + +++L D    D +     R      W   F++I++  H D    L T+    +++  +++  +     W     S+ +    L  S+R+ C ++Y+GE C   C+P  +  G + C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ GA CE     C  + C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C      G+ C+CP G+ G NCE   D CSS PC NG  C+D    +LC C  GFSG  C  N +DC    C NG  C D  N   C C  G+TGR C+  ++ C  + PC N   C +    Y C+C   + G   N + ++P +
Sbjct:   21 SSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCA--CRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRT--DLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENS--YSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCE-HAPCHNGATCHERGHRYVCECARGYGGP--NCQFLLPEL 523          

HSP 2 Score: 124.405 bits (311), Expect = 2.499e-28
Identity = 91/321 (28.35%), Postives = 133/321 (41.43%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C   W G +C   I L  C      C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G  CE+  DEC   PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ + PC N   C+D   +Y C+CQA +SG+ C+  +           C  +PC N G C        VN             ++C C PG+TG  C   +
Sbjct:  212 CNPGWKGPYCTEPICLPGCDEQHGFCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCS-SSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNV---------DDCASSPCANGGTCR-----DGVND------------FSCTCPPGYTGRNCSAPV 482          

HSP 3 Score: 70.4774 bits (171), Expect = 1.491e-11
Identity = 80/266 (30.08%), Postives = 106/266 (39.85%), Query Frame = 1
Query: 1177 KYICDCPESFYGDRCQ---------FNQTSCDD------NPCVGNSECIT-------DKTSGF-----KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC-QKLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +++CD  E +YG+ C          F   +C +      NP      C         D+  GF     +CKC  G+ GR C    DEC   P    G C  +P  + C C  G+ G  C  + N C     C NGA C +       C C  G+TG  C   I+EC  + PC N G C D   SY C C   + G+ C L  +          C   PC N G C  +               P GG Y+C+C  G++G  CEK I
Sbjct:  176 RFVCD--EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYC----DECIRYPGCLHGTC-QQP--WQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPS-PCKNGGSCTDLENSYSCTCPPGFYGKICELSAMT---------CADGPCFNGGRCSDS---------------PDGG-YSCRCPVGYSGFNCEKKI 406          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 286.189 bits (731), Expect = 1.783e-79
Identity = 188/598 (31.44%), Postives = 286/598 (47.83%), Query Frame = 1
Query:  181 GVFEIHIKKY-TLFPTLNLNKCCPT--RKNSTNSCSED-CNIFMEICLSIYQ-KNPHRYACDIGETYIKTDILGNYAL----------------NDSVKRDYSILV---RERWKRNFNIIVKIKHYDLITKKNV-VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKC-LINPCRNN-GICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            G FE+ +     +   L    CC    R      C  D C+ ++ +CL  YQ K      C  G  +  T +LG  +                      +D  ++V   +  W R+F +IV+   +D  T  N  +++   S    + P   W +   S    H +L +  R  C +NY+   C+K C+P  +  G Y C   G++ C  G+ G  C + VC + C  ++G C  P +CRC  GW G  CD+C+PYPGCVHGSC        + P  CNC+  WGG+ C+ DLNYC ++ + C N G C+N        QYRC C  G+ G +CEK EH C  N C NGG C  +   + + C CP  + G  C  +   C  NPC     C+ D+  GF+C CP  ++G  C++D ++C  + C +GG C D  +G+ CVCP GF G  C++ +++C    C +G  C D A+   C C  G++G +C  +++ C  + PC N   C +  G Y C C   + G+ C+    VP        C +I+ C ++ G  +  +  + V  P+       GG ++C C+ GFTG  C + I
Sbjct:   28 GYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYG--HGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVR--CDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSC--------VEPWQCNCETNWGGLLCDKDLNYCGSH-HPCTNGGTCIN----AEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSC--HEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCV-DQVDGFECICPEQWVGATCQLDVNDCRGQ-CQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPS-PCRNGARCYNLEGDYYCACPDDFGGKNCS----VPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENI 599          

HSP 2 Score: 147.517 bits (371), Expect = 3.912e-35
Identity = 142/546 (26.01%), Postives = 196/546 (35.90%), Query Frame = 1
Query:  595 HFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDR-----------ICHTGYSGSYCDKV--VCLK-KCINGA----CVGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKC--------------------KINVN----------------TNKYICDCPESFYGDRCQFNQTSC-------------DDNP----------CVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC--------------------------------------QKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLC 1875
            H   +  ++  C  N+ G  CDK      N  G ++  +NG              C  GYSG  C+K    C    C NG          +C C +GW+G +C    D+C   P    G+C       ++    C C ++W G  C +D+N C      C++ G C +  N      Y+C+C  GF G HCE     C  + C +GG C                    +++V+                   Y C CP+ F G  C   +  C             D  P          C  +  C++     F C C  GF G  C  + D+C  +PC NGG CID    F C CP G+ G+ C  N NDC                                         +C NG  C D  +   C C  GW G  C    N   +  PC+N G C+ +  S+ C C+  W G+ C       N N     C   PC N GIC+       VN     +F+       C+C PGF G  C
Sbjct:  284 HGSCVEPWQCNCETNWGGLLCDK----DLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTC-----VDQVDGFECICPEQWVGATCQLDVNDCRGQ---CQHGGTCKDLVN-----GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTH-----NTN----DCNPLPCYNGGICV-----DGVN-----WFR-------CECAPGFAGPDC 786          

HSP 3 Score: 143.28 bits (360), Expect = 8.173e-34
Identity = 121/407 (29.73%), Postives = 162/407 (39.80%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCL---KKCINGA----CVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKND-CQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEP 1923
            C  G+SG  C+  V L     C NGA      G   C C   + G +C   +P   C  G+CR  +           C    G        +       VC   G C++    +    + CIC  GF G +C +   +C+   C NGG C   V+   + C CP  + G+ C  N   C  +PC     C  D  + F C C  G+ G+ C   E +C +  C NGG C D    F C CP G+ G  C V KN  C    C+NG  C+       C C  GW GR C  N N+C    PC N GIC+D    +RC+C   ++G  C + I          +C  +PC     C+                  I G Y C C PG  G  C++VI    S      P
Sbjct:  486 CPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCS--VPREPCPGGACRVID----------GCGSDAGPGMPGTAAS------GVCGPHGRCVS----QPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDA--FRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCY-DLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNP-LPCYNGGICVDGVNWFRCECAPGFAGPDCRINI---------DECQSSPCAYGATCV----------------DEING-YRCSCPPGRAGPRCQEVIGFGRSCWSRGTP 840          

HSP 4 Score: 130.568 bits (327), Expect = 7.096e-30
Identity = 109/363 (30.03%), Postives = 153/363 (42.15%), Query Frame = 1
Query:  814 CRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ-TSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSY------------RCQCQATW--------SGQFCNLKIVVP-NINYLER---KCLINPCRNNGICILNSLPTSVNIPNNEYF 1815
            C C +G+TG  C    D C+  P C +G    DE         C C   W G  C+ + N C   P+ C + G C +  N      + C C  G+KG  C   E  C    C NGG C  + +T  + C CP  + G  C   + +SC  NPCV    C+    S F C C  G+ GR C  + ++C+  PC NGG+C+D  + F C C  GF+G  C++N ++CQ   C  GA C+D  N   C C  G  G  C + I      + C + G       S+            R  C   W        +GQ   L    P     LE+   +CL  PC   G C     P++  +P + + 
Sbjct:  584 CICDSGFTGTYCHENIDDCLGQP-CRNGGTCIDEVDA----FRCFCPSGWEGELCDTNPNDCL--PDPCHSRGRCYDLVN-----DFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDT--FRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGAS-FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVI---GFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL 928          

HSP 5 Score: 77.0258 bits (188), Expect = 1.693e-13
Identity = 72/247 (29.15%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE 1341
            +FR  C   + GE CD     + N+     C S G                    +C +   V    C C  GW G +C     QC  Y  C +G   +D          C C   W G  C +  N  S  PN C N G C+  G       + CIC+ G++G  C    ++C    C+NGG C   VN   + C+C   F G  C+ N   C  +PC   + C+ D+ +G++C CPPG  G  C+
Sbjct:  619 AFRCFCPSGWEGELCDT----NPNDCLPDPCHSRG--------------------RCYD--LVNDFYCACDDGWKGKTCHSREFQCDAYT-CSNGGTCYDSGDT----FRCACPPGWKGSTCAVAKNS-SCLPNPCVNGGTCVGSG-----ASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNW--FRCECAPGFAGPDCRINIDECQSSPCAYGATCV-DEINGYRCSCPPGRAGPRCQ 825          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 281.952 bits (720), Expect = 7.104e-78
Identity = 181/555 (32.61%), Postives = 261/555 (47.03%), Query Frame = 1
Query:  181 GVFEIHIKKY-TLFPTLNLNKCCPT--RKNSTNSCSED-CNIFMEICLSIYQ-KNPHRYACDIGETYIKTDILGNYAL----------------NDSVKRDYSILV---RERWKRNFNIIVKIKHYDLITKKNV-VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGIC 1764
            G FE+ +     +   L    CC    R      C  D C+ ++ +CL  YQ K      C  G  +  T +LG  +                      +D  ++V   +  W R+F +IV+   +D  T  N  +++   S    + P   W +   S    H +L +  R  C +NY+   C+K C+P  +  G Y C   G++ C  G+ G  C + VC + C  ++G C  P +CRC  GW G  CD+C+PYPGCVHGSC        + P  CNC+  WGG+ C+ DLNYC ++ + C N G C+N        QYRC C  G+ G +CEK EH C  N C NGG C  +   + + C CP  + G  C  +   C  NPC     C+ D+  GF+C CP  ++G  C++D +EC  KPCLN   C +   G+ C C  G+ G  C +N NDC+   C +G  C D  N   C C  G+ GR C    +ECA + PC + G+C D    + C C   +SG  C + + +         C  +PCRN   C
Sbjct:   28 GYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCSYG--HGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVR--CDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSC--------VEPWQCNCETNWGGLLCDKDLNYCGSH-HPCTNGGTCIN----AEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSC--HEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCV-DQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRG-QCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECA-SSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDL---------CEPSPCRNGARC 551          

HSP 2 Score: 142.895 bits (359), Expect = 1.064e-33
Identity = 121/407 (29.73%), Postives = 162/407 (39.80%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCL---KKCINGA----CVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKND-CQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEP 1923
            C  G+SG  C+  V L     C NGA      G   C C   + G +C   +P   C  G+CR  +           C    G        +       VC   G C++    +    + CIC  GF G +C +   +C+   C NGG C   V+   + C CP  + G+ C  N   C  +PC     C  D  + F C C  G+ G+ C   E +C +  C NGG C D    F C CP G+ G  C V KN  C    C+NG  C+       C C  GW GR C  N N+C    PC N GIC+D    +RC+C   ++G  C + I          +C  +PC     C+                  I G Y C C PG  G  C++VI    S      P
Sbjct:  524 CPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCS--VPREPCPGGACRVID----------GCGSDAGPGMPGTAAS------GVCGPHGRCVS----QPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDA--FRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCY-DLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNP-LPCYNGGICVDGVNWFRCECAPGFAGPDCRINI---------DECQSSPCAYGATCV----------------DEING-YRCSCPPGRAGPRCQEVIGFGRSCWSRGTP 878          

HSP 3 Score: 140.584 bits (353), Expect = 6.354e-33
Identity = 143/576 (24.83%), Postives = 197/576 (34.20%), Query Frame = 1
Query:  595 HFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDR-----------ICHTGYSGSYCDKV--VCLK-KCINGA----CVGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNP-----------------------------NVCENEGECLNFGNIKT-NQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKC--------------------KINVN----------------TNKYICDCPESFYGDRCQFNQTSC-------------DDNP----------CVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC--------------------------------------QKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLC 1875
            H   +  ++  C  N+ G  CDK      N  G ++  +NG              C  GYSG  C+K    C    C NG          +C C +GW+G +C    D+C   P    G+C       ++    C C ++W G  C +D N C   P                             NV +  G+C + G  K     Y+C+C  GF G HCE     C  + C +GG C                    +++V+                   Y C CP+ F G  C   +  C             D  P          C  +  C++     F C C  GF G  C  + D+C  +PC NGG CID    F C CP G+ G+ C  N NDC                                         +C NG  C D  +   C C  GW G  C    N   +  PC+N G C+ +  S+ C C+  W G+ C          +    C   PC N GIC+       VN     +F+       C+C PGF G  C
Sbjct:  284 HGSCVEPWQCNCETNWGGLLCDK----DLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTC-----VDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTC---------THNTNDCNPLPCYNGGICV-----DGVN-----WFR-------CECAPGFAGPDC 824          

HSP 4 Score: 130.183 bits (326), Expect = 7.943e-30
Identity = 109/364 (29.95%), Postives = 153/364 (42.03%), Query Frame = 1
Query:  811 QCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ-TSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSY------------RCQCQATW--------SGQFCNLKIVVP-NINYLER---KCLINPCRNNGICILNSLPTSVNIPNNEYF 1815
             C C +G+TG  C    D C+  P C +G    DE         C C   W G  C+ + N C   P+ C + G C +  N      + C C  G+KG  C   E  C    C NGG C  + +T  + C CP  + G  C   + +SC  NPCV    C+    S F C C  G+ GR C  + ++C+  PC NGG+C+D  + F C C  GF+G  C++N ++CQ   C  GA C+D  N   C C  G  G  C + I      + C + G       S+            R  C   W        +GQ   L    P     LE+   +CL  PC   G C     P++  +P + + 
Sbjct:  621 SCICDSGFTGTYCHENIDDCLGQP-CRNGGTCIDEVDA----FRCFCPSGWEGELCDTNPNDCL--PDPCHSRGRCYDLVN-----DFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDT--FRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGAS-FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVI---GFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL 966          

HSP 5 Score: 77.0258 bits (188), Expect = 1.895e-13
Identity = 72/247 (29.15%), Postives = 101/247 (40.89%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE 1341
            +FR  C   + GE CD     + N+     C S G                    +C +   V    C C  GW G +C     QC  Y  C +G   +D          C C   W G  C +  N  S  PN C N G C+  G       + CIC+ G++G  C    ++C    C+NGG C   VN   + C+C   F G  C+ N   C  +PC   + C+ D+ +G++C CPPG  G  C+
Sbjct:  657 AFRCFCPSGWEGELCDT----NPNDCLPDPCHSRG--------------------RCYD--LVNDFYCACDDGWKGKTCHSREFQCDAYT-CSNGGTCYDSGDT----FRCACPPGWKGSTCAVAKNS-SCLPNPCVNGGTCVGSG-----ASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNW--FRCECAPGFAGPDCRINIDECQSSPCAYGATCV-DEINGYRCSCPPGRAGPRCQ 863          
BLAST of Delta-like protein vs. Ensembl Human
Match: DLL4 (delta like canonical Notch ligand 4 [Source:HGNC Symbol;Acc:HGNC:2910])

HSP 1 Score: 266.544 bits (680), Expect = 7.133e-76
Identity = 163/500 (32.60%), Postives = 246/500 (49.20%), Query Frame = 1
Query:  262 STNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILG--NYALNDSV----KRDYSILVRERWKRNFNIIVKIKHY---DLITKK---NVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECIT-DKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCN--QNINECAINQPCLNNGICID--TPGSYRCQCQATWSGQFCNLKIVVP 1704
            S   C   C  F  +CL  +Q       C  G   + T +LG  ++A+ D      +    +     W   F++I++  H    DL  +    + +I  ++         +  + +Q ST     +L  S+R  CS NY+G+ C +LCK   +  G Y C  +G+  C  G++G YC + +CL  C   NG C  P +C C+ GW G  C++CIP+ GC HG+C          P  C C + WGG+FC+ DLNYC+++ + C+N   C N G     + Y C C+PG+ G  CE     C  N C NGG CK     + Y C CP  +YG  C+ +  SC D+PC     C   ++ + + C+CPP F G NCE   D C+S PC NGG C++R    +C C  GF+G  C+++ +DC +  C +G  C D  N + C C  G++GR C    +I+ CA + PC N   C    +  ++ C C   + G  C   + +P
Sbjct:   46 SGRPCEPGCRTFFRVCLKHFQAVVSPGPCTFGT--VSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLT---RLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCS--------TPWQCTCDEGWGGLFCDQDLNYCTHH-SPCKNGATCSNSGQ----RSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQ--EDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNRGPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACA-SSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLP 524          

HSP 2 Score: 83.9593 bits (206), Expect = 9.941e-16
Identity = 76/288 (26.39%), Postives = 120/288 (41.67%), Query Frame = 1
Query: 1030 NFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDK-TSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPS-GFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICID--TPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            +FG+          C PG+ G +C++         C +G   +    +    C C   + G  C         N C+ ++ C     ++ ++C C  G+ G  C+ D + C+   PC NG  C +     + C C  G++G  C++  ++C    C NG  C D+ +   C C  G+ G  C  +   CA + PC N G C +     +Y C+C   ++G  C  K+          +C  NPC N G C LN  P+ +                C+C PGFTG  CE
Sbjct:  194 HFGHYVCQPDGNLSCLPGWTGEYCQQP-------ICLSGCHEQNGYCSKPAECLCRPGWQGRLC---------NECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTLSCA-DSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKV---------DRCTSNPCANGGQC-LNRGPSRM----------------CRCRPGFTGTYCE 438          

HSP 3 Score: 66.6254 bits (161), Expect = 2.071e-10
Identity = 62/198 (31.31%), Postives = 79/198 (39.90%), Query Frame = 1
Query: 1300 KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +C C PG+ GR C    +EC        G C    + + C C  G+ G  C  + N C   S C NGA C +   R   C C  G+TG  C   ++EC  N PC N G C D    Y C C   + G  C    +          C  +PC N G C   +                G  Y C+C P FTG  CEK +
Sbjct:  238 ECLCRPGWQGRLC----NECIPHNGCRHGTCS---TPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSN-PCRNGGSCKDQEDGYHCLCPPGYYGLHCEHSTL---------SCADSPCFNGGSCRERNQ---------------GANYACECPPNFTGSNCEKKV 403          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 169.088 bits (427), Expect = 6.645e-42
Identity = 124/400 (31.00%), Postives = 178/400 (44.50%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVV--CLKK--CINGACVG---PNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPC--VGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C  G+ G  CDK +  C      +N  CV      +C C TG++G  C    + C   P CVHG C       +L    C C+  W G  C+ +++ C+ +P  C+N+ +C++  N      Y C C  G++G HC+ +  +C    C N   C  N+    Y CDC   F G  C+ N   C +N C  +G   C  D  + FKC C PG+ G  C++ +D+C+  PCLN   C+D    + CVC  G++G +C+ +   C    C N   C+       C C  G +G+ C    N C I QPC N G C D      C C A+++G+ C  K                 C N G C                 +  GG   C+C+PGFTG+ CE  I
Sbjct: 2157 CVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSP-CVHGLC-----IDKLYSRQCLCQPGWTGENCDQNIDECAASP--CQNDAKCIDEIN-----GYMCECADGYEGVHCQHLVDHCAKQPCHNNATC-TNMGAT-YHCDCTLGFDGVHCEMNIDECAENQCDKLGTESC-RDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRC-IGQPCHNGGECGDFGSHLECACPASFTGKGCEFK-----------NTGCKTCENGGKCA----------------EAAGGLQKCECSPGFTGERCETNI 2512          

HSP 2 Score: 167.933 bits (424), Expect = 1.371e-41
Identity = 112/336 (33.33%), Postives = 147/336 (43.75%), Query Frame = 1
Query: 1003 VCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCD-----------------------------------------DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +CEN  EC  F       + +C CKPG+ G  CE +E  C    C+NGGKC+  V T  Y C CP+ F G RCQF    C+                                         +NPC   + CI +K   FKC+C PG+ G NC+ + D+C+  PC     C+D  + + C CP GFSG RC + +N C    C++G  C+D+     C C  GWTG  C+QNI+ECA + PC N+  CID    Y C+C   + G  C          +L   C   PC NN  C                   +G  Y C C  GF G  CE  I
Sbjct: 2021 MCENNAECSVF-----MHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCE-QVGTT-YKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGL-CIDKLYSRQCLCQPGWTGENCDQNIDECAAS-PCQNDAKCIDEINGYMCECADGYEGVHC---------QHLVDHCAKQPCHNNATCT-----------------NMGATYHCDCTLGFDGVHCEMNI 2321          

HSP 3 Score: 167.162 bits (422), Expect = 2.173e-41
Identity = 114/374 (30.48%), Postives = 161/374 (43.05%), Query Frame = 1
Query:  727 CHTGYSGSYC---DKVVCLKKCINGACVG---PNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDC-------------------------------------ECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINY 1716
            C TG+SG  C   + +     C++G C+      QC CQ GWTG++CDQ I    C    C+ D     E+    C C   + G+ C   +++C+  P  C N   C N G       Y C C  GF G HCE     C  N+C   G        N + C C   + G RC   Q  C D+PC+ +++C+ D    +KC C  G+ G  CE D   C++KPC N G C+   + + CVCP G SG  C+   N C    C NG +C D  + ++C                                     EC+ G+TG  C  NI+EC+    C +   C+D   ++ C C    +G  C+  I   N NY
Sbjct: 2195 CPTGFSGKRCHIKENLCASSPCVHGLCIDKLYSRQCLCQPGWTGENCDQNIDE--CAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQP--CHNNATCTNMG-----ATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCV-DMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAH-CPSGATCVDQVNTHICVCPFNLTGVHCDKMI---NTNY 2554          

HSP 4 Score: 162.925 bits (411), Expect = 4.394e-40
Identity = 128/439 (29.16%), Postives = 172/439 (39.18%), Query Frame = 1
Query:  811 QCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN-KCFNGGKC---------------------------------KINVN----TNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQ---------------------------------------PCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            QC C+ G+ GD C    D C   P    G C    TT +     C C K + G  C  + + C  N   C N G C +   +K+     C+C+ GF G  CE++   C  N  C NG +C                                  +N       N Y C+CP  F G RC   +  C  +PCV +  CI DK    +C C PG+ G NC+ + DEC++ PC N   CID  +G++C C  G+ G  CQ   + C K  C N A C +      C+CT G+ G  C  NI+ECA NQ                                       PCLN+  C+D  G+Y+C C++ W+G  C               C   PCRNNG C+                  +   Y C C PG +G  CE  
Sbjct: 2036 QCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYK-----CTCPKMFNGARCQFESDEC--NGVKCPNGGVCHDLPGVKSTT---CLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCV-HGLCI-DKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQD---------NGSCAAKPCRNNGFCV-----------------SLVADYFCVCPPGVSGKNCESA 2436          

HSP 5 Score: 115.546 bits (288), Expect = 1.431e-25
Identity = 89/292 (30.48%), Postives = 123/292 (42.12%), Query Frame = 1
Query:  628 CSQNYHGEECDKLC-----KPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGAC--VGPNQCR---------CQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRC 1452
            C+  Y G  C  L      +P  N     N  +     C  G+ G +C+  + + +C    C  +G   CR         C+ G+TG  CD  +    C    C  D    ++     C CK  W G  C  D   C+  P  C N G C++         Y C+C PG  G +CE   + CI   C NGG+C      +   C CP SF G  C+F  T C    C    +C        KC+C PGF G  CE + DECS+  C +G  C+D+ +  +CVCP   +G  C
Sbjct: 2270 CADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCE--MNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCD--VKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKP--CRNNGFCVSL-----VADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGEC--GDFGSHLECACPASFTGKGCEFKNTGC--KTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHC 2546          

HSP 6 Score: 108.612 bits (270), Expect = 2.285e-23
Identity = 71/215 (33.02%), Postives = 98/215 (45.58%), Query Frame = 1
Query: 1240 CDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDR--ANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI-DTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLC 1875
            C    C  N+EC        +C C PG++G  CE+ ED CS++PC NGG C    + + C CP  F+G RCQ   ++C  + C NG  C D        C C TG+ G  C +  + C+ N PC N   CI +  G ++CQC   W G  C+  I           C  +PC  N  C        V++ N+         Y C+C  GF+G  C
Sbjct: 2017 CSAKMCENNAECSVFMHRA-QCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNI---------DDCADSPCALNATC--------VDLIND---------YKCECPTGFSGKRC 2204          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 157.147 bits (396), Expect = 2.000e-38
Identity = 119/364 (32.69%), Postives = 171/364 (46.98%), Query Frame = 1
Query:  811 QCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECT-TGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLK----IVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +C C  G++G+ C+Q      C H  C        +    C C+  + G FC   LN CS+N   C + G C    N        C C   ++GAHC+     C+   C N G C+ N + N + C+C + F G RC+  + SC    CV + ECI        C C  G+ G  C+   D C + PCLNG  C ++ +G+ C C VGF G  C++N ++C    C NGAKC D+ N  +C C  TG+ GR C  +INECA    C+ NG C +T G+Y+C C+  + G  C+++      + + N     C+   C N         P      N E  K     Y C C+ G+TG  C + I
Sbjct: 1314 ECNCMDGYSGELCEQ-RDVNECNHYDCNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSN--TCSSRGACSPVWN-----NTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTN-DENTFSCECQKFFMGTRCEI-EGSCLKAQCV-HGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCI-NGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVN---------PVVQIEKNREVAK-----YECACDRGYTGPTCSQRI 1651          

HSP 2 Score: 130.183 bits (326), Expect = 3.978e-30
Identity = 110/351 (31.34%), Postives = 157/351 (44.73%), Query Frame = 1
Query:  844 SCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTS-CDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI-DEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            S DQC  Y  C++G+   D   K      C C   + G  C  ++N C      C   G CL+        + +CIC  GF G HCE  +  C   +C NGGKC  N  + K +C C  S+ GD C   +T+ C D+PC    +C+    + F+C C  G+ G  CE  D +EC+   C N G C+   SG  C C +G++G  C+   N C   +C +   C    N   C C   W G  C   ++ C ++ PC N+G+C  +   ++ C+CQ  + G  C           +E  CL   C  +G CI  S  T                +TC CN G+ GD C+K I
Sbjct: 1173 STDQCGLYSTCLNGATCVDIWNKR----KCVCPAGFAGENCEDNVNDCKFVD--CGKHGYCLD-----GIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKN-RSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTC-LDFPCNNDGVCRTNDENTFSCECQKFFMGTRCE----------IEGSCLKAQCV-HGECIQLSPET----------------HTCSCNIGYEGDACDKKI 1482          

HSP 3 Score: 127.872 bits (320), Expect = 2.068e-29
Identity = 137/480 (28.54%), Postives = 190/480 (39.58%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLKKCINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCN---CKKKWGGMF-CNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQF-NQTSCDDNPCVGNSECITDKTS-------GF---------------------------------KCKCPPGFIGRNC-EIDEDECSSKPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQ------VNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQP------CLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSI-VMYSEPQITTEGF--LYKSRIA 1965
            C  G+SG  C    C   C++G CV    G   C+C  GW G  CD  +            D+T ++  P   +   C K   G + C  +   C+ +   C+N G C     +  N   +C C PGF G HCE  E  C  N C NG  C+ N+    Y C C + F G  C+  ++  C  + C  N +CI+  +        GF                                 +C+CP GF+G +C E+    C  +PCLNGG C+D     F C C   F+G  C       VN +DC+     NG KC+       C+C  G+ G  C   I+    + P      CLN G C +D  G   C C+  + G FC  K            C INPC+N G C                 +   G Y C C  GF G  CE V   ++ I  + + P  TT G     +S+I+
Sbjct:   46 CPKGFSGLLCQDN-CSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTD----------DDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATH--TCQNNGTC-----VAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCE-NLK-GSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCK-----NGGKCVFALAATTCQCPEGFNGSNCE--ISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPK----------SGCTINPCQNGGTC-----------------QDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKIS 471          

HSP 4 Score: 122.865 bits (307), Expect = 7.775e-28
Identity = 118/378 (31.22%), Postives = 155/378 (41.01%), Query Frame = 1
Query:  628 CSQNYHGEECDKLCKPSANERGFYNCSS--NGDRICHTGYSGSY--------CDKVVCLKKCINGACVGPN---QCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNI-DLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE-KVEHNCIINKCFNGGKC--KINVNTNKYICDCPESFYGDRC-QFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDED-ECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKN-----DCQKLSCMNGAKC-MDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            CS+ + G  CD L     ++     CS     D  C  G  GSY        C    C     NG CV  N   +C C  G+ GD C+       C    C+     + L     C C K + G +C I D   C+++   C N G+C     I T     C C PGF GA CE K E N  I  C N       +N  +    C+CP  F G  C +     CD  PC+    C+ D  + F C C P F G  C    D   +   C NGG C+   +   C CP GF+G  C+++ +      C  + C+NG  C +D      C C  G+ G  C    + C IN PC N G C D  G Y C C + + G  C
Sbjct:   80 CSEGWMGSLCDNL---VTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQN---NGTCVAENGNVKCACPPGFVGDHCE--TDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSD--YCHNNGQC-----ISTGSDLSCKCSPGFDGAFCELKAEVNECI--CENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNLFTCFCLPSFTGIYCGEPVDCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPK-SGCTIN-PCQNGGTCQDADGQYFCHCTSGFGGVHC 438          

HSP 5 Score: 103.605 bits (257), Expect = 5.322e-22
Identity = 70/222 (31.53%), Postives = 99/222 (44.59%), Query Frame = 1
Query: 1120 CIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFN-QTSCDDNPCV----GNSEC--------------ITDKTSGFKC--------KCPPGFIGRN-CEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVV 1701
            C  N C NGG C +N  T  + C+CP+ F G  CQ N    C    CV    G   C              +TD  +  KC        +C  G  G   C+ +E  C++  C N G C+       C CP GF GD C+ ++++C++  C NGA C +     +C+C  G++G+ C     +   +  C NNG CI T     C+C   + G FC LK  V
Sbjct:   22 CSRNTCLNGGTCTVNDETRMFQCECPKGFSGLLCQDNCSLHCLHGNCVKGTFGEETCQCSEGWMGSLCDNLVTDDDTAQKCSPQCGDDERCTKGADGSYICQSNEPSCATHTCQNNGTCVAENGNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEV 243          

HSP 6 Score: 102.449 bits (254), Expect = 1.318e-21
Identity = 101/356 (28.37%), Postives = 153/356 (42.98%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLK----KCINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLT-CNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQ--YRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCP-VGFSGDRCQVNKNDCQ-----------------KLSCMNG----------------------------AKCMDRANRID---------CECTTGWTGRMCNQNINECAIN 1596
            C  GYSG  C++    +     C  G CV    GP  C+C+ G+TG  C++ +    C   +C        +   T CNC   W G  C   ++ C + P  C N+G C      +TN +  + C C+  F G  CE +E +C+  +C +G +C I ++   + C C   + GD C      C   PC+  + C  +K +G+KC C  GF G +CEI+ DEC+ + C NG  C D+ + + CVC   GF G  C  + N+C                  K +C NG                             KC++   +I+         C C  G+TG  C+Q I E A++
Sbjct: 1317 CMDGYSGELCEQRDVNECNHYDCNRGHCVMTVSGP-ACQCEMGYTGRFCEKLLNQ--CSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFP--CNNDGVC------RTNDENTFSCECQKFFMGTRCE-IEGSCLKAQCVHG-EC-IQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANC-ENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESAMS 1657          

HSP 7 Score: 88.9669 bits (219), Expect = 1.810e-17
Identity = 99/376 (26.33%), Postives = 155/376 (41.22%), Query Frame = 1
Query:  604 LLVSFRYTCSQNYHGEECDKLCKPSANERGFYN---CSSNGDRI---CHTGYSGSYCDKVVCLKKCI-----------NGACVGPNQCRCQTGWTGDSCDQCIPYP----GCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE-----KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE-IDE------------------------DECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRID----CECTTGWTGRMC 1566
            L  S+   C + + G+ C+   K        +N   C S G  +   C  G+ G++C+    + +CI           NG      QC C +G+ G  C +    P     C++G    D+        TC C   + G++C   ++ C  N + C+N G+C+ F    T     C C  GF G++CE     +    C   +C NGG CK++     + C C E F G  C+  ++ C  NPC     C  D    + C C  GF G +CE +DE                         + S + C+N   C+D  SG +C+C  G+ G +C    + C K+SC +G  C    + ++    C C  G  G+ C
Sbjct:  181 LKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGT-SRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQN---LFTCFCLPSFTGIYCGEPVD-CLVNGSDCKNGGKCV-FALAATT----CQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPF-CVCEEGFDGPFCE-PKSGCTINPCQNGGTC-QDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQC 543          

HSP 8 Score: 87.8113 bits (216), Expect = 3.415e-17
Identity = 115/417 (27.58%), Postives = 172/417 (41.25%), Query Frame = 1
Query:  628 CSQNY--HGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI------NGACVGPNQ---CRCQTGWTGDSCD------QCI---PYPGC--VHGSCRFDETTKELLPLTCNCKKKWGGMFC-NIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHC-EKVEHNCIIN--KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQT-----SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ----------------------VNKNDCQKLSC---MNGAKCMDRANRIDCECTTGWTGRMCNQNINECA-----INQPC--LNNGICIDTPGSYRCQCQATWSGQFCNL 1689
            C +N+  +G +C+ L       +G Y C       C  G+SG YC+ +   K+C       NG C+       C+C  G+ G  C+      +CI   P   C  V+G+ R   TT+      C C   + G  C  +    C   P  C N G C++ G       + C C P F G +C E V+  C++N   C NGGKC   +      C CPE F G  C+ + +     +C D  C+    C  D      C C  GF G  CE  +  C+  PC NGG C D    + C C  GF G  C+                      ++     K+SC   +N + C+D  +   C C  G+ G+ C+Q  ++C+       Q C  +N+ + I    + +C C+    GQ C +
Sbjct:  167 CKENFCQNGADCENL-------KGSYECK------CLKGFSGKYCE-IQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEVNECICENPAHVCSLVNGTSR---TTQ------CECPSGFMGADCKELQARPCDREP--CLNGGHCVDDGQ----NLFTCFCLPSFTGIYCGEPVD--CLVNGSDCKNGGKCVFALAAT--TCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCE-PKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNI----TAQCGCEIGHFGQQCEM 545          

HSP 9 Score: 79.7221 bits (195), Expect = 1.041e-14
Identity = 57/188 (30.32%), Postives = 86/188 (45.74%), Query Frame = 1
Query: 1324 IGRNCEIDEDECS-SKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI-DTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            +G  C +  D+C     CLNG  C+D  +   CVCP GF+G+ C+ N NDC+ + C     C+D  +   C C  G+ G  C    +EC     C N G C+ +      CQC  +W G  CN+             C  +PC+N G C+  +         + +F+       C C  G++G+LCE+
Sbjct: 1167 VGTGC-MSTDQCGLYSTCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECE-GVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTT--------NCKDSPCQNFGQCMQKT---------DTFFE-------CNCMDGYSGELCEQ 1328          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 139.043 bits (349), Expect = 7.176e-33
Identity = 131/434 (30.18%), Postives = 179/434 (41.24%), Query Frame = 1
Query:  814 CRCQTGWTGDSCDQCIPYPGC-VHGSCRFDETTKELLPLTCNCK---------------KKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINK--CFNGGKCKINVNTNKYICDCPESFYGDRC---------QFNQTSC-----DDNPCVGNSEC----ITDKTSGFKCKCPPGFIGRNCEI--DEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR----------------------------------------IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            CRC  G+ G+ C+Q      C     C FD   K+    TC CK                 +GG  C     +C   P+VC N G+C+  GN     + +C C  GFKG  CE   + C  NK  C N   C   + T  YIC CP+ F    C         +F Q  C      D+P   +  C      DK S  KC+CPPG+ G  CE+   ED C+S PC +G +CI    GF C+C  G+SG  CQ  K++C    C  G+KC++  N                                          +C+C  G+ G +C Q+ NEC     CLNNG C++ PGS+RC C   + G++C+  + +         C    C N+G C+  S  + V                C+C  GF G  CEK
Sbjct:   49 CRCDEGFGGEYCEQQCDVSKCGADEKCVFD---KDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQ-GWCY--PSVCMNGGQCIGAGN-----RAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGT--YICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASS-KCQCPPGYHGSTCELLEKEDSCASNPCSHG-VCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNM---------CQDFHCENDGTCMHTSDHSPV----------------CQCKNGFIGKRCEK 442          

HSP 2 Score: 137.117 bits (344), Expect = 2.667e-32
Identity = 131/423 (30.97%), Postives = 179/423 (42.32%), Query Frame = 1
Query:  610 VSFRYTCSQNYHGEECDKL-----CKPSANERGFYNCSSNGDR-ICHTGYSGSYC---------DKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQ--CIPYPG-CVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQ------FNQTSCD-----------DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEID---------EDECSSKPCLNGGMCIDRPS--GFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYR-CQCQATWSGQFCNLKIVVPNINYLERKCLI 1737
             S +  C   YHG  C+ L     C  +    G     S G + IC  GYSGSYC         +K     KCING  V    C C    TG  C++  C   P  C HG+C  D    E     C C+  + G+ C  D N C +  N+C N G C+N         +RC C  GF G  C++  + C    C N G C ++ + +  +C C   F G RC+      F    CD              C    +C+    SGF C CPP F G  CE++         E+ C S PC+N   CID  +  G+ C+C  GF GD C+ +K+ C +  C NG  C        C+C  G+ G  C Q      +   C N G+CI+     R C+C   +SG  C  KI +    + E+  L+
Sbjct:  230 ASSKCQCPPGYHGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCING--VNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTC-IDSPLSEKA-FECQCEPGYEGILCEQDKNECLSE-NMCLNNGTCVNLPG-----SFRCDCARGFGGKWCDEPLNMCQDFHCENDGTC-MHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCL----SGF-CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKINL--TGFTEKDSLL 634          

HSP 3 Score: 127.487 bits (319), Expect = 2.327e-29
Identity = 108/343 (31.49%), Postives = 151/343 (44.02%), Query Frame = 1
Query:  931 CNCKKKWGGMFCNI--DLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGN-SECITDKTS--GFKCKCPPGFIGRNCEIDEDEC-SSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRID-CECTTGWTGRMCNQNINECAIN-------------------QPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            C C   + G  C +    + C++NP    + G C++F        ++CIC  G+ G++C++ + NC+ NKC  G KC   VN+  Y CDCP    G  C+  +  C   P + N   CI    S   F+C+C PG+ G  CE D++EC S   CLN G C++ P  F C C  GF G  C    N CQ   C N   CM  ++    C+C  G+ G+ C +   EC I                      C N G C+    S  C C   ++G  C +       +  E  CL +PC NN  CI             +    IG  Y C C  GF GD+CE+
Sbjct:  234 CQCPPGYHGSTCELLEKEDSCASNPC---SHGVCISFSG-----GFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNS--YFCDCPPERTGPYCE--KMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEK---ECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCL----SGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCI-------------DVDAHIG--YACICKQGFEGDICER 542          

HSP 4 Score: 101.679 bits (252), Expect = 2.163e-21
Identity = 102/315 (32.38%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  727 CHTGYSGSYC--DKVVCLKKCI---NGACV---GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET---TKELLPLTCNCKKKW-------------GGMFCNI--DLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHN---------CIINKCFNGGKCKINVNTN-KYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDED-ECSSKPCLNGGMCI-DRPSGFLCVCPVGFSGDRCQVNKN-------DCQKLSCMNGAKCMDRANRIDCE 1536
            C  GY G  C  DK  CL + +   NG CV   G  +C C  G+ G  CD+  P   C    C  D T   T +  P+ C CK  +             GG+ C++  ++  CS     C N G+CL+           C+C P F G  CE    N         C+ + C N   C I+V+ +  Y C C + F GD C+ ++  C +NPC     C   + S F C CPPGF G  CE ++   C    C NGG+CI +   G  C C  GFSG RC+   N       D    S     KC +RAN  +C+
Sbjct:  353 CEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDE--PLNMCQDFHCENDGTCMHTSDHSPV-CQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSG---------FCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATC-IDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRES-FSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCD 653          

HSP 5 Score: 89.7373 bits (221), Expect = 8.732e-18
Identity = 93/333 (27.93%), Postives = 131/333 (39.34%), Query Frame = 1
Query: 1003 VCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYIC---------------DCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS--KPCLNGGMCIDRPSGFLCVCPVGFSGDRC--------------------QVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCN--QNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            +C   G C       T   Y C C  GF G +CE+    C ++KC    KC  + +     C                CP  + GD C+  Q  C  + C+   +CI       KC CP GF G  CE+D +EC      C N   C++    ++CVCP GF    C                      +  D + + C NG  C D+A+   C+C  G+ G  C   +  + CA N PC ++G+CI   G ++C C   +SG +C            +  C+ N C     CI N +        N YF        C C P  TG  CEK+
Sbjct:   28 ICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYCEQ---QCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCK-TQGWCYPSVCMNGGQCIGAGNRA-KCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFC-DKASS-KCQCPPGYHGSTCELLEKEDSCASN-PC-SHGVCISFSGGFQCICDDGYSGSYCQEG---------KDNCVNNKCEAGSKCI-NGV--------NSYF--------CDCPPERTGPYCEKM 325          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 120.939 bits (302), Expect = 2.275e-27
Identity = 121/390 (31.03%), Postives = 165/390 (42.31%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVV---CLKKCINGA-CVGP---NQCRCQTGWTGDSCDQ---CIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQ------FNQTSCD-----------DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI--------DEDECSSKPCLNGGMCID-RPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPN-----INYL--ERKCLINPCRNNGIC 1764
            IC+ GY GSYC++ +      +C  G+ CV       C C  G +G  C++    +    C HG C  +    E     C C   + G FCN D N C      C N   C N      +  + C CKPG+ G +CE+    C    C N G C  + N    IC C + F G RC+      F    CD           +  C  +  CI    +GF C C P +IG  CEI        D   C   PC+N   CID + SG+ C CP+GF G  C+ +   C   +C NG  C      I C C  G++G  C     +     PC N G+C +T     C+CQ  ++G  C   +V+       I  L  +RKC+     +NGIC
Sbjct:  141 ICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNR--DEDKNFRCVCDSGYEGEFCNKDKNECLIE-ETCVNNSTCFNL-----HGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMP-ICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCI----NGF-CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLL-CTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTG---YCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRKCM--DLASNGIC 510          

HSP 2 Score: 119.783 bits (299), Expect = 5.241e-27
Identity = 121/430 (28.14%), Postives = 175/430 (40.70%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCL-------KKCINGACV---GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINK-CFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEID---------------EDECSSK--PCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKND--------CQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSS 1902
            C  GY G  C   +           C NG C    G  QC C  G+ G  C++ I +  C    C    T    +    C+C     G +C  +   C+   N+C N G C+   N   ++ +RC+C  G++G  C K ++ C+I + C N   C  N++ + + C C   + G  C+     C D  C  +  C  D      C C  GF G+ CEI+                  CS     C N G CI+   GF CVC   + GDRC++N+ D        C+   C+N A C+D  N    C C  G+ G  C Q++        C N G C    G  RC C   +SG +C +K          + C  +PC+N G+C            N  Y         C+C  G+TG  CE+V++   S
Sbjct:  101 CEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYPFYGGFQCICNNGYGGSYCEEGIDH--CAQNECAEGSTCVNSVYNYYCDCPIGKSGRYC--ERTECALMGNIC-NHGRCIP--NRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTC-FNLHGD-FTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCIN---GF-CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL--LCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKD--------RQLCSRHPCKNGGVC-----------KNTGY---------CECQYGYTGPTCEEVLVIEKS 487          

HSP 3 Score: 92.4337 bits (228), Expect = 1.234e-18
Identity = 88/303 (29.04%), Postives = 126/303 (41.58%), Query Frame = 1
Query: 1003 VCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI----DEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI---DTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINP-CRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
             C   G+C N   I+T   Y C CK GF GA CE+    C ++ C  G KC  +V      C C +             C+D          T  T   +  C  G+ G +C+       + C S PC N G+C     GF C+C  G+ G  C+   + C +  C  G+ C++      C+C  G +GR C +   ECA+     N+G CI   D   ++RC C + + G+FCN           + +CLI   C NN  C                   + G +TC C PG+ G  CE+ I
Sbjct:   28 ACSVNGKCYNGKLIET---YWCRCKKGFGGAFCER---ECDLD-CKRGEKCIYDVYGENPTCICQD-------------CEDE---------TPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPC-NNGLCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERT--ECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKD---------KNECLIEETCVNNSTCF-----------------NLHGDFTCTCKPGYAGKYCEEAI 272          

HSP 4 Score: 73.1738 bits (178), Expect = 1.066e-12
Identity = 88/330 (26.67%), Postives = 128/330 (38.79%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDK---LCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQ---CRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLN--YCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVE--------HNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSG-FKCKCPPGFIGRNCEI-DEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ-----------VNKNDCQKLSCMNGA 1500
            F L   F  TC   Y G+ C++   +CK        Y C ++G           YC                 NQ   C C+ G+TG  C+                            C   +GG+ C++ L   +CS +   C N+G C+N           C+C+P + G  CE            +C  N C N   C I++  + Y C CP  FYG  C+     C    C     C  +  +G  +C CP GF G  CEI D   CS  PC NGG+C  + +G+ C C  G++G  C+           V ++ C++  CM+ A
Sbjct:  249 FNLHGDFTCTCKPGYAGKYCEEAIDMCKD-------YVCQNDG-----------YCAH-------------DSNQMPICYCEQGFTGQRCE--------------------------IECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCING---------FCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATC-IDLKNSGYSCHCPLGFYGLNCE-QHLLCTPTTCANGGTC--EGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVC--KNTGY-CECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRKCMDLA 505          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: apx-1 (Anterior pharynx in excess protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41990])

HSP 1 Score: 117.472 bits (293), Expect = 4.095e-27
Identity = 90/283 (31.80%), Postives = 128/283 (45.23%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCIN-GACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINK-CFNGGKCKINVNTNK-YICDCPESFYGDRCQ--FNQTSCD-DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI-DEDECSSKPCLNGGMCIDRPSGFLCVC 1425
            F + V  R  CS NYHG+ C++ C   AN +  + CS++G R C  G+SG  C   +C   C N G CV PNQC C  G+ G  C+QC+P  GCV+G C  +ET                              PN C+                    C+ GF G  C+     C + K C NGG C I+ +++  Y C CP  F G +C+   ++  C  ++ C     CI+   +  +CKC  GF G+ CEI +  +CS+  C  G  C  + SG   +C
Sbjct:  122 FNVTVQLRNLCSSNYHGKRCNRYCI--ANAKLHWECSTHGVRRCSAGWSGEDCSNPICAGGCSNRGRCVAPNQCSCADGFNGTRCEQCLPRAGCVNGDC-VNET------------------------------PNTCK--------------------CRDGFIGDRCDIDIKICSLEKPCANGGICSIDSSSSTGYKCHCPFEFVGSQCKTPLSKVRCSAEHVCKNGGACISMDDTNIQCKCRRGFSGKFCEIGNHGDCSAMRCSAGETC--QISGDFAIC 349          

HSP 2 Score: 57.3806 bits (137), Expect = 5.161e-8
Identity = 64/233 (27.47%), Postives = 102/233 (43.78%), Query Frame = 1
Query: 1192 CPESFYGDRCQFNQTSCDDNPCVGNSECITD-KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC-IDTPGS--YRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            C  +++G RC        +  C+ N++   +  T G + +C  G+ G +C    +   +  C N G C+   +   C C  GF+G RC+       +  C+NG    +  N   C+C  G+ G  C+ +I  C++ +PC N GIC ID+  S  Y+C C   + G  C   +         R    + C+N G CI      S++  N +          CKC  GF+G  CE
Sbjct:  132 CSSNYHGKRC--------NRYCIANAKLHWECSTHGVR-RCSAGWSGEDCS---NPICAGGCSNRGRCV---APNQCSCADGFNGTRCE---QCLPRAGCVNGDCVNETPN--TCKCRDGFIGDRCDIDIKICSLEKPCANGGICSIDSSSSTGYKCHCPFEFVGSQCKTPL------SKVRCSAEHVCKNGGACI------SMDDTNIQ----------CKCRRGFSGKFCE 322          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083739)

HSP 1 Score: 282.722 bits (722), Expect = 1.522e-80
Identity = 194/592 (32.77%), Postives = 282/592 (47.64%), Query Frame = 1
Query:  175 SKGVFEIHIKKYT-LFPTLNLNKCCPTRKN-STNSCSEDCNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILGNYALNDSVKRDYS---------ILVRERWKRNFNIIVKIKH---YDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNC--IINKCFNGGKCKINVNT-NKYICDCPESFYGDRCQFNQTSCDDNPCVGN-----SECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            S G FE+ +K ++      N  +CC    + +T  C   C     +CL  YQ      + C  G+  + T ILG  ++N +  + +                W   F++IV+  H        + N +++     +  ++ SS W T +  +   +  L   FR TC  NY+G  C K C+P  +  G   CS  G+ IC TG+ G YC    C K C +G C  PNQC CQ GW G  C++C+  P C+HG+C          P TC C + WGG++CN DLNYC+N+   C+N G C N G       Y C C PG+ G  CE   ++C   +N C NGG C    +T   Y C C   + G  C+    +C D PC           +  K  G++C+CP G+ G NC++  D CS  PC+NGG C  +PSG  C+CP GFSG RC+ N +DC    C NG  C+D  N+  C+C  G+ G  C+  ++ C I +PC N G C++    Y+C C+A ++G+ C++ I          +C   PC N G C+       VN             + C C  GF G  C++
Sbjct:   22 SSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATIDTTSQCTYGD--VITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNK--SESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN--------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFNTG----EGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSC--QPSG-KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLI-RPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDI---------DECSSGPCHNGGTCM-----NRVN------------SFECVCANGFRGKQCDE 566          

HSP 2 Score: 119.013 bits (297), Expect = 6.745e-27
Identity = 98/299 (32.78%), Postives = 133/299 (44.48%), Query Frame = 1
Query:  688 RGFYNCSSNGDRICHTGYSGSYCDKVVC-----LKKCINGA-CVG-PN-----QCRCQTGWTGDSCDQ----CIPYPGCVHGSCR--FDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMN-GAKCMDRANRI 1527
             G Y C       C  GYSG  C+  +      +  C NG  C+  P+     +C C  GW+G  C++    C   P C  G CR        +     C C   + G  C++ L+ CS  PN C N G C   G        +CIC  GF G  CE    +C+ ++C NGG C   VN  +Y C C   F+G  C      C   PC     C+ +  + ++C C  GF G++C +D DECSS PC NGG C++R + F CVC  GF G +C     D         GA    RA+ +
Sbjct:  312 EGLYTCK------CAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCS--PNPCINGGSCQPSG--------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVN--QYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCL-NLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGL 590          

HSP 3 Score: 65.4698 bits (158), Expect = 2.532e-10
Identity = 63/224 (28.12%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 1309 CPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ--VNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA------NSSIVMYSEPQITTEGFLYK 1953
            C  G+ G  C I +    +K C +G    D+P+   CVC +G+ G  C   V + +C   +C     C+         C  GW G  CNQ++N C  ++PC N G C +T  G Y C+C   +SG  C  +I   + +       +NPC+N G CI            +E     G  Y C C  G++G +CE+ ++       +  I     P + ++G  Y+
Sbjct:  217 CLTGWQGDYCHIPK---CAKGCEHGH--CDKPN--QCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCI---------CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDAD-------VNPCQNGGTCI------------DEPHTKTG--YKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQ 403          

HSP 4 Score: 57.3806 bits (137), Expect = 7.703e-8
Identity = 52/158 (32.91%), Postives = 71/158 (44.94%), Query Frame = 1
Query: 1420 VCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA 1893
            +C  G+ GD C + K  C K  C +G    D+ N+  C C  GW G +CN    EC +   C++ G C + P  + C C   W G +CN      ++NY        PC+N G C                F    G YTCKC PG++GD CE  I +
Sbjct:  216 ICLTGWQGDYCHIPK--CAK-GCEHGH--CDKPNQ--CVCQLGWKGALCN----ECVLEPNCIH-GTC-NKP--WTCICNEGWGGLYCN-----QDLNYCTNH---RPCKNGGTC----------------FNTGEGLYTCKCAPGYSGDDCENEIYS 334          

HSP 5 Score: 52.7582 bits (125), Expect = 2.290e-6
Identity = 52/186 (27.96%), Postives = 84/186 (45.16%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKL---CKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV--CL-KKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII 1128
             ++  C   Y G  CD     C P+    G  +C  +G  IC  G+SG+ C+  +  CL  +C NG      V   +C+C  G+ G  C    D C+  P    G+C       +     C C+  + G  C++D++ CS+ P  C N G C+N  N      + C+C  GF+G  C++  ++ + 
Sbjct:  401 GYQCECPIGYSGPNCDLQLDNCSPNPCINGG-SCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQ-----CTCRAGFTGKDCSVDIDECSSGP--CHNGGTCMNRVN-----SFECVCANGFRGKQCDEESYDSVT 573          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083740)

HSP 1 Score: 282.722 bits (722), Expect = 1.522e-80
Identity = 194/592 (32.77%), Postives = 282/592 (47.64%), Query Frame = 1
Query:  175 SKGVFEIHIKKYT-LFPTLNLNKCCPTRKN-STNSCSEDCNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILGNYALNDSVKRDYS---------ILVRERWKRNFNIIVKIKH---YDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNC--IINKCFNGGKCKINVNT-NKYICDCPESFYGDRCQFNQTSCDDNPCVGN-----SECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            S G FE+ +K ++      N  +CC    + +T  C   C     +CL  YQ      + C  G+  + T ILG  ++N +  + +                W   F++IV+  H        + N +++     +  ++ SS W T +  +   +  L   FR TC  NY+G  C K C+P  +  G   CS  G+ IC TG+ G YC    C K C +G C  PNQC CQ GW G  C++C+  P C+HG+C          P TC C + WGG++CN DLNYC+N+   C+N G C N G       Y C C PG+ G  CE   ++C   +N C NGG C    +T   Y C C   + G  C+    +C D PC           +  K  G++C+CP G+ G NC++  D CS  PC+NGG C  +PSG  C+CP GFSG RC+ N +DC    C NG  C+D  N+  C+C  G+ G  C+  ++ C I +PC N G C++    Y+C C+A ++G+ C++ I          +C   PC N G C+       VN             + C C  GF G  C++
Sbjct:   22 SSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATIDTTSQCTYGD--VITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNK--SESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN--------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFNTG----EGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSC--QPSG-KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLI-RPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDI---------DECSSGPCHNGGTCM-----NRVN------------SFECVCANGFRGKQCDE 566          

HSP 2 Score: 119.013 bits (297), Expect = 6.745e-27
Identity = 98/299 (32.78%), Postives = 133/299 (44.48%), Query Frame = 1
Query:  688 RGFYNCSSNGDRICHTGYSGSYCDKVVC-----LKKCINGA-CVG-PN-----QCRCQTGWTGDSCDQ----CIPYPGCVHGSCR--FDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMN-GAKCMDRANRI 1527
             G Y C       C  GYSG  C+  +      +  C NG  C+  P+     +C C  GW+G  C++    C   P C  G CR        +     C C   + G  C++ L+ CS  PN C N G C   G        +CIC  GF G  CE    +C+ ++C NGG C   VN  +Y C C   F+G  C      C   PC     C+ +  + ++C C  GF G++C +D DECSS PC NGG C++R + F CVC  GF G +C     D         GA    RA+ +
Sbjct:  312 EGLYTCK------CAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCS--PNPCINGGSCQPSG--------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVN--QYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCL-NLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGL 590          

HSP 3 Score: 65.4698 bits (158), Expect = 2.532e-10
Identity = 63/224 (28.12%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 1309 CPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ--VNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA------NSSIVMYSEPQITTEGFLYK 1953
            C  G+ G  C I +    +K C +G    D+P+   CVC +G+ G  C   V + +C   +C     C+         C  GW G  CNQ++N C  ++PC N G C +T  G Y C+C   +SG  C  +I   + +       +NPC+N G CI            +E     G  Y C C  G++G +CE+ ++       +  I     P + ++G  Y+
Sbjct:  217 CLTGWQGDYCHIPK---CAKGCEHGH--CDKPN--QCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCI---------CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDAD-------VNPCQNGGTCI------------DEPHTKTG--YKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQ 403          

HSP 4 Score: 57.3806 bits (137), Expect = 7.703e-8
Identity = 52/158 (32.91%), Postives = 71/158 (44.94%), Query Frame = 1
Query: 1420 VCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA 1893
            +C  G+ GD C + K  C K  C +G    D+ N+  C C  GW G +CN    EC +   C++ G C + P  + C C   W G +CN      ++NY        PC+N G C                F    G YTCKC PG++GD CE  I +
Sbjct:  216 ICLTGWQGDYCHIPK--CAK-GCEHGH--CDKPNQ--CVCQLGWKGALCN----ECVLEPNCIH-GTC-NKP--WTCICNEGWGGLYCN-----QDLNYCTNH---RPCKNGGTC----------------FNTGEGLYTCKCAPGYSGDDCENEIYS 334          

HSP 5 Score: 52.7582 bits (125), Expect = 2.290e-6
Identity = 52/186 (27.96%), Postives = 84/186 (45.16%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKL---CKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV--CL-KKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII 1128
             ++  C   Y G  CD     C P+    G  +C  +G  IC  G+SG+ C+  +  CL  +C NG      V   +C+C  G+ G  C    D C+  P    G+C       +     C C+  + G  C++D++ CS+ P  C N G C+N  N      + C+C  GF+G  C++  ++ + 
Sbjct:  401 GYQCECPIGYSGPNCDLQLDNCSPNPCINGG-SCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQ-----CTCRAGFTGKDCSVDIDECSSGP--CHNGGTCMNRVN-----SFECVCANGFRGKQCDEESYDSVT 573          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0304658)

HSP 1 Score: 282.722 bits (722), Expect = 1.522e-80
Identity = 194/592 (32.77%), Postives = 282/592 (47.64%), Query Frame = 1
Query:  175 SKGVFEIHIKKYT-LFPTLNLNKCCPTRKN-STNSCSEDCNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILGNYALNDSVKRDYS---------ILVRERWKRNFNIIVKIKH---YDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNC--IINKCFNGGKCKINVNT-NKYICDCPESFYGDRCQFNQTSCDDNPCVGN-----SECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            S G FE+ +K ++      N  +CC    + +T  C   C     +CL  YQ      + C  G+  + T ILG  ++N +  + +                W   F++IV+  H        + N +++     +  ++ SS W T +  +   +  L   FR TC  NY+G  C K C+P  +  G   CS  G+ IC TG+ G YC    C K C +G C  PNQC CQ GW G  C++C+  P C+HG+C          P TC C + WGG++CN DLNYC+N+   C+N G C N G       Y C C PG+ G  CE   ++C   +N C NGG C    +T   Y C C   + G  C+    +C D PC           +  K  G++C+CP G+ G NC++  D CS  PC+NGG C  +PSG  C+CP GFSG RC+ N +DC    C NG  C+D  N+  C+C  G+ G  C+  ++ C I +PC N G C++    Y+C C+A ++G+ C++ I          +C   PC N G C+       VN             + C C  GF G  C++
Sbjct:   22 SSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATIDTTSQCTYGD--VITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVSSEWKTNK--SESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCN--------KPWTCICNEGWGGLYCNQDLNYCTNH-RPCKNGGTCFNTG----EGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSC--QPSG-KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLI-RPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDI---------DECSSGPCHNGGTCM-----NRVN------------SFECVCANGFRGKQCDE 566          

HSP 2 Score: 119.013 bits (297), Expect = 6.745e-27
Identity = 98/299 (32.78%), Postives = 133/299 (44.48%), Query Frame = 1
Query:  688 RGFYNCSSNGDRICHTGYSGSYCDKVVC-----LKKCINGA-CVG-PN-----QCRCQTGWTGDSCDQ----CIPYPGCVHGSCR--FDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMN-GAKCMDRANRI 1527
             G Y C       C  GYSG  C+  +      +  C NG  C+  P+     +C C  GW+G  C++    C   P C  G CR        +     C C   + G  C++ L+ CS  PN C N G C   G        +CIC  GF G  CE    +C+ ++C NGG C   VN  +Y C C   F+G  C      C   PC     C+ +  + ++C C  GF G++C +D DECSS PC NGG C++R + F CVC  GF G +C     D         GA    RA+ +
Sbjct:  312 EGLYTCK------CAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKP-CHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCS--PNPCINGGSCQPSG--------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVN--QYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCL-NLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGL 590          

HSP 3 Score: 65.4698 bits (158), Expect = 2.532e-10
Identity = 63/224 (28.12%), Postives = 99/224 (44.20%), Query Frame = 1
Query: 1309 CPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ--VNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA------NSSIVMYSEPQITTEGFLYK 1953
            C  G+ G  C I +    +K C +G    D+P+   CVC +G+ G  C   V + +C   +C     C+         C  GW G  CNQ++N C  ++PC N G C +T  G Y C+C   +SG  C  +I   + +       +NPC+N G CI            +E     G  Y C C  G++G +CE+ ++       +  I     P + ++G  Y+
Sbjct:  217 CLTGWQGDYCHIPK---CAKGCEHGH--CDKPN--QCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCI---------CNEGWGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDAD-------VNPCQNGGTCI------------DEPHTKTG--YKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQ 403          

HSP 4 Score: 57.3806 bits (137), Expect = 7.703e-8
Identity = 52/158 (32.91%), Postives = 71/158 (44.94%), Query Frame = 1
Query: 1420 VCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA 1893
            +C  G+ GD C + K  C K  C +G    D+ N+  C C  GW G +CN    EC +   C++ G C + P  + C C   W G +CN      ++NY        PC+N G C                F    G YTCKC PG++GD CE  I +
Sbjct:  216 ICLTGWQGDYCHIPK--CAK-GCEHGH--CDKPNQ--CVCQLGWKGALCN----ECVLEPNCIH-GTC-NKP--WTCICNEGWGGLYCN-----QDLNYCTNH---RPCKNGGTC----------------FNTGEGLYTCKCAPGYSGDDCENEIYS 334          

HSP 5 Score: 52.7582 bits (125), Expect = 2.290e-6
Identity = 52/186 (27.96%), Postives = 84/186 (45.16%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKL---CKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV--CL-KKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII 1128
             ++  C   Y G  CD     C P+    G  +C  +G  IC  G+SG+ C+  +  CL  +C NG      V   +C+C  G+ G  C    D C+  P    G+C       +     C C+  + G  C++D++ CS+ P  C N G C+N  N      + C+C  GF+G  C++  ++ + 
Sbjct:  401 GYQCECPIGYSGPNCDLQLDNCSPNPCINGG-SCQPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQ-----CTCRAGFTGKDCSVDIDECSSGP--CHNGGTCMNRVN-----SFECVCANGFRGKQCDEESYDSVT 573          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Ser (gene:FBgn0004197 transcript:FBtr0344121)

HSP 1 Score: 221.861 bits (564), Expect = 1.529e-58
Identity = 177/648 (27.31%), Postives = 266/648 (41.05%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCC-----PTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETY--IKTDILG--NYALNDSVKRDYSILVRERWKRNFNIIVK-IKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYG----------------------DRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQK-----------------------LS---------------------CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            + G FE+ I + +   +  LN  C       R   T  CS  C     +CL  YQ      +   G ++    T ILG  ++ L+D       +    RW ++F +I++ +  Y+        ++  +S    + PS  W  K L     + ++    R  C+  Y+   C   C+P  ++ G Y C S G ++C  G+ G  C++ +C   C  ++G C  P +C C+ GW G  C++C+ YPGC HGSC             C C   WGG+ C+ DLN+C  +   C++ G C N    K    YRC C  G  G  CE VEH C    C NGG C +   +N+       + +G                      +    N +S      +G+ +        F C C  G+ G  CEI+ DEC+  PC +GG CID   GF C CP  + GD CQV+ N+C+                        LS                     C+N  +C ++     C C  GW G  C +N+++C + Q C N   CID    YRC C + + G+ C   I          +C  +PCRN G C+                  + G + C C  G++G LCE+ 
Sbjct:   82 AAGNFELEILEISNTNSHLLNGYCCGMPAELRATKTIGCSP-CTTAFRLCLKEYQTTEQGASISTGCSFGNATTKILGGSSFVLSDPGVGAIVLPFTFRWTKSFTLILQALDMYNTSYPDAERLIEETSYSGVILPSPEW--KTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHGSCNGSA-------WKCVCDTNWGGILCDQDLNFCGTH-EPCKHGGTCENTAPDK----YRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKT-SNRTQAQVYRTSHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGSSSPGLVSLGSLQLQQQLAPDFTCDCAAGWTGPTCEINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDC-VGQ-CRNGATCIDLVNDYRCACASGFKGRDCETDI---------DECATSPCRNGGECV-----------------DMVGKFNCICPLGYSGSLCEEA 685          

HSP 2 Score: 152.91 bits (385), Expect = 5.247e-37
Identity = 139/497 (27.97%), Postives = 195/497 (39.24%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGE-------ECDKLCKPSANERGFYNCSSN---GDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCR---------CQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNK-YICDCPESFYGDRCQF-----NQTSCDDN---------------------------------PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCM----DRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
              L+  FR  C   +HG+       EC+               ++    G  +  T    +    V      I G C+   +CR         C+ GW G +C    D C+       G CR   T  +L+    C C   + G  C  D++ C+ +P  C N GEC++        ++ CIC  G+ G+ CE+ + NC  + C  G  C   +NT + Y C CP    G  C+      +Q  C++                                  PC G+  C       F CKC  G  G  CE + +ECS  PC NGG+C+D    F C C  G++G RC      C    C NG  CM    D+A +  C C  GWTG  C + I++C   QPC N G C    G +RC C   +SG  C +     N+N    +C   PC+    CI                  IGG Y+C C PG  G  CE ++
Sbjct:  506 IDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAI-GPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCV-------GQCRNGATCIDLVNDYRCACASGFKGRDCETDIDECATSP--CRNGGECVDMVG-----KFNCICPLGYSGSLCEEAKENCTPSPCLEG-HC---LNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGTF-CKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCSERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCR-GQPCHNGGTCESGAGWFRCVCAQGFSGPDCRI-----NVN----ECSPQPCQGGATCI----------------DGIGG-YSCICPPGRHGLRCEILL 955          

HSP 3 Score: 138.272 bits (347), Expect = 1.501e-32
Identity = 115/434 (26.50%), Postives = 172/434 (39.63%), Query Frame = 1
Query:  814 CRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLP-LTCNCKKKWGGMFCNIDLNYCS--NNPNVCENE----------------------------------GECLNFGNIKTNQ-QYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNG-----------------------AKCMDRANRIDC---------------ECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C C  GWTG +C+  I    C  G C    T  +L+    C C  +W G  C +D+N C   ++  +  N                                   G C+N    +     + CICK G+ G  C +   +C+  +C NG  C I++  N Y C C   F G  C+ +   C  +PC    EC+ D    F C CP G+ G  CE  ++ C+  PCL G  C++ P G+ C CP   +G  C+  +  C +  C  G                        + M + + + C               +C  G TG  C  N+NEC+ N PC N GIC+D  G + C+C + W+G+ C+ +            C    C+N G C+  + P     P+            C+C PG+TG  C + I
Sbjct:  476 CDCAAGWTGPTCE--INIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCV-GQCRNGATC-IDL-VNDYRCACASGFKGRDCETDIDECATSPCRNGGECV-DMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEG-HCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGTFCKCHVGHTGTFCEHNLNECSPN-PCRNGGICLDGDGDFTCECMSGWTGKRCSERAT---------GCYAGQCQNGGTCMPGA-PDKALQPH------------CRCAPGWTGLFCAEAI 879          

HSP 4 Score: 99.7525 bits (247), Expect = 1.060e-20
Identity = 96/362 (26.52%), Postives = 131/362 (36.19%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKLCKPSANER-----------GFYNCSSNGDRICHTGYSGSYCDKV---VCLKKCINGACVGPNQ---CRCQTGWTGDSCDQCIPY-------PGCV-----------------------------------HGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYI--CDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGA 1500
              L+  +R  C+  + G +C+      A              G +NC      IC  GYSGS C++         C+ G C+   +   C C     G  C+Q  P         GC                                    HGSC   +     +   C C     G FC  +LN CS  PN C N G CL+      +  + C C  G+ G  C +    C   +C NGG C            C C   + G  C      C   PC     C       F+C C  GF G +C I+ +ECS +PC  G  CID   G+ C+CP G  G RC++  +D  K +C N +
Sbjct:  625 IDLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNC------ICPLGYSGSLCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSD-----VGTFCKCHVGHTGTFCEHNLNECS--PNPCRNGGICLD-----GDGDFTCECMSGWTGKRCSERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTC-ESGAGWFRCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEILLSD-PKSACQNAS 966          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Ser (gene:FBgn0004197 transcript:FBtr0085128)

HSP 1 Score: 221.861 bits (564), Expect = 1.529e-58
Identity = 177/648 (27.31%), Postives = 266/648 (41.05%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCC-----PTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETY--IKTDILG--NYALNDSVKRDYSILVRERWKRNFNIIVK-IKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYG----------------------DRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQK-----------------------LS---------------------CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            + G FE+ I + +   +  LN  C       R   T  CS  C     +CL  YQ      +   G ++    T ILG  ++ L+D       +    RW ++F +I++ +  Y+        ++  +S    + PS  W  K L     + ++    R  C+  Y+   C   C+P  ++ G Y C S G ++C  G+ G  C++ +C   C  ++G C  P +C C+ GW G  C++C+ YPGC HGSC             C C   WGG+ C+ DLN+C  +   C++ G C N    K    YRC C  G  G  CE VEH C    C NGG C +   +N+       + +G                      +    N +S      +G+ +        F C C  G+ G  CEI+ DEC+  PC +GG CID   GF C CP  + GD CQV+ N+C+                        LS                     C+N  +C ++     C C  GW G  C +N+++C + Q C N   CID    YRC C + + G+ C   I          +C  +PCRN G C+                  + G + C C  G++G LCE+ 
Sbjct:   82 AAGNFELEILEISNTNSHLLNGYCCGMPAELRATKTIGCSP-CTTAFRLCLKEYQTTEQGASISTGCSFGNATTKILGGSSFVLSDPGVGAIVLPFTFRWTKSFTLILQALDMYNTSYPDAERLIEETSYSGVILPSPEW--KTLDHIGRNARITYRVRVQCAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGECECRPGWRGPLCNECMVYPGCKHGSCNGSA-------WKCVCDTNWGGILCDQDLNFCGTH-EPCKHGGTCENTAPDK----YRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKT-SNRTQAQVYRTSHGRSNMGRPVRRSSSMRSLDHLRPEGQALNGSSSPGLVSLGSLQLQQQLAPDFTCDCAAGWTGPTCEINIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDC-VGQ-CRNGATCIDLVNDYRCACASGFKGRDCETDI---------DECATSPCRNGGECV-----------------DMVGKFNCICPLGYSGSLCEEA 685          

HSP 2 Score: 152.91 bits (385), Expect = 5.247e-37
Identity = 139/497 (27.97%), Postives = 195/497 (39.24%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGE-------ECDKLCKPSANERGFYNCSSN---GDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCR---------CQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNK-YICDCPESFYGDRCQF-----NQTSCDDN---------------------------------PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCM----DRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
              L+  FR  C   +HG+       EC+               ++    G  +  T    +    V      I G C+   +CR         C+ GW G +C    D C+       G CR   T  +L+    C C   + G  C  D++ C+ +P  C N GEC++        ++ CIC  G+ G+ CE+ + NC  + C  G  C   +NT + Y C CP    G  C+      +Q  C++                                  PC G+  C       F CKC  G  G  CE + +ECS  PC NGG+C+D    F C C  G++G RC      C    C NG  CM    D+A +  C C  GWTG  C + I++C   QPC N G C    G +RC C   +SG  C +     N+N    +C   PC+    CI                  IGG Y+C C PG  G  CE ++
Sbjct:  506 IDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAI-GPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCV-------GQCRNGATCIDLVNDYRCACASGFKGRDCETDIDECATSP--CRNGGECVDMVG-----KFNCICPLGYSGSLCEEAKENCTPSPCLEG-HC---LNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGTF-CKCHVGHTGTFCEHNLNECSPNPCRNGGICLDGDGDFTCECMSGWTGKRCSERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCR-GQPCHNGGTCESGAGWFRCVCAQGFSGPDCRI-----NVN----ECSPQPCQGGATCI----------------DGIGG-YSCICPPGRHGLRCEILL 955          

HSP 3 Score: 138.272 bits (347), Expect = 1.501e-32
Identity = 115/434 (26.50%), Postives = 172/434 (39.63%), Query Frame = 1
Query:  814 CRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLP-LTCNCKKKWGGMFCNIDLNYCS--NNPNVCENE----------------------------------GECLNFGNIKTNQ-QYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNG-----------------------AKCMDRANRIDC---------------ECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C C  GWTG +C+  I    C  G C    T  +L+    C C  +W G  C +D+N C   ++  +  N                                   G C+N    +     + CICK G+ G  C +   +C+  +C NG  C I++  N Y C C   F G  C+ +   C  +PC    EC+ D    F C CP G+ G  CE  ++ C+  PCL G  C++ P G+ C CP   +G  C+  +  C +  C  G                        + M + + + C               +C  G TG  C  N+NEC+ N PC N GIC+D  G + C+C + W+G+ C+ +            C    C+N G C+  + P     P+            C+C PG+TG  C + I
Sbjct:  476 CDCAAGWTGPTCE--INIDECAGGPCEHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALLAALTSAVASTSLAIGPCINAKECRNQPGSFACICKEGWGGVTCAENLDDCV-GQCRNGATC-IDL-VNDYRCACASGFKGRDCETDIDECATSPCRNGGECV-DMVGKFNCICPLGYSGSLCEEAKENCTPSPCLEG-HCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSDVGTFCKCHVGHTGTFCEHNLNECSPN-PCRNGGICLDGDGDFTCECMSGWTGKRCSERAT---------GCYAGQCQNGGTCMPGA-PDKALQPH------------CRCAPGWTGLFCAEAI 879          

HSP 4 Score: 99.7525 bits (247), Expect = 1.060e-20
Identity = 96/362 (26.52%), Postives = 131/362 (36.19%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKLCKPSANER-----------GFYNCSSNGDRICHTGYSGSYCDKV---VCLKKCINGACVGPNQ---CRCQTGWTGDSCDQCIPY-------PGCV-----------------------------------HGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYI--CDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGA 1500
              L+  +R  C+  + G +C+      A              G +NC      IC  GYSGS C++         C+ G C+   +   C C     G  C+Q  P         GC                                    HGSC   +     +   C C     G FC  +LN CS  PN C N G CL+      +  + C C  G+ G  C +    C   +C NGG C            C C   + G  C      C   PC     C       F+C C  GF G +C I+ +ECS +PC  G  CID   G+ C+CP G  G RC++  +D  K +C N +
Sbjct:  625 IDLVNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNC------ICPLGYSGSLCEEAKENCTPSPCLEGHCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPPCNEGCFANVSLATSATTTTTTTTTATTTRKMAKPSGLPCSGHGSCEMSD-----VGTFCKCHVGHTGTFCEHNLNECS--PNPCRNGGICLD-----GDGDFTCECMSGWTGKRCSERATGCYAGQCQNGGTCMPGAPDKALQPHCRCAPGWTGLFCAEAIDQCRGQPCHNGGTC-ESGAGWFRCVCAQGFSGPDCRINVNECSPQPCQGGATCIDGIGGYSCICPPGRHGLRCEILLSD-PKSACQNAS 966          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 307.76 bits (787), Expect = 5.550e-91
Identity = 181/516 (35.08%), Postives = 254/516 (49.22%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI---KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLK 1692
            S GVFE+ +  +T               +S    S DC IF  +CL      I  + P  Y   + E      IL   +++ S     S+    +W    ++I++    +  D  T+ N  +++  +++  +     W   Q     +  QL  S+R  C + YHGEEC   C+P  +  G +NC + G+RIC  G+ G YC + +CL  C   NG C  P +C+C+ GW G  CD+C  +PGC+HG+C          P  C CK+ WGG+FCN DLN+C+N+   C N+  C N G       Y CICKPGF G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C D PC     C+   +  + C+CPPG++G NCE   D CSS PC NGG C+D  +   C C  GF+G RC+ N +DC    C N   C+D  N   C CT G++G+ C    + C+   PC N G C        CQC A + G  C  K
Sbjct:   20 SSGVFELKVLSFT-------------STSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSE------ILSADSISSSAY--ISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAIGEDW--SQDVHLGEQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN--------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTNTGQ----GSYTCICKPGFSGKNCEIETNECDSNPCKNGGSC--NDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSF-MPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYK 496          

HSP 2 Score: 106.301 bits (264), Expect = 7.094e-23
Identity = 88/294 (29.93%), Postives = 123/294 (41.84%), Query Frame = 1
Query: 1033 FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN------KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            FG+   +     IC PG+KG +C   E  C+         C   G+CK  +     +CD                C  +P   +  C       F+C C  G+ G  C  D + C++ KPC N   C +   G + C+C  GFSG  C++  N+C    C NG  C D+ N   C C  G+ G+ C  +   CA + PC N G C++   GSY C+C   + G  C  KI          +C  +PC N G C+                  +G   TC+C PGFTG  CE  I
Sbjct:  176 FGHFNCDAAGNRICLPGWKGDYC--TEPICLSGCSEENGYCEAPGECKCRIGWEGPLCD---------------ECTRHPGCLHGTC----NQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCA-DGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKI---------DRCSSDPCANGGQCL-----------------DLGNKATCRCRPGFTGSRCETNI 421          

HSP 3 Score: 67.781 bits (164), Expect = 5.970e-11
Identity = 56/183 (30.60%), Postives = 78/183 (42.62%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLKKCINGACV----------GPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ 1233
            C  G+ G  C+  V    C +G C           G   CRC  G+ G +C    D+C   P C +G    D   K     TC C+  + G  C  +++ CS+NP  C+N G C++  N      Y C C  GF G  C      C    C NGG C  + +    +C CP  F G +C++ Q
Sbjct:  331 CPQGFYGKNCE--VSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDP-CANGGQCLDLGNKA----TCRCRPGFTGSRCETNIDDCSSNP--CQNAGTCVDGIN-----GYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFS--GPVCQCPAGFMGTQCEYKQ 497          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 307.76 bits (787), Expect = 8.322e-91
Identity = 181/516 (35.08%), Postives = 254/516 (49.22%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI---KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLK 1692
            S GVFE+ +  +T               +S    S DC IF  +CL      I  + P  Y   + E      IL   +++ S     S+    +W    ++I++    +  D  T+ N  +++  +++  +     W   Q     +  QL  S+R  C + YHGEEC   C+P  +  G +NC + G+RIC  G+ G YC + +CL  C   NG C  P +C+C+ GW G  CD+C  +PGC+HG+C          P  C CK+ WGG+FCN DLN+C+N+   C N+  C N G       Y CICKPGF G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C D PC     C+   +  + C+CPPG++G NCE   D CSS PC NGG C+D  +   C C  GF+G RC+ N +DC    C N   C+D  N   C CT G++G+ C    + C+   PC N G C        CQC A + G  C  K
Sbjct:   20 SSGVFELKVLSFT-------------STSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSE------ILSADSISSSAY--ISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAIGEDW--SQDVHLGEQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN--------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTNTGQ----GSYTCICKPGFSGKNCEIETNECDSNPCKNGGSC--NDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSF-MPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYK 496          

HSP 2 Score: 105.916 bits (263), Expect = 7.453e-23
Identity = 88/294 (29.93%), Postives = 123/294 (41.84%), Query Frame = 1
Query: 1033 FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN------KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            FG+   +     IC PG+KG +C   E  C+         C   G+CK  +     +CD                C  +P   +  C       F+C C  G+ G  C  D + C++ KPC N   C +   G + C+C  GFSG  C++  N+C    C NG  C D+ N   C C  G+ G+ C  +   CA + PC N G C++   GSY C+C   + G  C  KI          +C  +PC N G C+                  +G   TC+C PGFTG  CE  I
Sbjct:  176 FGHFNCDAAGNRICLPGWKGDYC--TEPICLSGCSEENGYCEAPGECKCRIGWEGPLCD---------------ECTRHPGCLHGTC----NQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCA-DGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKI---------DRCSSDPCANGGQCL-----------------DLGNKATCRCRPGFTGSRCETNI 421          

HSP 3 Score: 67.781 bits (164), Expect = 6.001e-11
Identity = 56/183 (30.60%), Postives = 78/183 (42.62%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLKKCINGACV----------GPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ 1233
            C  G+ G  C+  V    C +G C           G   CRC  G+ G +C    D+C   P C +G    D   K     TC C+  + G  C  +++ CS+NP  C+N G C++  N      Y C C  GF G  C      C    C NGG C  + +    +C CP  F G +C++ Q
Sbjct:  331 CPQGFYGKNCE--VSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDP-CANGGQCLDLGNKA----TCRCRPGFTGSRCETNIDDCSSNP--CQNAGTCVDGIN-----GYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFS--GPVCQCPAGFMGTQCEYKQ 497          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dlb (deltaB [Source:NCBI gene;Acc:30141])

HSP 1 Score: 295.819 bits (756), Expect = 3.897e-87
Identity = 183/555 (32.97%), Postives = 255/555 (45.95%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI-------KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNI 1797
            S GVFE+ +  ++                     + DCNIF  ICL      I  + P  +    G+T +      + A + +++  +      +W   F++I++        +H+D    +N +I  L++          W   Q     D  +L  S+   C + Y GE C   C+P  +  G Y C  NG++ C  G+ G YC   +C   C   +G C  P +C+C+ GW G SC +C+ YPGC+HG+C          P  C CK+ WGG+FCN DLNYC+N+   C N   C N G       Y C C+PGF G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+    +C D+PC     C    T G+ C+CPP F G NCE   D CS KPC NGG C+D  +  LC C  GFSG RC+ N +DC +  C N   C D  N   C CT G+TG+ C+   + C  N PCL+ G C        CQC   + G  C   +         R    +P      C+L  L   + +
Sbjct:   20 SSGVFELKVHSFST-------------TRRFCRRTRDCNIFFRICLKHSEDVISAEPPCTFG--TGQTSVLRADQSSIASSAAIRVPFHF----KWPGTFSLIIEAWNAESPKEHHDYTENQNNLISRLATRRRLAVGED-W--SQDVHFGDQSELRYSYHVFCDEFYFGEACSDYCRPRDDTLGHYTCDENGNKECLVGWQGDYCSDPICSSDCSERHGYCESPGECKCRLGWQGPSCSECVHYPGCLHGTCS--------QPWQCVCKEGWGGLFCNQDLNYCTNH-KPCANGATCTNTGQ----GSYTCTCRPGFGGTNCELEINECDCNPCKNGGSC--NDLENDYSCTCPQGFYGKNCEIIAMTCADDPCFNGGTCEEKFTGGYVCRCPPTFTGSNCEKRLDRCSHKPCANGGECVDLGASALCRCRPGFSGSRCETNIDDCARYPCQNAGTCQDGINDYTCTCTLGFTGKNCSLRADACLTN-PCLHGGTCFTHFSGPVCQCVPGFMGSTCEFPVQASLEKMAPRVGQTSPSAVAVSCVLGVLAVFLGV 536          

HSP 2 Score: 88.1965 bits (217), Expect = 2.266e-17
Identity = 63/200 (31.50%), Postives = 88/200 (44.00%), Query Frame = 1
Query: 1297 FKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            ++C C  G+ G  C  D + C++ KPC NG  C +   G + C C  GF G  C++  N+C    C NG  C D  N   C C  G+ G+ C      CA + PC N G C +   G Y C+C  T++G  C  ++          +C   PC N G C+                  +G    C+C PGF+G  CE  I
Sbjct:  254 WQCVCKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGFGGTNCELEINECDCNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIIAMTCA-DDPCFNGGTCEEKFTGGYVCRCPPTFTGSNCEKRL---------DRCSHKPCANGGECV-----------------DLGASALCRCRPGFSGSRCETNI 426          

HSP 3 Score: 67.781 bits (164), Expect = 6.347e-11
Identity = 76/264 (28.79%), Postives = 99/264 (37.50%), Query Frame = 1
Query: 1192 CPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGF---------------------KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C E ++G+ C              +CD+N   GN EC+      +                     +CKC  G+ G +C     EC   P    G C  +P  + CVC  G+ G  C  + N C     C NGA C +       C C  G+ G  C   INEC  N PC N G C D    Y C C   + G+ C +         +   C  +PC N G C              E F    G Y C+C P FTG  CEK +
Sbjct:  161 CDEFYFGEACSDYCRPRDDTLGHYTCDEN---GNKECLVGWQGDYCSDPICSSDCSERHGYCESPGECKCRLGWQGPSCS----ECVHYPGCLHGTC-SQP--WQCVCKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGFGGTNCELEINECDCN-PCKNGGSCNDLENDYSCTCPQGFYGKNCEI---------IAMTCADDPCFNGGTC-------------EEKFT---GGYVCRCPPTFTGSNCEKRL 388          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dla (deltaA [Source:NCBI gene;Acc:30131])

HSP 1 Score: 296.975 bits (759), Expect = 4.337e-86
Identity = 175/523 (33.46%), Postives = 257/523 (49.14%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPH-RYACDIGETYIKT---------DILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            S GVFE+ ++++     +  NK C     +T+    +C  F  ICL  YQ N      C  G T             D L + +  + ++ ++       W   F++I++  H D    L T+    I++  +++  +     W     S  +   +L  S+R+ C ++Y+GE C   C+P  +  G + C   G+ IC  G+ G YC + +CL  C   +G C  P +C+C+ G+ G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C+PGF GA CE   + C  N C NGG C    NT  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C+CP G+ G NCE   D CSS PC NG  C+D  + +LC CP GF+G  C    ++C    C NG  C + A+   C C  G+TGR C+  ++ C  N PC N   C +    Y C C + + G+ C   +
Sbjct:   22 SSGVFELKLQEFLNKKGVQGNKNCCKGGLTTSYQQCECKTFFRICLKHYQPNASPEPPCTYGGTVTPVLGSNSFQVPDTLPDGSFTNPIRMNFGFT----WPGTFSLIIEALHADSKEDLTTENPERIISTMTTQRHLTVGEDWSQDLHSVGRT--ELKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICDAGWKGQYCTEPICLPGCDEEHGFCEKPGECKCRVGFKGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCSNTGQ----GSYTCSCRPGFSGASCEIEVNECTGNPCRNGGSCTDMENT--YSCTCPPGFYGKNCELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTCQEGASGYMCTCPPGYTGRNCSSPVSRCQHN-PCHNGATCHERNNRYVCACVSGYGGRNCQFLL 522          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: dla (deltaA [Source:NCBI gene;Acc:30131])

HSP 1 Score: 297.36 bits (760), Expect = 5.684e-86
Identity = 175/523 (33.46%), Postives = 257/523 (49.14%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPH-RYACDIGETYIKT---------DILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            S GVFE+ ++++     +  NK C     +T+    +C  F  ICL  YQ N      C  G T             D L + +  + ++ ++       W   F++I++  H D    L T+    I++  +++  +     W     S  +   +L  S+R+ C ++Y+GE C   C+P  +  G + C   G+ IC  G+ G YC + +CL  C   +G C  P +C+C+ G+ G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C+PGF GA CE   + C  N C NGG C    NT  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C+CP G+ G NCE   D CSS PC NG  C+D  + +LC CP GF+G  C    ++C    C NG  C + A+   C C  G+TGR C+  ++ C  N PC N   C +    Y C C + + G+ C   +
Sbjct:   22 SSGVFELKLQEFLNKKGVQGNKNCCKGGLTTSYQQCECKTFFRICLKHYQPNASPEPPCTYGGTVTPVLGSNSFQVPDTLPDGSFTNPIRMNFGFT----WPGTFSLIIEALHADSKEDLTTENPERIISTMTTQRHLTVGEDWSQDLHSVGRT--ELKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICDAGWKGQYCTEPICLPGCDEEHGFCEKPGECKCRVGFKGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCSNTGQ----GSYTCSCRPGFSGASCEIEVNECTGNPCRNGGSCTDMENT--YSCTCPPGFYGKNCELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTCQEGASGYMCTCPPGYTGRNCSSPVSRCQHN-PCHNGATCHERNNRYVCACVSGYGGRNCQFLL 522          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 294.278 bits (752), Expect = 2.279e-85
Identity = 178/525 (33.90%), Postives = 261/525 (49.71%), Query Frame = 1
Query:  166 VQCSKGVFEIHIKKYTLFPTL--NLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRD--YSILVRE----RWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            + CS G+FE+ ++++     L  N+N C P    +   C  DC  F  ICL  YQ N      C  G          ++ + +S   D  +S  +R      W   F++I++  H D    L T+    +++  +++  +     W     S+  D  +L  S+R+ C ++Y+GE C   C+P  +  G ++C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ G++CE   + C  N C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP G+ G NCE   D CSS PC NG  C D  + ++C C  GFSG  C  N +DC    C NG  C D  N   C C  G+ G+ C+  I +C  N PC N   C +    Y CQC   + G  C   +
Sbjct:   19 ISCS-GLFELRLQEFLNKKGLLGNMNCCRPGSLGTLQRC--DCKTFFRICLKHYQSNVSPEPPCTYGSAVTPVLGTNSFVVPESSSSDPTFSNPIRFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSS--DRTELKYSYRFVCDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENS--YSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNPCANGAHCEDLGNSYICQCQEGFSGRNCDDNLDDCASFPCQNGGTCQDGINDYTCTCPPGYIGKNCSMPITKCEHN-PCHNGATCHERNNRYVCQCARGYGGNNCQFLL 522          

HSP 2 Score: 126.331 bits (316), Expect = 6.045e-29
Identity = 95/322 (29.50%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
            C   W G++C   I L  C  +   C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G NCEI+ +EC + PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ N PC N   C D   SY CQCQ  +SG+ C+  +           C   PC+N G C        +N             YTC C PG+ G  C   I 
Sbjct:  214 CNPGWKGLYCTEPICLPGCDEHHGYCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSN-PCANGAHCEDLGNSYICQCQEGFSGRNCDDNL---------DDCASFPCQNGGTC-----QDGIN------------DYTCTCPPGYIGKNCSMPIT 485          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 294.278 bits (752), Expect = 2.720e-85
Identity = 178/525 (33.90%), Postives = 261/525 (49.71%), Query Frame = 1
Query:  166 VQCSKGVFEIHIKKYTLFPTL--NLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRD--YSILVRE----RWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            + CS G+FE+ ++++     L  N+N C P    +   C  DC  F  ICL  YQ N      C  G          ++ + +S   D  +S  +R      W   F++I++  H D    L T+    +++  +++  +     W     S+  D  +L  S+R+ C ++Y+GE C   C+P  +  G ++C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ G++CE   + C  N C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP G+ G NCE   D CSS PC NG  C D  + ++C C  GFSG  C  N +DC    C NG  C D  N   C C  G+ G+ C+  I +C  N PC N   C +    Y CQC   + G  C   +
Sbjct:   19 ISCS-GLFELRLQEFLNKKGLLGNMNCCRPGSLGTLQRC--DCKTFFRICLKHYQSNVSPEPPCTYGSAVTPVLGTNSFVVPESSSSDPTFSNPIRFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSS--DRTELKYSYRFVCDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENS--YSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNPCANGAHCEDLGNSYICQCQEGFSGRNCDDNLDDCASFPCQNGGTCQDGINDYTCTCPPGYIGKNCSMPITKCEHN-PCHNGATCHERNNRYVCQCARGYGGNNCQFLL 522          

HSP 2 Score: 126.331 bits (316), Expect = 6.174e-29
Identity = 95/322 (29.50%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
            C   W G++C   I L  C  +   C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G NCEI+ +EC + PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ N PC N   C D   SY CQCQ  +SG+ C+  +           C   PC+N G C        +N             YTC C PG+ G  C   I 
Sbjct:  214 CNPGWKGLYCTEPICLPGCDEHHGYCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSN-PCANGAHCEDLGNSYICQCQEGFSGRNCDDNL---------DDCASFPCQNGGTC-----QDGIN------------DYTCTCPPGYIGKNCSMPIT 485          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 293.508 bits (750), Expect = 3.531e-85
Identity = 178/525 (33.90%), Postives = 261/525 (49.71%), Query Frame = 1
Query:  166 VQCSKGVFEIHIKKYTLFPTL--NLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRD--YSILVRE----RWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            + CS G+FE+ ++++     L  N+N C P    +   C  DC  F  ICL  YQ N      C  G          ++ + +S   D  +S  +R      W   F++I++  H D    L T+    +++  +++  +     W     S+  D  +L  S+R+ C ++Y+GE C   C+P  +  G ++C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ G++CE   + C  N C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP G+ G NCE   D CSS PC NG  C D  + ++C C  GFSG  C  N +DC    C NG  C D  N   C C  G+ G+ C+  I +C  N PC N   C +    Y CQC   + G  C   +
Sbjct:   19 ISCS-GLFELRLQEFLNKKGLLGNMNCCRPGSLGTLQRC--DCKTFFRICLKHYQSNVSPEPPCTYGSAVTPVLGTNSFVVPESSSSDPTFSNPIRFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSS--DRTELKYSYRFVCDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENS--YSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNPCANGAHCEDLGNSYICQCQEGFSGRNCDDNLDDCASFPCQNGGTCQDGINDYTCTCPPGYIGKNCSMPITKCEHN-PCHNGATCHERNNRYVCQCARGYGGNNCQFLL 522          

HSP 2 Score: 125.561 bits (314), Expect = 8.829e-29
Identity = 95/322 (29.50%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
            C   W G++C   I L  C  +   C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G NCEI+ +EC + PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ N PC N   C D   SY CQCQ  +SG+ C+  +           C   PC+N G C        +N             YTC C PG+ G  C   I 
Sbjct:  214 CNPGWKGLYCTEPICLPGCDEHHGYCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSN-PCANGAHCEDLGNSYICQCQEGFSGRNCDDNL---------DDCASFPCQNGGTC-----QDGIN------------DYTCTCPPGYIGKNCSMPIT 485          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 294.278 bits (752), Expect = 3.837e-85
Identity = 178/525 (33.90%), Postives = 261/525 (49.71%), Query Frame = 1
Query:  166 VQCSKGVFEIHIKKYTLFPTL--NLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRD--YSILVRE----RWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            + CS G+FE+ ++++     L  N+N C P    +   C  DC  F  ICL  YQ N      C  G          ++ + +S   D  +S  +R      W   F++I++  H D    L T+    +++  +++  +     W     S+  D  +L  S+R+ C ++Y+GE C   C+P  +  G ++C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ G++CE   + C  N C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP G+ G NCE   D CSS PC NG  C D  + ++C C  GFSG  C  N +DC    C NG  C D  N   C C  G+ G+ C+  I +C  N PC N   C +    Y CQC   + G  C   +
Sbjct:   29 ISCS-GLFELRLQEFLNKKGLLGNMNCCRPGSLGTLQRC--DCKTFFRICLKHYQSNVSPEPPCTYGSAVTPVLGTNSFVVPESSSSDPTFSNPIRFPFGFTWPGTFSLIIEAIHADSADDLNTENPERLISRLATQRHLTVGEQWSQDLHSS--DRTELKYSYRFVCDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENS--YSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNPCANGAHCEDLGNSYICQCQEGFSGRNCDDNLDDCASFPCQNGGTCQDGINDYTCTCPPGYIGKNCSMPITKCEHN-PCHNGATCHERNNRYVCQCARGYGGNNCQFLL 532          

HSP 2 Score: 126.331 bits (316), Expect = 6.580e-29
Identity = 95/322 (29.50%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
            C   W G++C   I L  C  +   C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G NCEI+ +EC + PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ N PC N   C D   SY CQCQ  +SG+ C+  +           C   PC+N G C        +N             YTC C PG+ G  C   I 
Sbjct:  224 CNPGWKGLYCTEPICLPGCDEHHGYCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSN-PCANGAHCEDLGNSYICQCQEGFSGRNCDDNL---------DDCASFPCQNGGTC-----QDGIN------------DYTCTCPPGYIGKNCSMPIT 495          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: gsdme (gasdermin E [Source:Xenbase;Acc:XB-GENE-983245])

HSP 1 Score: 286.189 bits (731), Expect = 1.312e-82
Identity = 172/515 (33.40%), Postives = 253/515 (49.13%), Query Frame = 1
Query:  166 VQCSKGVFEIHIKKYTLFPTL--NLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            + CS G+FE+ ++++     L  N+N C P    +   C  DC  F  ICL  YQ N      C  G          ++ + +S   D +     R+   F   V     ++  +    +++  +++  +     W     S+  D  +L  S+R+ C ++Y+GE C   C+P  +  G ++C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ G++CE   + C  N C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP G+ G NCE   D CSS PC NG  C D  + ++C C  GFSG  C  N +DC    C NG  C D  N   C C  G+ G+ C+  I +C  N PC N   C +    Y CQC   + G  C   +
Sbjct:   19 ISCS-GLFELRLQEFLNKKGLLGNMNCCRPGSLGTLQRC--DCKTFFRICLKHYQSNVSPEPPCTYGSAVTPVLGTNSFVVPESSSSDPTFSNPIRFPFGFTWPVS----NVFHENPERLISRLATQRHLTVGEQWSQDLHSS--DRTELKYSYRFVCDEHYYGEGCSDYCRPRDDAFGHFSCGEKGEKLCNPGWKGLYCTEPICLPGCDEHHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENS--YSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSNPCANGAHCEDLGNSYICQCQEGFSGRNCDDNLDDCASFPCQNGGTCQDGINDYTCTCPPGYIGKNCSMPITKCEHN-PCHNGATCHERNNRYVCQCARGYGGNNCQFLL 508          

HSP 2 Score: 125.946 bits (315), Expect = 7.264e-29
Identity = 95/322 (29.50%), Postives = 135/322 (41.93%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
            C   W G++C   I L  C  +   C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G NCEI+ +EC + PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ N PC N   C D   SY CQCQ  +SG+ C+  +           C   PC+N G C        +N             YTC C PG+ G  C   I 
Sbjct:  200 CNPGWKGLYCTEPICLPGCDEHHGYCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGSNCEIEINECDANPCKNGGSCTDLENSYSCSCPPGFYGKNCELSAMTCADGPCFNGGRCSDNPDGGYICFCPVGYSGFNCEKKIDYCSSN-PCANGAHCEDLGNSYICQCQEGFSGRNCDDNL---------DDCASFPCQNGGTC-----QDGIN------------DYTCTCPPGYIGKNCSMPIT 471          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dll1 (delta like canonical Notch ligand 1 [Source:MGI Symbol;Acc:MGI:104659])

HSP 1 Score: 292.738 bits (748), Expect = 6.293e-85
Identity = 171/523 (32.70%), Postives = 252/523 (48.18%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRER------WKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCIN--GACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVP 1704
            S GVFE+ ++++     L  N+ C  R  S   C+  C  F  +CL  YQ +      C  G        + +++L D    D +     R      W   F++I++  H D    L T+    +++  +++  +     W     S+ +    L  S+R+ C ++Y+GE C   C+P  +  G + C   G+++C  G+ G YC   +CL  C +  G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C+PG+ GA+CE     C  + C NG  C    ++  + C CP  FYG  C+ +  +C D PC     C  +   G+ C CP GF G NCE   D C S PC NG  C+D  + +LC C  GFSG  C+ N +DC    C NG  C D  N   C C  G+TG+ C+  ++ C  + PC N   C      Y C+C   + G  C   +  P
Sbjct:   21 SSGVFELKLQEFVNKKGLLGNRNC-CRGGSGPPCA--CRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRT--DLRYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCRNGATCTNTGQ----GSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDS--FSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCVDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAPVSRCE-HAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEP 522          

HSP 2 Score: 93.2041 bits (230), Expect = 8.885e-19
Identity = 80/295 (27.12%), Postives = 118/295 (40.00%), Query Frame = 1
Query: 1033 FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN------KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDK-TSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP-GSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            FG+     +   +C PG+KG +C   +  C+         C   G+CK  V      CD                     C+    C+       ++C C  G+ G  C  D + C+  KPC NG  C +   G + C C  G++G  C++  ++C    C NGA C D  +   C C  G+ G++C  +   CA + PC N G C D P G Y C C   +SG  C  K+ +         C  +PC N   C+                  +G  Y C+C  GF+G  CE  +
Sbjct:  198 FGHFTCGDRGEKMCDPGWKGQYC--TDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCD--------------------ECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCA-DGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDL---------CGSSPCSNGAKCV-----------------DLGNSYLCRCQAGFSGRYCEDNV 443          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dll4 (delta like canonical Notch ligand 4 [Source:MGI Symbol;Acc:MGI:1859388])

HSP 1 Score: 272.322 bits (695), Expect = 5.521e-78
Identity = 170/532 (31.95%), Postives = 253/532 (47.56%), Query Frame = 1
Query:  160 QPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILG--NYALND----SVKRDYSILVRERWKRNFNIIVKIKHY---DLI--TKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECIT-DKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECA-INQPCLNNGICID--TPGSYRCQCQATWSGQFCNLKIVVP 1704
            Q      G+F++ ++++     +  N           SC   C  F  ICL  +Q       C  G   + T +LG  ++ + D    S +    +     W   F++ ++  H    DL   T     +++    +  +     W T + +      +L  S+R  CS NY+GE C +LCK   +  G Y C  +G   C  G++G YCD+ +CL  C   NG C  P++C C+ GW G  C++CIP+ GC HG+C         +P  C C + WGG+FC+ DLNYC+++ + C+N   C N G     + Y C C PG+ G HCE     C  N C NGG CK   N+  Y C CP  +YG  C+ +  +C D+PC     C   ++ S + C+CPP F G NCE   D C+S PC NGG C +R     C C  GF+G  C+++ +DC +  C +G  C D  N   C C  G++GR C   I   A  + PC N   C    +P ++ C C   + G  C   + +P
Sbjct:   22 QQRAAGSGIFQLRLQEFVNQRGMLANG---------QSCEPGCRTFFRICLKHFQATFSEGPCTFGN--VSTPVLGTNSFVVRDKNSGSGRNPLQLPFNFTWPGTFSLNIQAWHTPGDDLRPETSPGNSLISQIIIQGSLAVGKIWRTDEQN--DTLTRLSYSYRVICSDNYYGESCSRLCKKRDDHFGHYECQPDGSLSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECICRPGWQGRLCNECIPHNGCRHGTCS--------IPWQCACDEGWGGLFCDQDLNYCTHH-SPCKNGSTCSNSGP----KGYTCTCLPGYTGEHCELGLSKCASNPCRNGGSCKDQENS--YHCLCPPGYYGQHCEHSTLTCADSPCFNGGSCRERNQGSSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCQNRGPSRTCRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGPVCTCPAGFSGRRCEVRITHDACASGPCFNGATCYTGLSPNNFVCNCPYGFVGSRCEFPVGLP 525          

HSP 2 Score: 93.2041 bits (230), Expect = 9.876e-19
Identity = 82/291 (28.18%), Postives = 123/291 (42.27%), Query Frame = 1
Query: 1030 NFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS-GFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDR-PSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICID--TPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +FG+ +        C PG+ G +C++         C +G   +    +    C C   + G  C         N C+ ++ C     S  ++C C  G+ G  C+ D + C+   PC NG  C +  P G+ C C  G++G+ C++  + C    C NG  C D+ N   C C  G+ G+ C  +   CA + PC N G C +     SY C+C   ++G  C  K+          +C  NPC N G C  N  P+                 TC+C PGFTG  CE  I
Sbjct:  195 HFGHYECQPDGSLSCLPGWTGKYCDQP-------ICLSGCHEQNGYCSKPDECICRPGWQGRLC---------NECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPKGYTCTCLPGYTGEHCELGLSKCASNPCRNGGSCKDQENSYHCLCPPGYYGQHCEHSTLTCA-DSPCFNGGSCRERNQGSSYACECPPNFTGSNCEKKV---------DRCTSNPCANGGQC-QNRGPSR----------------TCRCRPGFTGTHCELHI 442          

HSP 3 Score: 70.8626 bits (172), Expect = 6.598e-12
Identity = 74/264 (28.03%), Postives = 103/264 (39.02%), Query Frame = 1
Query: 1180 YICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCE---------------IDEDECSSKPCLNGGMCID-RPSG----------FLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            Y   C +++YG+ C       DD+   G+ EC  D +      C PG+ G+ C+                  DEC  +P   G +C +  P            + C C  G+ G  C  + N C   S C NG+ C +   +   C C  G+TG  C   +++CA N PC N G C D   SY C C   + GQ C    +          C  +PC N G C   +                G  Y C+C P FTG  CEK +
Sbjct:  172 YRVICSDNYYGESCSRLCKKRDDH--FGHYECQPDGS----LSCLPGWTGKYCDQPICLSGCHEQNGYCSKPDECICRPGWQGRLCNECIPHNGCRHGTCSIPWQCACDEGWGGLFCDQDLNYCTHHSPCKNGSTCSNSGPKGYTCTCLPGYTGEHCELGLSKCASN-PCRNGGSCKDQENSYHCLCPPGYYGQHCEHSTLT---------CADSPCFNGGSCRERNQ---------------GSSYACECPPNFTGSNCEKKV 404          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag2 (jagged 2 [Source:MGI Symbol;Acc:MGI:1098270])

HSP 1 Score: 274.248 bits (700), Expect = 1.666e-75
Identity = 191/632 (30.22%), Postives = 277/632 (43.83%), Query Frame = 1
Query:  181 GVFEIHIKKY-TLFPTLNLNKCCPT--RKNSTNSCSED-CNIFMEICLSIYQ-KNPHRYACDIGETYIKTDILGNYAL----------------NDSVKRDYSILV---RERWKRNFNIIVKIKHYD-LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVV-----------------------------PNINYLERKCLINPCRNNGICILNS-------LPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            G FE+ +     +   L    CC    R      C  D C+ ++ +CL  YQ K      C  G  Y  T +LG  +                      +D  ++V   +  W R+F +IV+   +D   T    +++   S    + P   W +   S    H +L +  R  C +NY+   C+K C+P  +  G Y C   G++ C  G+ G  C + VC + C  ++G C  P +CRC  GW G  CD+C+PYPGCVHGSC        + P  C+C+  WGG+ C+ DLNYC ++ + C N G C+N        QY C C  G+ G +CE+ EH C  N C NGG C  +   + + C CP  + G  C  +   C  NPC     C+ D+  GF+C CP  ++G  C++D +EC  KPCLN   C +   G+ C C  G+ G  CQ+N NDC    C +G  C D  N   C C  G+ GR C    ++CA + PC   GIC D    +RC C    SG  C + + +                              N +     C    CR    C   +        P+ +  P+       GG ++C C+ GFTG  C + I
Sbjct:   28 GYFELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTPTGPCSYG--YGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVR--CDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSC--------VEPWHCDCETNWGGLLCDKDLNYCGSH-HPCVNGGTCIN----AEPDQYLCACPDGYLGKNCERAEHACASNPCANGGSC--HEVPSGFECHCPSGWNGPTCALDIDECASNPCAAGGTCV-DQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGINCQININDCHG-QCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCA-SSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENI 637          

HSP 2 Score: 148.288 bits (373), Expect = 1.438e-35
Identity = 125/444 (28.15%), Postives = 171/444 (38.51%), Query Frame = 1
Query:  799 VGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCV-----------------------GNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLK---IVVPNI--------------------NYLERKCLIN-------PCRNNGICILNSLPTSVNIPNNEYFKPIGGP--------------------------YTCKCNPGFTGDLCEKVII 1890
            +G   C C  GW G +C   I      HG C+   T K+L+    C C + +GG  C ++ + C+++P  C   G C +  +      +RC C  G  G HCE     C  + C NG +C  N+  + Y C CPE F G  C   + +C    C                         +  C++     F C C  GF G  C  + D+C  +PC NGG CID    F C CP G+ G+ C +N NDC    C +  +C D  N   C C  GW G+ C+    +C     C N G C D+  ++RC C   W G  C +      VPN                      +  R C  N       PC N GIC+       VN    E      GP                          Y C C PG +G  C++V+I
Sbjct:  442 IGGYYCDCLPGWKGINCQININD---CHGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCASSP--CRRGGICEDLVD-----GFRCHCPRGLSGLHCEVDMDLCEPSPCLNGARC-YNLEGD-YYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSGWEGELCDINPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT-CSNGGTCYDSGDTFRCACPPGWKGSTCTIAKNSSCVPNPCVNGGTCVGSGDSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICV-----DGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQEVVI 867          

HSP 3 Score: 134.806 bits (338), Expect = 2.216e-31
Identity = 112/357 (31.37%), Postives = 153/357 (42.86%), Query Frame = 1
Query:  811 QCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ-TSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSY-------RC-----QCQATW--------SGQFCNLKIVVPNINYLERK----CLINPCRNNGICILNS-LPTSV 1791
             C C +G+TG  C    D C+  P C +G    DE         C C   W G  C+I+ N C   P+ C + G C +  N      + C C  G+KG  C   E  C    C NGG C  + +T  + C CP  + G  C   + +SC  NPCV    C+    S F C C  G+ GR C  + ++C+  PC NGG+C+D  + F C C  GF+G  C++N ++CQ   C  GA C+D  N   C C  G +G  C + +      +PC + G+      S+       RC      C   W        SGQ  +     P     + K    CL  PC N G C     LP S 
Sbjct:  621 SCICDSGFTGTYCHENIDDCMGQP-CRNGGTCIDEVDS----FRCFCPSGWEGELCDINPNDCL--PDPCHSRGRCYDLVN-----DFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDT--FRCACPPGWKGSTCTIAKNSSCVPNPCVNGGTCVGSGDS-FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQEVV---IFTRPCWSRGMSFPHGSSWMEDCNSCRCLDGHRDCSKVWCGWKPCLLSGQPSDPSAQCPPGQQCQEKAVGQCLQPPCENWGECTAEEPLPPST 959          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag1 (jagged 1 [Source:MGI Symbol;Acc:MGI:1095416])

HSP 1 Score: 272.322 bits (695), Expect = 7.056e-75
Identity = 199/622 (31.99%), Postives = 284/622 (45.66%), Query Frame = 1
Query:  175 SKGVFEIHI-KKYTLFPTLNLNKCCPTRKNSTN-SCSED-CNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILGNYALNDSVKR--DYSILVRE---RWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVV-----------------------------PNINYLERKCLINPCRNNGICIL----NSLPTSVNI-------PNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            + G FE+ I     +   L    CC   +N  +  C+ D C+ + ++CL  YQ        C  G     T ++G    N    R  D + +V      W R++ ++V+       T +   I+  +S    + PS  W T + +T   HF+  +  R TC  +Y+G  C+K C+P  +  G Y C  NG++ C  G+ G  C+K +C + C   +G+C  P  CRCQ GW G  CD+CIP+PGCVHG+C          P  C C+  WGG  C+ DLNYC  +   C N G C N G  K    Y+C C  G+ G +CE  EH C+ + C N G CK    ++ + C+C   + G  C  N   C  N C     C  D  +GFKC CPP + G+ C++D +EC +KPC+N   C +  + + C C  G+ G  C +N NDC    C N A C D  N   C C  G+ G  C ++I+ECA N PCLN G C +    ++C C   +SG  C L I                                N ++L+  C    C     C +    N  P  V         P+ +     GG +TC CN GFTG  C + I
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSG--STPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQI--RVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCN--------EPWQCLCETNWGGQLCDKDLNYCGTH-QPCLNRGTCSNTGPDK----YQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCK--ETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTC-QDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSCKNLIASYYCDCLPGWMGQNCDININDCLG-QCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASN-PCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENI 630          

HSP 2 Score: 157.532 bits (397), Expect = 2.221e-38
Identity = 132/466 (28.33%), Postives = 187/466 (40.13%), Query Frame = 1
Query:  604 LLVSFRYTCSQNYHGEEC-----DKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTN--------------------------KYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            L+  F+  C   + G+ C     +   KP  N R   N  ++    C  G+ G  CD  +  CL +C N A     V   +C C  G+ GD C    D+C   P    G C+      E+    C C   + G  C +D++YC   PN C+N  +C N  +      Y C C   ++G +C  ++ +C    C     C + + +N                          K+ CDC + F G  C  N   C+ NPC     CI D  + +KC C  G+ G +CE + ++CS  PC  GG C D  + F C C  G+ G  C    + C + +C NG  C D  +   C C  GW G  CN   N   +  PC N G C+    S+ C C+  W G  C       N N     C  +PC N+G C+                      Y C+C PGF G  C 
Sbjct:  392 LVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQ-----NEINRFQCLCPTGFSGNLCQLDIDYCE--PNPCQNGAQCYNRAS-----DYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCI-DGVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPIC-----TQNTN----DCSPHPCYNSGTCVDGD-----------------NWYRCECAPGFAGPDCR 818          

HSP 3 Score: 129.798 bits (325), Expect = 8.821e-30
Identity = 106/373 (28.42%), Postives = 156/373 (41.82%), Query Frame = 1
Query:  880 HGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI---------------------------------------DEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSY------------RCQCQATWSG-QFCNLKIV---VPN----INYLERKCLINPCRNNGICILNSL-PTSVNIPNNEYFK 1818
            HG C+     K     TC+C K + G +C+ ++N C +NP  C+N G C++  N      Y+CIC  G++GAHCE   ++C  N C  GG C+  VN   + CDC   + G  C    + CD+  C     C  D+   FKC CP G+ G  C I                                       + ++CS  PC N G C+D  + + C C  GF+G  C++N N+CQ   C  GA C+D  N   C C  G +G  C++        + C+  G  I     +            R  C   W G + C L       P+    I  L+ +C + PC   G C  +SL P      ++ Y++
Sbjct:  602 HGKCKSQSGGK----FTCDCNKGFTGTYCHENINDCESNP--CKNGGTCIDGVN-----SYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVN--DFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCY-DEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQCICPPGHSGAKCHE-----VSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKSHNECPSGQSCIPVLDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQ 955          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Notch2 (notch 2 [Source:MGI Symbol;Acc:MGI:97364])

HSP 1 Score: 194.512 bits (493), Expect = 1.582e-49
Identity = 142/430 (33.02%), Postives = 199/430 (46.28%), Query Frame = 1
Query:  724 ICHTGYSGSYC--DKVVCLK-KCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICIL------------------NSLPTSVNIPNNEYFKPI-------------GGPYTCKCNPGFTGDLCEKVI 1887
            +C  G+ G  C  DK  CL   C NG      V   +C C+ G+ G +C    D+C   P    G+C FD+ +      TC+C   + G  C   L  CS  PN CEN   C    N ++   + C+C PG++G  C      CI   C N G C  +     Y+C+CP  F G  C+ +   C  NPC     C+ D  + F C+C PGFIG  C+ D +EC S+PC NGG C D  + + C CP GF G  C+ N ++C + SC NG  C+D  N   C C  G+TG  C  +INEC+ N PCLN G C+D  G+YRC C   ++G+ C   + +         C  +PC+N G C+                   + L  S      +   P+             G  + C+C  G+TG  CE+ +
Sbjct:  744 LCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTC-FDDVSG----YTCHCMLPYTGKNCQTVLAPCS--PNPCENAAVCKEAPNFES---FSCLCAPGWQGKRCTVDVDECISKPCMNNGVC--HNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCV-DHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSN-PCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNL---------CSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQL 1150          

HSP 2 Score: 192.586 bits (488), Expect = 5.275e-49
Identity = 156/484 (32.23%), Postives = 223/484 (46.07%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKL---CKPSANERGFYNCSSNGDRI----CHTGYSGSYCDKVV--CL-KKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPG----------------------------------CVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII---NKCFNGGKCKINVNTN-KYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
              L  S+R  C Q + G+ CD     C PS    G   C   GD      C  G+ GS C++ +  C   KC NG      V    CRC   WTG  C    D+C+  P                                   C + SC    T    +   +C C +   G+ C++D + C +NP  C     C        N QY C C  G+KGA C +    C +   N C + GKC   VNT+  + C+C + + G RC+ +   C  +PC  ++ C+ DK  GF C C PGF G +CE++ +EC S PC+N G C+D+ + F C+CP GF+G  CQ++ +DC    C+NGAKC+D  N  +C+C TG+TG +C++NI+ C  + PC ++G C D   SY C C   + G  C+ +I          +C  +PC N+G CI        ++ N          Y C C PG +G  CE
Sbjct:  199 LNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGG-TCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAGLLCHLD-DACISNP--CHKGALC---DTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKC---VNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCL-DKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPD-PC-HHGQCQDGIDSYTCICNPGYMGAICSDQI---------DECYSSPCLNDGRCI--------DLVNG---------YQCNCQPGTSGLNCE 643          

HSP 3 Score: 181.8 bits (460), Expect = 1.094e-45
Identity = 135/400 (33.75%), Postives = 184/400 (46.00%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVVCLKKCINGAC---------VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKT-SGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLC 1875
            +C  G++G  C+  + + +C +  C         V   +C C  G    SC    ++C+  P C+HG+C     T  L    C C   W G+ C +D N C +NP  C+N G C N  N      YRC CK GFKG +C+     C  N C N G C  +V+   Y C C   + G  CQ     C  NPC   + C        F C C PG+ G+ C +D DEC SKPC+N G+C +    ++C CP GFSG  C+ + NDC    C NG  C+D  N   C+C  G+ G  C  ++NEC +++PC N G C D   SY C C A + G  C   I          +C  + C N G C+  +NS                   ++C C  GFTG  C
Sbjct:  669 VCSPGFTGQRCN--IDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNP-CIHGNC-----TGGLSGYKCLCDAGWVGVNCEVDKNECLSNP--CQNGGTCNNLVN-----GYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVS--GYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNEC-LSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNI---------DECTESSCFNGGTCVDGINS-------------------FSCLCPVGFTGPFC 1022          

HSP 4 Score: 176.792 bits (447), Expect = 4.453e-44
Identity = 137/437 (31.35%), Postives = 196/437 (44.85%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVV---CLKKCINGA-CVG-PN--QCRCQTGWTGDSCDQ----CIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITD------------------------------------KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPG--SYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +C  G++G  C   +       C+NGA C+  PN  +C+C TG+TG  CD+    C P P C HG C+       +   TC C   + G  C+  ++ C ++P  C N+G C++  N      Y+C C+PG  G +CE    +C  N C +G  C   +N  +Y C C   F G RC  +   C  NPC   + CI D                                      SG+KC C  G++G NCE+D++EC S PC NGG C +  +G+ C C  GF G  CQVN ++C    C+N   C D  +   C C   +TG+ C   +  C+ N PC N  +C + P   S+ C C   W G+ C + +          +C+  PC NNG+C                     G Y C+C PGF+G  CE+ I
Sbjct:  519 LCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDP-CHHGQCQ-----DGIDSYTCICNPGYMGAICSDQIDECYSSP--CLNDGRCIDLVN-----GYQCNCQPGTSGLNCEINFDDCASNPCMHG-VCVDGIN--RYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPN-PCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDV---------DECISKPCMNNGVC-----------------HNTQGSYVCECPPGFSGMDCEEDI 912          

HSP 5 Score: 173.711 bits (439), Expect = 3.775e-43
Identity = 142/424 (33.49%), Postives = 199/424 (46.93%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVV-------CLK--KCINGACVGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRAN--RIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLP-------------TSVNIPNNEYFKPIG------GPYTCKCNPGFTGDLCEKVI 1887
            IC+ GY G+ C   +       CL   +CI+   V   QC CQ G +G +C    D C   P C+HG C  D   +     +C C   + G  CNID++ C++NP  C     C+N  N      +RCIC  G     C    + C+ N C +G  C   ++  K +CD    + G  C+ ++  C  NPC     C  +  +G++C C  GF G NC+++ DEC+S PCLN G C D  SG+ C C + ++G  CQ     C    C N A C +  N     C C  GW G+ C  +++EC I++PC+NNG+C +T GSY C+C   +SG  C   I           CL NPC+N G C+  +N+               T +N   +E  K  G        YTC C  GF G  CE  I
Sbjct:  594 ICNPGYMGAICSDQIDECYSSPCLNDGRCID--LVNGYQCNCQPGTSGLNCEINFDDCASNP-CMHGVC-VDGINR----YSCVCSPGFTGQRCNIDIDECASNP--CRKGATCINDVN-----GFRCICPEGPHHPSCYSQVNECLSNPCIHG-NCTGGLSGYKCLCD--AGWVGVNCEVDKNECLSNPCQNGGTC-NNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDEC-ISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDI---------NDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNI 988          

HSP 6 Score: 173.711 bits (439), Expect = 4.365e-43
Identity = 147/484 (30.37%), Postives = 201/484 (41.53%), Query Frame = 1
Query:  604 LLVSFRYTCSQNYHGEECDK-----LCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCL---KKCINGACV--GPN----QCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINEC---------AINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI------------------------VVP-----NINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            L+  +R TC + + G  C          P  N+   ++  S     C   Y+G  C  V+       C N A     PN     C C  GW G  C    D+CI  P   +G C   + +       C C   + GM C  D+N C  NP  C+N G C++  N      + C C PGF G  C+   + C+   C NGG C   VN+  Y C CP  F+G  C+ N   C ++ C     C+ D  + F C CP GF G  C  D +ECSS PCLN G C+D    + C+CP+G++G  CQ   N C +  C N   C+    R  C C  GW G  C+     C          +   C ++GICI+   ++ CQC   ++G +C  ++                         VP     N  Y   +C   PC+N G CI       VN     +FK       C C PG  G LCE+ I
Sbjct:  775 LVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGS-----YVCECPPGFSGMDCEEDINDCLANP--CQNGGSCVDHVNT-----FSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNS--YTCTCPAGFHGVHCENNIDECTESSCFNGGTCV-DGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCI-----DLVN-----HFK-------CSCPPGTRGLLCEENI 1226          

HSP 7 Score: 162.54 bits (410), Expect = 1.084e-39
Identity = 143/433 (33.03%), Postives = 193/433 (44.57%), Query Frame = 1
Query:  712 NGDRICH--TGYSGSYCDKVV--CLKKCIN-----GACV---GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRC--------------------------QCQATWSGQ--FCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            NG  IC    GY G+ C + V  C     N     G CV   G   C C  G+ G  C+  I    C    C+ D T   ++   TC C   + G+ C +++N C +NP  C N G+C++  N     +++C+C PGF G  C+    +C    C NG KC  +   N Y C C   F G  C  N  +CD +PC  + +C  D    + C C PG++G  C    DEC S PCLN G CID  +G+ C C  G SG  C++N +DC    CM+G  C+D  NR  C C+ G+TG+ CN +I+ECA N PC     CI+    +RC                           C    SG    C+   V  N    + +CL NPC+N G C         N+ N          Y C C  GF G  C+  I
Sbjct:  396 NGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINE--CHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEVNECQSNP--CVNNGQCVDKVN-----RFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDH--PNGYECQCATGFTGILCDENIDNCDPDPC-HHGQC-QDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGV-CVDGINRYSCVCSPGFTGQRCNIDIDECASN-PCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTC--------NNLVNG---------YRCTCKKGFKGYNCQVNI 796          

HSP 8 Score: 159.844 bits (403), Expect = 7.433e-39
Identity = 130/425 (30.59%), Postives = 189/425 (44.47%), Query Frame = 1
Query:  727 CHTGYSGSYCD-KVVCLK-KCINGA-CV-----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLT--CNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNC-IINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC--QKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI----IANSSIVMYSEPQITTEGFLY 1950
            C  G+ G YC  +  C K +C NG  CV     G   CRC  G+TG+ C     +P  V   C+   T   L   T  C C+  + G  C    + C ++P  CEN   C +  +     Q+ C C  G  G  CE   + C I  +C +GG C +N+    Y C CP+ F G  C      C  +PCV    C       F+C C PGF G  CE + D+C +  C NGG+C+D  + + C CP  ++G  C  + ++C  Q  +C NG  C +R     C C  GW+G  C++NI++CA    C     CID   S+ C C    +G  C          +L+  C+ NPC    +C  N               P+ G Y C C  G+ G  C + +    +ANS+   ++   + T+G  +
Sbjct:   53 CPEGFLGEYCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQW-TDACLSHP--CENGSTCTSVAS-----QFSCKCPAGLTGQKCEADINECDIPGRCQHGGTC-LNL-PGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYAS-CTPGSTCIDRVASFSCLCPEGKAGLLC----------HLDDACISNPCHKGALCDTN---------------PLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFH 441          

HSP 9 Score: 158.303 bits (399), Expect = 2.066e-38
Identity = 136/480 (28.33%), Postives = 201/480 (41.88%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRI------CHTGYSGSYCDKVV-------CLKK--CINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNP--------NVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKP-CLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAK--CMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI---DTPGSYRCQCQATWSGQFC--------------------NLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSS 1902
            S+  TC   +HG  C+        E   +N  +  D I      C  G++G +C   +       CL    C++G  +G  +C C  G+TG +C   +    C    C+   T  +E     C C   W G +C++    C            ++C++ G C+N GN      + C C  G+ G++CE+    C  N C +G  C  N     Y C+C   + G  C++    C + PC     CI D  + FKC CPPG  G  CE + DEC+  P CLNGG C+DR  G+ C C  GF+G+RC+ + N+C    C +     C+   N  +C C + +TGR C   ++ C   +PCLN G C    + P  + C+C   +SG  C                      +    N    E  C  NPC++ G C     P                 Y+C+C P F G  CE      S+
Sbjct:  970 SYTCTCPAGFHGVHCENNID-ECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDG--LGTYRCICPLGYTGKNCQTLVNL--CSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNT-----HHCQCPLGYTGSYCEEQLDECASNPCQHGATC--NDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCI-DLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCP-QKPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQPPH---------------YSCRCPPSFGGSHCELYTAPTST 1420          

HSP 10 Score: 156.377 bits (394), Expect = 8.934e-38
Identity = 133/405 (32.84%), Postives = 180/405 (44.44%), Query Frame = 1
Query:  727 CHTGYSGSYC--DKVVCLKK-CINGAC----VGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCD----------DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            CH G+ G  C  D   CL + C NG      V    C C  G+ G  C+  I    C   SC    T  + +   +C C   + G FC  D+N CS+NP  C N G C++   + T   YRCIC  G+ G +C+ + + C  + C N G C       +  C CP  + G  C     SC           ++ C  +  CI    +   C+CP G+ G  CE   DEC+S PC +G  C D   G+ C C  G+ G  C+   ++CQ   C NG  C+D  N   C C  G  G +C +NI+ECA    CLN G C+D  G Y C+C   ++G+ C   I          +CL NPC + G     SL   V + NN         Y C C   FTG  CE  +
Sbjct:  937 CHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDE--CTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNP--CLNAGTCVD--GLGT---YRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCV--QEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNT-HHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGERCEGDI---------NECLSNPCSSEG-----SL-DCVQLKNN---------YNCICRSAFTGRHCETFL 1305          

HSP 11 Score: 98.9821 bits (245), Expect = 2.686e-20
Identity = 110/405 (27.16%), Postives = 164/405 (40.49%), Query Frame = 1
Query:  628 CSQNYHGEECDKL---CKPSANERGF---YNCSSNGDRI---------CHTGYSGSYCDKVVCLKKCINGAC---------VGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLN-FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSEC--ITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKL----SCMNGAKCMDRAN--RIDCECTTGWTGRMCNQNINECAI------NQPCLN---NGICIDTPGSYRCQCQATWSGQFCNLKIVVPNIN 1713
            C   + G  CD L   CK +A ++G    + C  +G  I         C  GY+GSYC++   L +C +  C         +G  +C C  G+ G +C+  +    C +  C+   T  +L+    C+C     G+ C  +++ C+  P+ C N G+C++  G       Y C C PGF G  CE   + C+ N C + G        N Y C C  +F G  C+     C   PC+    C   ++   GF C+CPPGF G  C   +  C    C  G  CI   SG  C C          +N  DC+       C +G  C  +       C C   + G  C       +       +Q C +   +GIC +   S+ CQ    W G  C+L +  P  N
Sbjct: 1089 CPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQ--LDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDE--CQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPH-CLNGGQCVDRIGG------YTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNMPDGFICRCPPGFSGARC---QSSCGQVKCRRGEQCIHTDSGPRCFC----------LNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDGICDEACNSHACQ----WDGGDCSLTMEDPWAN 1465          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q9IAT6|DLLC_DANRE (Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 9.656e-90
Identity = 182/516 (35.27%), Postives = 254/516 (49.22%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI---KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLK 1692
            S GVFE+ +  +T               +S    S DC IF  +CL      I  + P  Y   + E      IL   +++ S     S+    +W    ++I++    +  D  T+ N  +++  +++  +  S  W   Q        QL  S+R  C + YHGEEC   C+P  +  G +NC + G+RIC  G+ G YC + +CL  C   NG C  P +C+C+ GW G  CD+C  +PGC+HG+C          P  C CK+ WGG+FCN DLN+C+N+   C N+  C N G       Y CICKPGF G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C D PC     C+   +  + C+CPPG++G NCE   D CSS PC NGG C+D  +   C C  GF+G RC+ N +DC    C N   C+D  N   C CT G++G+ C    + C+   PC N G C        CQC A + G  C  K
Sbjct:   20 SSGVFELKVLSFT-------------STSSVCKGSSDCQIFFRVCLKHSQALILPEPPCTYGTGMSE------ILSADSISSSAY--ISVPFNFKWPGIVSLIIETWNAETSDQSTENNNNMISRLATKRRLAISEDW--SQDVHLGRQSQLRFSYRVVCDEFYHGEECSDFCRPRNDTFGHFNCDAAGNRICLPGWKGDYCTEPICLSGCSEENGYCEAPGECKCRIGWEGPLCDECTRHPGCLHGTCN--------QPFQCTCKEGWGGLFCNEDLNFCTNH-KPCRNDATCTNTGQ----GSYTCICKPGFSGKNCEIETNECDSNPCKNGGSC--NDQENDYTCTCPQGFYGKNCEVSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDPCANGGQCLDLGNKATCRCRPGFTGSRCETNIDDCSSNPCQNAGTCVDGINGYTCTCTLGFSGKDCRVRSDACSF-MPCQNGGTCYTHFSGPVCQCPAGFMGTQCEYK 496          

HSP 2 Score: 105.916 bits (263), Expect = 5.842e-22
Identity = 88/294 (29.93%), Postives = 123/294 (41.84%), Query Frame = 1
Query: 1033 FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN------KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            FG+   +     IC PG+KG +C   E  C+         C   G+CK  +     +CD                C  +P   +  C       F+C C  G+ G  C  D + C++ KPC N   C +   G + C+C  GFSG  C++  N+C    C NG  C D+ N   C C  G+ G+ C  +   CA + PC N G C++   GSY C+C   + G  C  KI          +C  +PC N G C+                  +G   TC+C PGFTG  CE  I
Sbjct:  176 FGHFNCDAAGNRICLPGWKGDYC--TEPICLSGCSEENGYCEAPGECKCRIGWEGPLCD---------------ECTRHPGCLHGTC----NQPFQCTCKEGWGGLFCNEDLNFCTNHKPCRNDATCTNTGQGSYTCICKPGFSGKNCEIETNECDSNPCKNGGSCNDQENDYTCTCPQGFYGKNCEVSAMTCA-DGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKI---------DRCSSDPCANGGQCL-----------------DLGNKATCRCRPGFTGSRCETNI 421          

HSP 3 Score: 67.781 bits (164), Expect = 4.393e-10
Identity = 56/183 (30.60%), Postives = 78/183 (42.62%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLKKCINGACV----------GPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQ 1233
            C  G+ G  C+  V    C +G C           G   CRC  G+ G +C    D+C   P C +G    D   K     TC C+  + G  C  +++ CS+NP  C+N G C++  N      Y C C  GF G  C      C    C NGG C  + +    +C CP  F G +C++ Q
Sbjct:  331 CPQGFYGKNCE--VSAMTCADGPCFNGGTCMEKGSGSYSCRCPPGYMGSNCEKKIDRCSSDP-CANGGQCLDLGNKA----TCRCRPGFTGSRCETNIDDCSSNP--CQNAGTCVDGIN-----GYTCTCTLGFSGKDCRVRSDACSFMPCQNGGTCYTHFS--GPVCQCPAGFMGTQCEYKQ 497          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|P97677|DLL1_RAT (Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.039e-86
Identity = 175/528 (33.14%), Postives = 256/528 (48.48%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRER------WKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCIN--GACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYL 1719
            S GVFE+ ++++     L  N+ C  R  S   C+  C  F  +CL  YQ +      C  G        + +++L D    D +     R      W   F++I++  H D    L T+    +++  +++  +     W     S+ +    L  S+R+ C ++Y+GE C   C+P  +  G + C   G+++C  G+ G YC   +CL  C +  G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C+PG+ GA+CE     C  + C NGG C    ++  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C CP GF G NCE   D CSS PC NG  C+D  + +LC C  GFSG  C+ N +DC    C NG  C D  N   C C  G+TGR C+  ++ C  + PC N   C      Y C+C   + G  C   +  P  + +
Sbjct:   21 SSGVFELKLQEFVNKKGLLGNRNC-CRGGSGPPCA--CRTFFRVCLKHYQASVSPEPPCTYGSAVTAVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLTTQRHLTVGEEWSQDLHSSGRT--DLRYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCRNGATCTNTGQ----GSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDS--YSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPAGFSGFNCEKKIDLCSSSPCSNGAKCVDLGNSYLCRCQTGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGRNCSAPVSRCE-HAPCHNGATCHQRGQRYMCECAQGYGGANCQFLLPEPPPDLI 527          

HSP 2 Score: 95.5153 bits (236), Expect = 1.215e-18
Identity = 81/295 (27.46%), Postives = 119/295 (40.34%), Query Frame = 1
Query: 1033 FGNIKTNQQYRCICKPGFKGAHCEKVEHNCIIN------KCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDK-TSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP-GSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            FG+    ++   +C PG+KG +C   +  C+         C   G+CK  V      CD                     C+    C+       ++C C  G+ G  C  D + C+  KPC NG  C +   G + C C  G++G  C++  ++C    C NG  C D  +   C C  G+ G++C  +   CA + PC N G C D P G Y C C A +SG  C  KI +         C  +PC N   C+                  +G  Y C+C  GF+G  CE  +
Sbjct:  198 FGHFTCGERGEKMCDPGWKGQYC--TDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCD--------------------ECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCRNGGSCTDLEDSYSCTCPPGFYGKVCELSAMTCA-DGPCFNGGRCSDNPDGGYTCHCPAGFSGFNCEKKIDL---------CSSSPCSNGAKCV-----------------DLGNSYLCRCQTGFSGRYCEDNV 443          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|O57409|DLLB_DANRE (Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.942e-86
Identity = 183/555 (32.97%), Postives = 255/555 (45.95%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI-------KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNI 1797
            S GVFE+ +  ++                     + DCNIF  ICL      I  + P  +    G+T +      + A + +++  +      +W   F++I++        +H+D    +N +I  L++          W   Q     D  +L  S+   C + Y GE C   C+P  +  G Y C  NG++ C  G+ G YC   +C   C   +G C  P +C+C+ GW G SC +C+ YPGC+HG+C          P  C CK+ WGG+FCN DLNYC+N+   C N   C N G       Y C C+PGF G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+    +C D+PC     C    T G+ C+CPP F G NCE   D CS KPC NGG C+D  +  LC C  GFSG RC+ N +DC +  C N   C D  N   C CT G+TG+ C+   + C  N PCL+ G C        CQC   + G  C   +         R    +P      C+L  L   + +
Sbjct:   20 SSGVFELKVHSFST-------------TRRFCRRTRDCNIFFRICLKHSEDVISAEPPCTFG--TGQTSVLRADQSSIASSAAIRVPFHF----KWPGTFSLIIEAWNAESPKEHHDYTENQNNLISRLATRRRLAVGED-W--SQDVHFGDQSELRYSYHVFCDEFYFGEACSDYCRPRDDTLGHYTCDENGNKECLVGWQGDYCSDPICSSDCSERHGYCESPGECKCRLGWQGPSCSECVHYPGCLHGTCS--------QPWQCVCKEGWGGLFCNQDLNYCTNH-KPCANGATCTNTGQ----GSYTCTCRPGFGGTNCELEINECDCNPCKNGGSC--NDLENDYSCTCPQGFYGKNCEIIAMTCADDPCFNGGTCEEKFTGGYVCRCPPTFTGSNCEKRLDRCSHKPCANGGECVDLGASALCRCRPGFSGSRCETNIDDCARYPCQNAGTCQDGINDYTCTCTLGFTGKNCSLRADACLTN-PCLHGGTCFTHFSGPVCQCVPGFMGSTCEFPVQASLEKMAPRVGQTSPSAVAVSCVLGVLAVFLGV 536          

HSP 2 Score: 88.1965 bits (217), Expect = 1.710e-16
Identity = 63/200 (31.50%), Postives = 88/200 (44.00%), Query Frame = 1
Query: 1297 FKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            ++C C  G+ G  C  D + C++ KPC NG  C +   G + C C  GF G  C++  N+C    C NG  C D  N   C C  G+ G+ C      CA + PC N G C +   G Y C+C  T++G  C  ++          +C   PC N G C+                  +G    C+C PGF+G  CE  I
Sbjct:  254 WQCVCKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGFGGTNCELEINECDCNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIIAMTCA-DDPCFNGGTCEEKFTGGYVCRCPPTFTGSNCEKRL---------DRCSHKPCANGGECV-----------------DLGASALCRCRPGFSGSRCETNI 426          

HSP 3 Score: 67.781 bits (164), Expect = 4.791e-10
Identity = 76/264 (28.79%), Postives = 99/264 (37.50%), Query Frame = 1
Query: 1192 CPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGF---------------------KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C E ++G+ C              +CD+N   GN EC+      +                     +CKC  G+ G +C     EC   P    G C  +P  + CVC  G+ G  C  + N C     C NGA C +       C C  G+ G  C   INEC  N PC N G C D    Y C C   + G+ C +         +   C  +PC N G C              E F    G Y C+C P FTG  CEK +
Sbjct:  161 CDEFYFGEACSDYCRPRDDTLGHYTCDEN---GNKECLVGWQGDYCSDPICSSDCSERHGYCESPGECKCRLGWQGPSCS----ECVHYPGCLHGTC-SQP--WQCVCKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGFGGTNCELEINECDCN-PCKNGGSCNDLENDYSCTCPQGFYGKNCEI---------IAMTCADDPCFNGGTC-------------EEKFT---GGYVCRCPPTFTGSNCEKRL 388          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q6DI48|DLLA_DANRE (Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 3.373e-85
Identity = 175/523 (33.46%), Postives = 257/523 (49.14%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPH-RYACDIGETYIKT---------DILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            S GVFE+ ++++     +  NK C     +T+    +C  F  ICL  YQ N      C  G T             D L + +  + ++ ++       W   F++I++  H D    L T+    I++  +++  +     W     S  +   +L  S+R+ C ++Y+GE C   C+P  +  G + C   G+ IC  G+ G YC + +CL  C   +G C  P +C+C+ G+ G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C+PGF GA CE   + C  N C NGG C    NT  Y C CP  FYG  C+ +  +C D PC     C  +   G+ C+CP G+ G NCE   D CSS PC NG  C+D  + +LC CP GF+G  C    ++C    C NG  C + A+   C C  G+TGR C+  ++ C  N PC N   C +    Y C C + + G+ C   +
Sbjct:   22 SSGVFELKLQEFLNKKGVQGNKNCCKGGLTTSYQQCECKTFFRICLKHYQPNASPEPPCTYGGTVTPVLGSNSFQVPDTLPDGSFTNPIRMNFGFT----WPGTFSLIIEALHADSKEDLTTENPERIISTMTTQRHLTVGEDWSQDLHSVGRT--ELKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICDAGWKGQYCTEPICLPGCDEEHGFCEKPGECKCRVGFKGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCSNTGQ----GSYTCSCRPGFSGASCEIEVNECTGNPCRNGGSCTDMENT--YSCTCPPGFYGKNCELSAMTCADGPCFNGGRCADNPDGGYFCQCPTGYAGFNCEKKIDHCSSSPCSNGARCVDLVNSYLCQCPDGFTGMNCDRAGDECSMYPCQNGGTCQEGASGYMCTCPPGYTGRNCSSPVSRCQHN-PCHNGATCHERNNRYVCACVSGYGGRNCQFLL 522          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|O00548|DLL1_HUMAN (Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2)

HSP 1 Score: 295.819 bits (756), Expect = 3.829e-85
Identity = 173/525 (32.95%), Postives = 256/525 (48.76%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRER------WKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNI 1710
            S GVFE+ ++++     L  N+ C         C+  C  F  +CL  YQ +      C  G        + +++L D    D +     R      W   F++I++  H D    L T+    +++  +++  +     W     S+ +    L  S+R+ C ++Y+GE C   C+P  +  G + C   G+++C+ G+ G YC + +CL  C   +G C  P +C+C+ GW G  CD+CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C+N   C N G       Y C C+PG+ GA CE     C  + C NGG C    N+  Y C CP  FYG  C+ +  +C D PC     C      G+ C+CP G+ G NCE   D CSS PC NG  C+D    +LC C  GFSG  C  N +DC    C NG  C D  N   C C  G+TGR C+  ++ C  + PC N   C +    Y C+C   + G   N + ++P +
Sbjct:   21 SSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCA--CRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRT--DLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCKNGATCTNTGQ----GSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENS--YSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCE-HAPCHNGATCHERGHRYVCECARGYGGP--NCQFLLPEL 523          

HSP 2 Score: 124.405 bits (311), Expect = 1.200e-27
Identity = 91/321 (28.35%), Postives = 133/321 (41.43%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR-IDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C   W G +C   I L  C      C+  GEC               C+ G++G +C++         C     C        + C+C E + G  C  +   C  + PC   + C       + C C PG+ G  CE+  DEC   PC NGG C D  + + C CP GF G  C+++   C    C NG +C D  +    C C  G++G  C + I+ C+ + PC N   C+D   +Y C+CQA +SG+ C+  +           C  +PC N G C        VN             ++C C PG+TG  C   +
Sbjct:  212 CNPGWKGPYCTEPICLPGCDEQHGFCDKPGECK--------------CRVGWQGRYCDE---------CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCS-SSPCSNGAKCVDLGDAYLCRCQAGFSGRHCDDNV---------DDCASSPCANGGTCR-----DGVND------------FSCTCPPGYTGRNCSAPV 482          

HSP 3 Score: 70.4774 bits (171), Expect = 7.160e-11
Identity = 80/266 (30.08%), Postives = 106/266 (39.85%), Query Frame = 1
Query: 1177 KYICDCPESFYGDRCQ---------FNQTSCDD------NPCVGNSECIT-------DKTSGF-----KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC-QKLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            +++CD  E +YG+ C          F   +C +      NP      C         D+  GF     +CKC  G+ GR C    DEC   P    G C  +P  + C C  G+ G  C  + N C     C NGA C +       C C  G+TG  C   I+EC  + PC N G C D   SY C C   + G+ C L  +          C   PC N G C  +               P GG Y+C+C  G++G  CEK I
Sbjct:  176 RFVCD--EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYC----DECIRYPGCLHGTC-QQP--WQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPS-PCKNGGSCTDLENSYSCTCPPGFYGKICELSAMT---------CADGPCFNGGRCSDS---------------PDGG-YSCRCPVGYSGFNCEKKI 406          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A0N7Z9Z0 (Delta-like protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 8.355e-101
Identity = 202/607 (33.28%), Postives = 297/607 (48.93%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNL-NKCCPTRKNSTNSCSEDCNIFMEICLSIYQK--NPHRYACDIGETYIKTDILG-------NYALNDSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSG--SYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEG 1941
            +  VFE+ +K +      ++   CC   +++   CS  CN    +CL +YQ+  +P+   C  GE    T +LG       N A +DS   +    +   W+  F++I++  H D           V++T   ++  +    SW      T  DH  L   +R  C ++Y+GE C K C+P  +  G Y C++ GD +C  G+ G   YC   +C + C   +G C  P++C+C +GW G +CDQC  YPGC+HGSC          P  CNC + WGG+FCN DL+YC+N+   C+N   C N         Y C C PGF G +CE +   C    C NGG C ++   + ++C CP  + G  CQ +  SC D PC   + C TD  +G+ C C  GF G NCE   +EC+S PCLNGG C+D   GF CVCPVG++G RCQ N +DC    C+NG  C+D  +   C C  G+ G++C  N+++C    PC N G+C D    ++CQC+A W G+ C  ++  P        C   PC+N G C              +    +   Y C C  G  G  C    +    +V   + +  + G
Sbjct:   26 ANAVFELKLKHFVNSYGRDIKGHCCSGYRDTQGQCSGGCNTKFRVCLKVYQEIIDPNS-PCTFGEA--TTPVLGENDVDFSNLAQDDSEFDNPVRFMLASWQGTFSLIIEAWHDDGTNATTNYAGPVLITRLMTQRSLDLGESWNEDDHRT--DHASLSYEYRVVCQEHYYGEGCRKSCRPRDDTFGHYLCNATGDLVCMEGWKGIEGYCVDPICREGCSITSGYCHKPDECKCLSGWQGPNCDQCKKYPGCLHGSCD--------TPWQCNCDEGWGGLFCNQDLHYCTNH-RPCKNGATCFN----TAPGSYSCECPPGFSGTNCEIINDTCATTPCRNGGTC-LDTGDDNFVCQCPSGYTGQYCQISGQSCADRPCQHGATC-TDTNTGYHCLCRAGFEGTNCERAVNECASDPCLNGGSCVDEHDGFQCVCPVGYTGPRCQTNIDDCAHRPCLNGGTCVDAVDSYVCRCVPGFVGKLCQTNVDDCRA-APCANGGVCQDRVNDFQCQCKAGWGGRQCTERVTSP--------CASGPCKNGGYC--------------QEAADLAAGYRCSCPHGVGGPQCTIATVVAGDVVSRPDAEAMSAG 589          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A385Z8N9 (Delta-like protein OS=Penaeus vannamei OX=6689 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.401e-99
Identity = 204/616 (33.12%), Postives = 297/616 (48.21%), Query Frame = 1
Query:  175 SKGVFEIHIKKYT-LFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQK--NPHRYACDIGETYIKTDILGNYALNDSVK-----RDYSILVRERWKRNFNIIVKIKHYDLITKKNVV---IVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSG--SYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFLYKSRIANRPM 1977
            +  VFE+ +KK++  F       CC   +NS   C+  C     +CL +YQ+  +P    C  GE   +T +LG+  ++ S       R+        W+  F++I++  H +  T    V   ++T    +  +     W      T   H  L   FR TC +NY+GE C K CKP  +  G Y C   G+ +C  G+ G  +YC K +C   C    G C  PN+C+C +GW G +CDQC  YPGC+HG+C             CNC + WGG+FCN DLN+C+N+   C+N   C N         Y C C PGF G  CE +   C    C NGG C ++   ++++C CP  F G  C+ +  SC D PC+  + C +D  +G++C C  G+ G +CE   +EC+S PCLNGG C+D   GF CVCPVG++GDRCQ N +DC    C+NG  C+D  +   C C  G+ G +C  N+++C   QPC N G C+D    + C+C+  W G+ C  ++ VP        C   PC N G C        V  P       +   + C C  G  G  C  V      + + + P    +  L  +     P+
Sbjct:   26 ANAVFELRLKKFSNRFGKDTEGHCCSGYRNSQGHCTGTCKTKFRVCLKVYQEVIDPES-PCTFGEA--ETPVLGDNEVDFSKVDLQGFRNPVPFELASWQGTFSLIIEAWHEEPNTTATYVEPALITRLMIQRWLDLGEEWTGDDHRT--SHSSLSYEFRVTCQENYYGEGCRKWCKPRNDSFGRYVCDDQGEYVCLDGWQGPDNYCLKPICSPGCHESTGYCDQPNECKCHSGWKGPNCDQCQVYPGCLHGTCEKQ--------WQCNCIEGWGGLFCNQDLNFCTNH-RPCKNGATCFN----TAPGSYSCECPPGFSGTICEIINDTCANTPCRNGGTC-LDAGDDQFVCQCPSGFTGQYCEISGQSCSDRPCLNGASC-SDTATGYECHCRAGYEGTSCERPVNECASDPCLNGGSCVDEHDGFQCVCPVGYTGDRCQTNVDDCAHRPCLNGGTCIDGLDSFTCRCIPGFLGTLCQTNVDDCR-TQPCANGGTCVDGVNDFSCECRPGWGGRQCTTRVPVP-----VSPCASAPCHNGGYC--------VEAPE------LAVGFQCTCPSGLGGPFCTVVTKPAPQVDVDASPMSAAQVVLVVTFSVAVPV 601          
BLAST of Delta-like protein vs. TrEMBL
Match: A0MK38 (Delta-like protein OS=Parhyale hawaiensis OX=317513 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 2.216e-98
Identity = 199/553 (35.99%), Postives = 287/553 (51.90%), Query Frame = 1
Query:  154 FSQPVQCSKGVFEIHIKKYTLFPTLNL-NKCCPTRKNSTNSCSEDCNIFMEICLSIYQKN-PHRYACDIGETYIKTDILGNYALNDSVKRDYSIL-----VRERWKRNFNIIVKIKHYDLITK--KNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYS--GSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI---DTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGIC 1764
             SQ V  S  +FE+ +K +      N    CC   +N++  CSE C     +CL +YQ+   +R  C  GE  I T +LG   ++ S       +       + W+  F++I++  H    T    + V+V    ++  +     W   + ST  DH  L   +R  C ++Y+G+ C K C+P  +  G Y C S+G+  C  G+     YC+   C   C    G C  PNQC+C  GW G++CDQC+ YPGC HG+C          P  C C + WGG+FCN+DLNYC+N+   C+N   C N     +   Y C C PGF G +CE   H C  + C NGG C ++   + ++C CP  F G  C  +  +C D PC+ N  C+ D  SGF+C+CPPGF G  C+I  +EC S PC NGG C+D  +GF CVC  G++G +C+ N+NDC +  C+N   C+D  N   C+C  G+ G +C ++I  C  + PC N GICI   D    +RC C++ W G+ CN     P +N     C  +PC+N GIC
Sbjct:   17 LSQQVS-SNAIFELQLKSFLNHKGYNSEGHCCNGFRNTSGRCSEKCLTKFRVCLKVYQEVIDYRSPCTFGE--INTPVLGENEIDFSQVHTEGFVNPVQFSLDSWQDTFSLIIEAWHEGNTTDPIADAVLVQRLMTQRSLDVDPVWSVHEEST--DHSTLSYQYRVVCQEHYYGKGCRKWCRPRDDSFGHYVCDSDGNIKCLDGWQEPQGYCNTPTCRPGCHPKQGFCEKPNQCQCHLGWQGENCDQCMIYPGCDHGTCN--------SPWECTCDEGWGGLFCNLDLNYCTNH-KPCKNGATCFN----TSPGSYSCQCPPGFSGTNCEVTNHTCATDPCLNGGTC-LDTGDDGFVCQCPTGFTGQYCHISGKTCSDRPCLNNGACL-DTKSGFQCQCPPGFEGETCQIAVNECDSNPCFNGGSCVDEHAGFTCVCSPGYTGKQCETNRNDCVQKPCLNNGVCIDGINSFKCQCPRGFYGELC-ESIEACG-SAPCANGGICIPTFDGTTKFRCNCKSGWGGRLCNQ----PKVN--SSPCESSPCQNGGIC 541          

HSP 2 Score: 146.747 bits (369), Expect = 5.077e-32
Identity = 89/284 (31.34%), Postives = 133/284 (46.83%), Query Frame = 1
Query: 1063 RCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDR-PSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSS 1902
            +C C  G++G +C++    C+I    + G C      + + C C E + G  C  +   C ++ PC   + C       + C+CPPGF G NCE+    C++ PCLNGG C+D    GF+C CP GF+G  C ++   C    C+N   C+D  +   C+C  G+ G  C   +NEC  N PC N G C+D    + C C   ++G+ C               C+  PC NNG+CI  +NS                   + C+C  GF G+LCE +    S+
Sbjct:  244 QCQCHLGWQGENCDQ----CMIYPGCDHGTCN-----SPWECTCDEGWGGLFCNLDLNYCTNHKPCKNGATCFNTSPGSYSCQCPPGFSGTNCEVTNHTCATDPCLNGGTCLDTGDDGFVCQCPTGFTGQYCHISGKTCSDRPCLNNGACLDTKSGFQCQCPPGFEGETCQIAVNECDSN-PCFNGGSCVDEHAGFTCVCSPGYTGKQCETN---------RNDCVQKPCLNNGVCIDGINS-------------------FKCQCPRGFYGELCESIEACGSA 489          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A1Y1KDN6 (Delta-like protein OS=Photinus pyralis OX=7054 GN=PPYR_05535 PE=4 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 5.352e-98
Identity = 213/630 (33.81%), Postives = 313/630 (49.68%), Query Frame = 1
Query:  175 SKGVFEIHIKKY-TLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILGNYALNDSVKRDYSILVRER----WKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI----------------------LNSLPTSVNIPNNEYFKPIGGP--YTCKCNPGFTGDLCEKVIIANS-SIVMYSEPQITTEGFLYKSRIA 1965
            S GVFE+ +K +       +L KCC  +    + CS+ C+    +CL  Y+ N    + C  G+  + T +LG    ND+ +  +   +R      W   F++IV+  H +L +   V+I  L            W T+ L   K +  L   +R TC Q+Y+G+ C+  C+P  +  G Y CS+ GDR+C +G++G YC K  CL  C   +G C  PN+C+CQ+GW G  C++C  YPGC+HG+C        + P  C C + WGG+FCN DLN+C+N+   C N G C N G       Y C C P F G+ CE   ++C    C NGG C  + N   +IC CP  F G  C     SCD  PC  +  C+ D   G+ CKC  GF+G NCE   + C   PCLN G C+   +GF C CP GF+G RC+ N +DCQ   C+NG  C+D+ N   C+C  G+ G +C   ++ C   +PC N G CI     YRC+C   ++G+ C+ ++ +         C   PCRN G C+                      L+++      P       I G   + C+C PG+ G  CE++  + S S  + S+ Q+TTE  +  + I+
Sbjct:   20 SSGVFELRLKSFDNEAGKDDLGKCCSGKLGENSECSDYCHPRFRVCLKEYRVNIDPTSPCTFGD--VTTSVLGPNFENDTTQDGFENSIRFSFPFTWPGTFSLIVEAWHGNLTSNSGVLISRLMRQRWLDVSEE-W-TEDLHNSK-YSTLKFEYRVTCEQHYYGKGCENFCRPRDDNFGHYTCSAVGDRVCLSGWTGDYCTKARCLPGCDEQHGHCTVPNECKCQSGWEGPLCNECQRYPGCMHGTC--------VKPWDCICNEGWGGLFCNQDLNFCTNH-KPCRNGGTCRNTGP----GSYTCTCPPEFTGSECEIAINDCSTKPCLNGGTC--SPNGTYHICLCPRGFNGPHCGTAIQSCDGKPCKNDGICL-DTDRGYTCKCKAGFVGDNCEQPINHCLPNPCLNNGSCVHNANGFRCACPSGFTGHRCETNIDDCQDNPCLNGGTCVDKVNEFYCQCVPGFVGSLCQTRVDYCTT-KPCANGGTCIKLTNDYRCKCAPGFTGKDCSAELDL---------CQSQPCRNGGTCVNRVHDFECHCPGGFLGRTCEKTLSTVDQCSAHPCRNGGSCINGDSGFECRCLPGYLGLTCEEITSSVSPSAQVSSKSQLTTEHVVVIATIS 618          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A067QK07 (Delta-like protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_02310 PE=4 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 7.103e-98
Identity = 194/546 (35.53%), Postives = 294/546 (53.85%), Query Frame = 1
Query:  172 CSKGVFEIHIKKYT-LFPTLNLNKCCP-TRKNSTNSCSEDCNIFMEICLSIYQKNPHRYA-CDIGETYIKTDILG--NYALNDSVKRD-YSILVRE----RWKRNFNIIVKIKHYDLITKKN--VVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCIN--GACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNK-YICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGIC 1764
            C  GVFE+ +K +   +   ++ +CC  TR + + +CS  C     +CL  YQ N    + C  G+  + T +LG  N  L  + +RD ++  +R      W   F++IV+  H D  T ++    ++T  +++  +     W   +  +   H  +   +R TC  +Y+G  C  LC+P  +  G Y CS  GDR+C +G+ G YC K  CL  C +  G C  PN+C C +GW G  CD+C  YPGC+HGSC+         P  C C + WGG+FCN DLNYC+N+   C + G C N G       Y C C PGF G  CE+   +C  + C NGG CK+ V+  + Y C+CP+ ++G  C+ +  +C+D PC   + C  D + GF CKCP GF G +C+ + DECS  PC N   C+DR +GF C+CP GF+G+RC+ N +DC+  +C+NG  C+D  N+  C+C  G+ G +C   ++ C   +PC N G C      YRC C+  ++G+ C++ +          +C  +PC+N G C
Sbjct:    3 CCSGVFELRLKSFINDYGKDSVGQCCSGTRSSDSGACSGPCRTRFRVCLKHYQANIDTTSPCTFGD--VITPVLGENNVRLVGTAQRDGFANPIRFPFDFTWPGTFSLIVEALHDDNATSRSGGETLITRLTTQRWLDVGEEWTEDEYRS--SHAVMRYDYRVTCDAHYYGAGCANLCRPRDDSFGHYKCSPTGDRVCLSGWQGDYCTKPRCLPGCDDQHGHCNQPNECLCHSGWKGRLCDECERYPGCLHGSCQ--------KPWDCLCDEGWGGLFCNQDLNYCTNH-KPCRHGGTCFNTGQ----GSYTCSCPPGFTGTDCERKLDDCAHHSCLNGGTCKVIVSQREGYRCECPKGWHGPHCETSAQTCEDKPCKNGATC-RDTSKGFVCKCPAGFSGTDCQNEIDECSPSPCKNNASCVDRVNGFDCICPTGFTGERCETNVDDCKGNTCLNGGTCVDMVNQFRCQCVPGYIGPLCQNKVDYCQT-KPCANGGECTVLINDYRCTCRPGFTGKDCSVDV---------DECSSSPCKNGGTC 520          

HSP 2 Score: 79.337 bits (194), Expect = 3.822e-11
Identity = 72/267 (26.97%), Postives = 110/267 (41.20%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDK--------------LCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCL---KKCINGACVGPNQ----CRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNC 1338
            S+  +C   + G +C++               CK   ++R  Y C       C  G+ G +C+        K C NGA          C+C  G++G  C    D+C P P   + SC        +    C C   + G  C  +++ C  N   C N G C++  N     Q+RC C PG+ G  C+     C    C NGG+C + +N   Y C C   F G  C  +   C  +PC     C +++ + F+C CP G+ G+ C
Sbjct:  295 SYTCSCPPGFTGTDCERKLDDCAHHSCLNGGTCKVIVSQREGYRCE------CPKGWHGPHCETSAQTCEDKPCKNGATCRDTSKGFVCKCPAGFSGTDCQNEIDECSPSPCKNNASC-----VDRVNGFDCICPTGFTGERCETNVDDCKGN--TCLNGGTCVDMVN-----QFRCQCVPGYIGPLCQNKVDYCQTKPCANGGECTVLIN--DYRCTCRPGFTGKDCSVDVDECSSSPCKNGGTC-SNRVNSFQCLCPQGYHGKTC 540          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dld (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:103044307])

HSP 1 Score: 298.516 bits (763), Expect = 3.908e-87
Identity = 181/522 (34.67%), Postives = 258/522 (49.43%), Query Frame = 1
Query:  181 GVFEIHIKKY--TLFPTLNLNKCCPTRKNSTNSCSE-DCNIFMEICLSIYQKNPH-RYACDIGETYIKTDILG-------NYALNDSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
            GVFE+ ++++      T N N CC     +T+   + +C  F  ICL  YQ N      C  G     T +LG         A ++S            W   F++I++  H D    L T+    +++  +++  +     W      T +   +L  S+R+ C ++Y+GE C   C+P  +  G + C   G+ IC++G+ G YC + +CL  C   +G C  P +C+C+ G+TG  CD CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   CEN   C N G       Y C C+PGF GA CE   + C  N C NGG C    NT  Y C CP  +YG  C+ +  +C D PC     C  +   G+ C+CP G++G NCE   D CSS PC NG  C+D    +LC CP GF+G  C  N N+C    C NG  C D      C C  G+TG+ C+  +N+C  N PC N G C +    Y C C   + G  C   +
Sbjct:   23 GVFELKLQEFLNKKGNTGNTN-CCKGAAPTTSGIQQCECKTFFRICLKHYQANVSPEPPCTYGGAV--TPVLGFNSFQVPETASDNSFTNPIRFPFGFTWPGTFSLIIEALHTDSNEDLSTENPERLISRMTTQRHLTVGEEWSQDLQVTGRT--ELKYSYRFMCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFTGKYCDDCIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCENGATCTNTGQ----GSYTCACRPGFTGASCEIEVNECSDNPCRNGGSCTDMENT--YNCACPPGYYGRNCELSAMTCADGPCFNGGRCADNSEGGYFCECPTGYVGFNCEKKIDHCSSNPCSNGAQCLDLVDSYLCQCPEGFTGAHCDDNINECASYPCQNGGTCQDGLGDYTCTCLPGYTGKNCSSPVNKCVQN-PCHNGGTCHERDHRYVCACIPGYGGHNCQFLL 523          

HSP 2 Score: 73.1738 bits (178), Expect = 1.029e-12
Identity = 70/214 (32.71%), Postives = 88/214 (41.12%), Query Frame = 1
Query: 1282 DKTSGF-----KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDC-QKLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSS 1902
            D+  GF     +CKC  GF G+ C    D+C   P    G C  +P  + C C  G+ G  C  + N C     C NGA C +       C C  G+TG  C   +NEC+ N PC N G C D   +Y C C   + G+ C L  +          C   PC N G C  NS                 G Y C+C  G+ G  CEK I   SS
Sbjct:  234 DEEHGFCDKPGECKCRVGFTGKYC----DDCIRYPGCLHGTC-QQP--WQCNCQEGWGGLFCNQDLNYCTHHKPCENGATCTNTGQGSYTCACRPGFTGASCEIEVNECSDN-PCRNGGSCTDMENTYNCACPPGYYGRNCELSAMT---------CADGPCFNGGRCADNSE----------------GGYFCECPTGYVGFNCEKKIDHCSS 414          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 295.049 bits (754), Expect = 4.125e-86
Identity = 183/556 (32.91%), Postives = 272/556 (48.92%), Query Frame = 1
Query:   70 NFEIQFQSMLQLRMYSKXXXXXXXXXXYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILV--RERWKRNFNIIVKI-KHYDLITKKNV-----VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE--KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSG-FKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            +  +Q+ S++   +  +    F   L  F +P   S GVFE+ ++++     LN                    IF  +CL      I  + P  Y     ET +++D       ++S+     I V    +W   F++I+   K  +  +++++     V++ L++            + Q    ++  +LL S+   C ++Y+G+ C   C+P  +  G Y C S G+R+C  G+ G YC   +C   C   +G C  P +C+C+ GW G  CD+C  YPGC HG+C          P  C CK+ WGG+FCN DLN+C+N+   C+N+  C N G       Y C CKPGF G  CE   V   C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C + PC     CITD T+G + C+CPPG++G NCE   D CSS PC NGG+C D+   F+C C  GF G RC++N ++C +  C N   C+D  N   C+CT G+TG+ C    + C++  PC N G C        CQC   + G  C
Sbjct:   19 SIRLQWPSLIPSTVLPRCPYAFSPRLSLFIRPQVSSSGVFELKVREFHSERALN------------------SRIFFRVCLKHSQDVILPEPPCTYGAGFTET-LRSD-------HNSISSSAPIRVPFYFKWPGTFSLIIDAWKASESTSEQSIENPDNVLIRLATKRTLAVGD----SNQGKHNQNQSELLYSYHVACDEHYYGDSCSDYCRPRDDTFGHYTCDSTGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQCDECTRYPGCSHGTCD--------QPWQCICKEGWGGLFCNQDLNFCTNH-KPCKNDATCTNTGQ----GSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSC--NDMLNDYSCTCPQGFYGKNCEISAMTCAERPCFNGGTCITDDTTGGYSCRCPPGYMGSNCEKKIDRCSSNPCANGGICRDQGLSFVCQCRPGFRGSRCEINIDECARNPCRNAGTCVDGINDYTCKCTLGYTGKDCGVRSDTCSL-MPCENGGTCYTHFSGPVCQCPPGFMGSRC 528          

HSP 2 Score: 70.4774 bits (171), Expect = 8.679e-12
Identity = 74/269 (27.51%), Postives = 101/269 (37.55%), Query Frame = 1
Query: 1180 YICDCPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGF---------------------KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRA-NRIDCECTTGWTGRMCN-QNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            Y   C E +YGD C          F   +CD     GN  C+      +                     +CKC  G+ G  C    DEC+  P  + G C D+P  + C+C  G+ G  C  + N C     C N A C +       C C  G+TG+ C   N++    + PC N G C D    Y C C   + G+ C +  +          C   PC N G CI +                  G Y+C+C PG+ G  CEK I
Sbjct:  184 YHVACDEHYYGDSCSDYCRPRDDTFGHYTCDS---TGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQC----DECTRYPGCSHGTC-DQP--WQCICKEGWGGLFCNQDLNFCTNHKPCKNDATCTNTGQGSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSCNDMLNDYSCTCPQGFYGKNCEISAMT---------CAERPCFNGGTCITDD---------------TTGGYSCRCPPGYMGSNCEKKI 418          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 295.049 bits (754), Expect = 4.545e-86
Identity = 183/556 (32.91%), Postives = 272/556 (48.92%), Query Frame = 1
Query:   70 NFEIQFQSMLQLRMYSKXXXXXXXXXXYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILV--RERWKRNFNIIVKI-KHYDLITKKNV-----VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE--KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSG-FKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            +  +Q+ S++   +  +    F   L  F +P   S GVFE+ ++++     LN                    IF  +CL      I  + P  Y     ET +++D       ++S+     I V    +W   F++I+   K  +  +++++     V++ L++            + Q    ++  +LL S+   C ++Y+G+ C   C+P  +  G Y C S G+R+C  G+ G YC   +C   C   +G C  P +C+C+ GW G  CD+C  YPGC HG+C          P  C CK+ WGG+FCN DLN+C+N+   C+N+  C N G       Y C CKPGF G  CE   V   C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C + PC     CITD T+G + C+CPPG++G NCE   D CSS PC NGG+C D+   F+C C  GF G RC++N ++C +  C N   C+D  N   C+CT G+TG+ C    + C++  PC N G C        CQC   + G  C
Sbjct:   19 SIRLQWPSLIPSTVLPRCPYAFSPRLSLFIRPQVSSSGVFELKVREFHSERALN------------------SRIFFRVCLKHSQDVILPEPPCTYGAGFTET-LRSD-------HNSISSSAPIRVPFYFKWPGTFSLIIDAWKASESTSEQSIENPDNVLIRLATKRTLAVGD----SNQGKHNQNQSELLYSYHVACDEHYYGDSCSDYCRPRDDTFGHYTCDSTGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQCDECTRYPGCSHGTCD--------QPWQCICKEGWGGLFCNQDLNFCTNH-KPCKNDATCTNTGQ----GSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSC--NDMLNDYSCTCPQGFYGKNCEISAMTCAERPCFNGGTCITDDTTGGYSCRCPPGYMGSNCEKKIDRCSSNPCANGGICRDQGLSFVCQCRPGFRGSRCEINIDECARNPCRNAGTCVDGINDYTCKCTLGYTGKDCGVRSDTCSL-MPCENGGTCYTHFSGPVCQCPPGFMGSRC 528          

HSP 2 Score: 70.0922 bits (170), Expect = 9.008e-12
Identity = 74/269 (27.51%), Postives = 101/269 (37.55%), Query Frame = 1
Query: 1180 YICDCPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGF---------------------KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRA-NRIDCECTTGWTGRMCN-QNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            Y   C E +YGD C          F   +CD     GN  C+      +                     +CKC  G+ G  C    DEC+  P  + G C D+P  + C+C  G+ G  C  + N C     C N A C +       C C  G+TG+ C   N++    + PC N G C D    Y C C   + G+ C +  +          C   PC N G CI +                  G Y+C+C PG+ G  CEK I
Sbjct:  184 YHVACDEHYYGDSCSDYCRPRDDTFGHYTCDS---TGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQC----DECTRYPGCSHGTC-DQP--WQCICKEGWGGLFCNQDLNFCTNHKPCKNDATCTNTGQGSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSCNDMLNDYSCTCPQGFYGKNCEISAMT---------CAERPCFNGGTCITDD---------------TTGGYSCRCPPGYMGSNCEKKI 418          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlc (deltaC [Source:NCBI gene;Acc:30120])

HSP 1 Score: 286.189 bits (731), Expect = 3.473e-83
Identity = 170/482 (35.27%), Postives = 246/482 (51.04%), Query Frame = 1
Query:  292 IFMEICLS-----IYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILV--RERWKRNFNIIVKI-KHYDLITKKNV-----VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE--KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSG-FKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            IF  +CL      I  + P  Y     ET +++D       ++S+     I V    +W   F++I+   K  +  +++++     V++ L++            + Q    ++  +LL S+   C ++Y+G+ C   C+P  +  G Y C S G+R+C  G+ G YC   +C   C   +G C  P +C+C+ GW G  CD+C  YPGC HG+C          P  C CK+ WGG+FCN DLN+C+N+   C+N+  C N G       Y C CKPGF G  CE   V   C  N C NGG C  N   N Y C CP+ FYG  C+ +  +C + PC     CITD T+G + C+CPPG++G NCE   D CSS PC NGG+C D+   F+C C  GF G RC++N ++C +  C N   C+D  N   C+CT G+TG+ C    + C++  PC N G C        CQC   + G  C
Sbjct:   41 IFFRVCLKHSQDVILPEPPCTYGAGFTET-LRSD-------HNSISSSAPIRVPFYFKWPGTFSLIIDAWKASESTSEQSIENPDNVLIRLATKRTLAVGD----SNQGKHNQNQSELLYSYHVACDEHYYGDSCSDYCRPRDDTFGHYTCDSTGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQCDECTRYPGCSHGTCD--------QPWQCICKEGWGGLFCNQDLNFCTNH-KPCKNDATCTNTGQ----GSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSC--NDMLNDYSCTCPQGFYGKNCEISAMTCAERPCFNGGTCITDDTTGGYSCRCPPGYMGSNCEKKIDRCSSNPCANGGICRDQGLSFVCQCRPGFRGSRCEINIDECARNPCRNAGTCVDGINDYTCKCTLGYTGKDCGVRSDTCSL-MPCENGGTCYTHFSGPVCQCPPGFMGSRC 494          

HSP 2 Score: 70.0922 bits (170), Expect = 1.068e-11
Identity = 74/269 (27.51%), Postives = 101/269 (37.55%), Query Frame = 1
Query: 1180 YICDCPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGF---------------------KCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRA-NRIDCECTTGWTGRMCN-QNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            Y   C E +YGD C          F   +CD     GN  C+      +                     +CKC  G+ G  C    DEC+  P  + G C D+P  + C+C  G+ G  C  + N C     C N A C +       C C  G+TG+ C   N++    + PC N G C D    Y C C   + G+ C +  +          C   PC N G CI +                  G Y+C+C PG+ G  CEK I
Sbjct:  150 YHVACDEHYYGDSCSDYCRPRDDTFGHYTCDS---TGNRVCLEGWKGEYCADPICSSGCSEEHGYCETPGECKCRLGWQGPQC----DECTRYPGCSHGTC-DQP--WQCICKEGWGGLFCNQDLNFCTNHKPCKNDATCTNTGQGSYTCTCKPGFTGKDCEIVNVSSECDSNPCKNGGSCNDMLNDYSCTCPQGFYGKNCEISAMT---------CAERPCFNGGTCITDDTT---------------GGYSCRCPPGYMGSNCEKKI 384          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: dlb (deltaB [Source:NCBI gene;Acc:30141])

HSP 1 Score: 276.174 bits (705), Expect = 2.310e-80
Identity = 172/509 (33.79%), Postives = 243/509 (47.74%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICL----SIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKI-------KHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKD-----HF----QLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP 1635
            S GVFE+ +  ++            TR+        DCNIF  ICL     +   +P    C  G          + A+ +S      +    +W   F++I++        +H D    +N +I  L+              ++L+  +D     HF    +L  S+   C + Y+G+ C   C+P  +  G YNC  NG++ C  G+ G YC   +C   C   +G C  P +C+C+ GW G SC +C+ +PGC+HG+C          P  C CK+ WGG+FCN DLNYC+N+   C N   C N G       Y C C+PG+ G +CE   + C  N C NGG C  N   N Y C CP+ FYG  C+    +C D+PC     C    T G+ C+CPP + G NCE   D CS+KPC NGG C+D  S  LC C  GFSG  C++N +DC    C N   C+D  N   C CT G+TG+ C+   + C +  PCL+ G     P
Sbjct:   15 SSGVFELKVHAFST-----------TRRYCRRP--RDCNIFFRICLKHSEDVISADP---PCTFGTGQTGVMRAEHSAIANSAA--IRVPFHFKWPGTFSLIIEAWNAESPKEHPDHTENQNNLISRLA------------TRRRLAIGEDWSQDVHFGEQSELRYSYHVFCDEFYYGDACSDYCRPRDDTLGHYNCDENGNKECLEGWQGDYCSDPICSADCSERHGYCESPGECKCRLGWQGPSCSECVRHPGCLHGTC--------TQPWQCVCKEGWGGLFCNQDLNYCTNH-KPCANGATCTNTGQ----GSYTCTCRPGYGGTNCELEINECDCNPCKNGGSC--NDLENDYSCTCPQGFYGKNCEIVAMTCADDPCFNGGTCEERFTGGYVCRCPPAYTGSNCEKKLDRCSNKPCANGGECVDVGSSALCRCRPGFSGPFCEMNVDDCLHSPCQNSGTCVDGVNDYTCSCTLGFTGKNCSVRAHAC-LTHPCLHGGTWFMGP 477          

HSP 2 Score: 87.0409 bits (214), Expect = 4.667e-17
Identity = 65/212 (30.66%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1255 CVGNSECITDK-TSGFKCKCPPGFIGRNCEIDEDECSS-KPCLNGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            CV +  C+    T  ++C C  G+ G  C  D + C++ KPC NG  C +   G + C C  G+ G  C++  N+C    C NG  C D  N   C C  G+ G+ C      CA + PC N G C +   G Y C+C   ++G  C  K+          +C   PC N G C+                  +G    C+C PGF+G  CE
Sbjct:  234 CVRHPGCLHGTCTQPWQCVCKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGYGGTNCELEINECDCNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIVAMTCA-DDPCFNGGTCEERFTGGYVCRCPPAYTGSNCEKKL---------DRCSNKPCANGGECV-----------------DVGSSALCRCRPGFSGPFCE 418          

HSP 3 Score: 67.3958 bits (163), Expect = 5.994e-11
Identity = 74/266 (27.82%), Postives = 99/266 (37.22%), Query Frame = 1
Query: 1192 CPESFYGDRCQ---------FNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ--VNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDT-PGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFK----------------------PIGGPYTCKCNPGFTGDLCEKVI 1887
            C E +YGD C              +CD+N   GN EC+             G+ G  C   +  CS+      G C    S   C C +G+ G  C   V    C   +C    +C+         C  GW G  CNQ++N C  ++PC N   C +T  GSY C C+  + G  C L+I          +C  NPC+N G C       S   P   Y K                         G Y C+C P +TG  CEK +
Sbjct:  156 CDEFYYGDACSDYCRPRDDTLGHYNCDEN---GNKECLE------------GWQGDYCS--DPICSADCSERHGYC---ESPGECKCRLGWQGPSCSECVRHPGCLHGTCTQPWQCV---------CKEGWGGLFCNQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGYGGTNCELEI---------NECDCNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIVAMTCADDPCFNGGTCEERFTGGYVCRCPPAYTGSNCEKKL 383          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 254.218 bits (648), Expect = 2.665e-70
Identity = 165/476 (34.66%), Postives = 225/476 (47.27%), Query Frame = 1
Query:  616 FRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQ--CRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLN-----------------------FGNIKTNQQ-------------YRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTP-GSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI-----------LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
             R  C ++Y    C KLCKP  +  G Y C SNG+++C  G++G  C K +C + C   +G C  P +  CRCQ GW G  CDQCIPYPGCVHG C          P  C C   WGG+ C+ DLNYC N+   C N G C N                         +I  N               Y+C+C PG+ GA+C +    C  + C NGG C +N+  N + C CP  + G  C  +   CDDNPCV    C  +   G+ C C PG+ G+NC+ID ++C  K CLNGG C D  + + C C  G++G RC+   N+C    C+NG +C D  +   C C  G+ G  C  +++ C  N PC N   C++ P G Y C C   + G  C L         L+  CL +PC+    C            +  + ++V  PN       GG +TC CN GF G  C + +
Sbjct:   44 LRVMCDEHYFSTNCTKLCKPRDDYFGHYACDSNGNKVCLDGWTGGDCKKAICRQGCSTEHGQCDNPGECNCRCQYGWQGHFCDQCIPYPGCVHGGCS--------KPWECRCDTNWGGLLCDKDLNYCGNH-QPCRNGGSCSNAQPDSYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTC-LNL-VNGFRCTCPPQWTGHTCLVDTDECDDNPCVHARSC-KNLFGGYYCGCLPGWTGQNCDIDVNDCEGK-CLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDLCVPN-PCQNGARCVNLPNGDYFCHCSENFEGTNCTL---------LKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENV 496          

HSP 2 Score: 169.859 bits (429), Expect = 3.711e-43
Identity = 145/512 (28.32%), Postives = 204/512 (39.84%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECD-------KLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV---CLKKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLP-LTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKT-NQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCL---------------------------NGGMCIDRPSG-FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIV-----------------------------VPNINYLER-KCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMY 1914
            S++  C + YHG  C+        L    AN        S    +C  G++G+ C + +       C NG      V   +C C   WTG +C    D+C   P CVH       + K L     C C   W G  C+ID+N C         EG+CLN G  K     Y C CKPG+ G  CE   + C  + C NGG+C+  +++  Y C C + F GD C+ +   C  NPC   + C+      + C C   F G NC + +D C + PC                              G C+ +  G F C+C  GF G  C  N NDC + +C NG  C+D  N   C C  GW G  C  ++++C+ + PCLN G C D    + C+C+  W G+ C+ KI                               P  N  +   C+ NPC+N   C+++                 G  Y C C  G+ G  C + I   SS   Y
Sbjct:  182 SYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDDNP-CVHA-----RSCKNLFGGYYCGCLPGWTGQNCDIDVNDC---------EGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDS--YYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVIS-----------------GDSYKCICQSGWEGANCTQDINDCSSHPCY 659          

HSP 3 Score: 157.918 bits (398), Expect = 2.313e-39
Identity = 134/468 (28.63%), Postives = 188/468 (40.17%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHG-------EECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKKCINGAC----VGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNK--------------------------YICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSK-PCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGD 1869
              L+  FR TC   + G       +ECD    P  + R   N        C  G++G  CD  V  C  KC+NG      V    C C+ G+TG  C+    +C  +P    G CR       +    C C   + G  C +D++ C   PN C+N   C+N      N  Y C C   F+G +C  ++ +C+ + C     C + V +N                           + C C   F G  C  N   C +  C     C+ D  + F+C CP G+ G  CE D D+CS+  PCLNGG C D  + F C C  G+ G  C    + C + +C NG +C D  +   C C TGW G  CN   +   +  PC N   C+ +  SY+C CQ+ W G  C   I           C  +PC N G C+  +                   Y C+C  GF G+
Sbjct:  255 LNLVNGFRCTCPPQWTGHTCLVDTDECDD--NPCVHARSCKNLFGGYYCGCLPGWTGQNCDIDVNDCEGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCR-----DAIDSYYCVCMDGFAGDSCELDVDLCV--PNPCQNGARCVNL----PNGDYFCHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCL-DGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDI---------NDCSSHPCYNGGTCVDGT-----------------NWYRCECAAGFAGE 682          

HSP 4 Score: 132.109 bits (331), Expect = 2.053e-31
Identity = 87/259 (33.59%), Postives = 122/259 (47.10%), Query Frame = 1
Query:  925 LTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCI-INKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDED-ECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKI 1695
             TC C   + G FC+ ++N C+     C N G CL+  N      ++C+C  G+ G  CE    +C   N C NGG C   VN   + C+C   + G  C    + CD+  C    EC  D    F+C CP G+ G  C I +   C   PC NG  C+     + C+C  G+ G  C  + NDC    C NG  C+D  N   CEC  G+ G    ++INEC  + PC  +  CID    YRC C    +G+ C+ ++
Sbjct:  479 FTCMCNSGFRGSFCHENVNDCAEG--ACHNGGTCLDGIN-----SFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVN--DFSCECKNGWKGKTCHSKISHCDEATCNNGGECF-DVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGDSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTNWYRCECAAGFAG----EDINECQ-SMPCAKDATCIDEINGYRCMCPLGRAGRHCHDEV 722          

HSP 5 Score: 128.642 bits (322), Expect = 2.571e-30
Identity = 96/283 (33.92%), Postives = 136/283 (48.06%), Query Frame = 1
Query:  787 NGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQT-SCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNG 1617
            NG C+    G   C C +G+ G  C + +    C  G+C    T  + +    C C   W G FC  D++ CSN+ N C N G C +  N      + C CK G+KG  C     +C    C NGG+C    +T  + C CP  + G  C   Q+ +C  NPC   + C+    S +KC C  G+ G NC  D ++CSS PC NGG C+D  + + C C  GF+G+    + N+CQ + C   A C+D  N   C C  G  GR C+  +      QPC+ +G
Sbjct:  468 NGRCLSQAGGNFTCMCNSGFRGSFCHENVN--DCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNH-NPCLNGGTCHDLVN-----DFSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDT--FRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGDS-YKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTNWYRCECAAGFAGE----DINECQSMPCAKDATCIDEINGYRCMCPLGRAGRHCHDEV----PTQPCVASG 731          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.602e-47
Identity = 98/257 (38.13%), Postives = 139/257 (54.09%), Query Frame = 1
Query: 1120 CIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQAT-WSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C    C +GG C +      + C C   + GD C+ +   C   PC+ ++ C+ D+  G+KC C PGF GR+CEID +EC+S+PCL+GG C +    + C CP GF+G+RCQ++ N+C    C NGA C+D   + +C C  G+TG MC   ++EC  + PC N G+CID   SY C C  T + G+ C L+I+         +C  NPCR+N  CI   L                  +TC C PGF GD CE+ +
Sbjct:    1 CASGPCLHGGTC-LPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCV-DEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECE-SGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEIL---------ECASNPCRHNSTCIEGIL-----------------NFTCICWPGFAGDACEEDV 228          

HSP 2 Score: 146.362 bits (368), Expect = 7.711e-39
Identity = 103/313 (32.91%), Postives = 150/313 (47.92%), Query Frame = 1
Query:  802 GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKC-PPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMD--------------------RANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSG 1674
            G   CRC  G++GD+C+  +   GC  G C  D     E     C C   + G  C ID+N C++ P  C + G C N        +Y C C  GF G  C+   + C    C NG  C ++++  K+ C CP  + G  C+     C+  PC     CI D    + C C   G+ G++CE++  EC+S PC +   CI+    F C+C  GF+GD C+ + N+C    CMNG +C++                     A+   C C  G TG  C+ N++EC  +QPCLN G CID  GS+ C+C   ++G
Sbjct:   18 GGFSCRCAPGYSGDNCEASVG--GCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEP--CLHGGTCTN-----GRDRYSCACPDGFAGERCQLDTNECASQPCHNGATC-VDLD-GKFECVCPRGYTGAMCETEVDECESGPCQNGGVCI-DLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECE-SQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 3 Score: 103.219 bits (256), Expect = 3.842e-24
Identity = 96/330 (29.09%), Postives = 132/330 (40.00%), Query Frame = 1
Query:  667 CKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACV---------GPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPES---------------------------------------FYGDRCQFNQTSCDDNPCVGNSECIT-------------------DKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSG 1443
            C P+A+  G ++C       C  GYSG  C+  V    C +G C+         G  +C C  G+ G  C+    +C   P C+HG       T      +C C   + G  C +D N C++ P  C N   C++      + ++ C+C  G+ GA CE     C    C NGG C   V++  Y CDC E+                                       F GD C+ +   C D PC+   +CI                       SGF C+C PG  G NC ++ DEC S+PCLNGG CID    F C C  GF+G
Sbjct:   12 CLPAAD--GGFSCR------CAPGYSGDNCEASV--GGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEP-CLHGG----TCTNGRDRYSCACPDGFAGERCQLDTNECASQP--CHNGATCVDL-----DGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDS--YTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 2.307e-41
Identity = 115/405 (28.40%), Postives = 173/405 (42.72%), Query Frame = 1
Query:  817 RCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDE----------CSSK----------------------------------PCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERK----CLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            RCQ GW G  CDQC PYPGCV G+C          P  C+C+  WGG+ C+ DLNYC  +   C N G C N    +  ++   +   G +       EH C+ + C N G C  +   + + C C   + G  C ++   C  +PC GN     D+ + F+C+CPP ++GR C++              C S+                                   C NGG C D  +G+ C CP G++G  CQ   ++C    C+N  +C D+ N   C C  G++G +C  +++ C  N PC N   C +    Y C C   + G+ C+        +   R     C +    N+    +  + + V  P+       GG +TC C+ GFTG  C + I
Sbjct:    1 RCQYGWQGAYCDQCTPYPGCVRGTCH--------EPWQCSCETNWGGLLCDKDLNYCGTH-TPCRNGGTCANTEPDEYTRRSP-LSPVGLREIPSHTAEHACLSDPCANDGSC--HETPSGFECVCALGWTGLTCAYDIDDCASDPC-GNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPN-PCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENI 391          

HSP 2 Score: 147.132 bits (370), Expect = 2.830e-36
Identity = 119/406 (29.31%), Postives = 166/406 (40.89%), Query Frame = 1
Query:  769 CLKKCINGAC----VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNC--------IINKC---------------FNGGKCK-----INVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            C  +C NG      V    C C  G+TG  C    D+C+  P   +G C+      +L    C C   + G  C +D++YC   PN C+N   C N      N  Y C C   ++G +C ++  +C        +I+ C                + G C      ++    K+ C C E F G  C  N   C  NPC     CI D    ++C C  G+ G  CEID ++CS   C N G C D  + F C C  G+ G  C   +  C + +C NGA C DR +   C C  GW G  C+   N    + PC+N   C+ +  S+ C C+  W G  C+      N N     C  +PC N G C+           + E +      Y C C PGF G  C 
Sbjct:  213 CHGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQ-----DQLNSFRCLCPAGFSGHLCQLDVDYCE--PNPCQNGAPCFNL-----NMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCI-DGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCS-----ENTN----DCNPHPCYNGGTCV-----------DGENW------YRCDCAPGFAGPDCR 579          

HSP 3 Score: 141.739 bits (356), Expect = 1.384e-34
Identity = 114/389 (29.31%), Postives = 168/389 (43.19%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVVCLKKCINGACVGPNQCR---------CQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNN---------------------------PNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKND-CQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI 1767
             C  GY+G  C + V   +C++  C+   QC+         C  G++G  C    D C P P C +G+  F+          C+C + + G  C+   ++C  +                             VC   G C++ G  K    + C C  GF G +C +  ++C +N C NGG C   V +  Y C C E + GD C+ +   C  N C     C  D  + F C+C  G+ G+ C   E +C    C NG  C DR   F C+CP+G+ G  C + +N  C    CMN A C+   +   C C  GW G  C++N N+C  + PC N G C+D    YRC C   ++G  C +     N+N    +C  NPC     C+
Sbjct:  233 TCPPGYTGRGCQQEV--DECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNP-CQNGAPCFNLNMDYF----CSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGK----FTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKS--YQCICHEGWEGDVCEIDTNDCSPNLCQNRGRC-RDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPH-PCYNGGTCVDGENWYRCDCAPGFAGPDCRI-----NVN----ECQSNPCAFGATCV 597          

HSP 4 Score: 139.813 bits (351), Expect = 4.978e-34
Identity = 126/461 (27.33%), Postives = 185/461 (40.13%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMF-----CNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRC----------------------------------------QFNQTSCDDNPCVG---NSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINEC-------AINQPC---------------LNNGIC-------IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            C  G+ G+YCD+      C+ G C  P QC C+T W G  CD+ + Y G  H  CR   T     P     +     +       +   + C ++P  C N+G C      +T   + C+C  G+ G  C     +C  + C NGG C+  +  N + C CP  + G  C                                        Q +Q     N C G   N    TD  +G+ C CPPG+ GR C+ + DEC S PCLN G C D+ + F C+CP GFSG  CQ++ + C+   C NGA C +      C C+  + G+ C++  + C       A+   C               +++G+C           G + C C   ++G +C+      NIN     C +NPC+N G CI                      Y C C+ G+ GD+CE
Sbjct:    2 CQYGWQGAYCDQCTPYPGCVRGTCHEPWQCSCETNWGGLLCDKDLNYCG-THTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDP--CANDGSCH-----ETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRL--NDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCH-----ENIN----DCTVNPCKNGGTCIDGVK-----------------SYQCICHEGWEGDVCE 426          

HSP 5 Score: 130.568 bits (327), Expect = 4.344e-31
Identity = 104/350 (29.71%), Postives = 147/350 (42.00%), Query Frame = 1
Query:  925 LTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDE-CSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQ---------------ATWSGQF----------CNL-----------------------KIVVPN------------INYLERKCLINPCRNNGICILNSLPTSV 1791
             TC+C + + G +C+ ++N C+ NP  C+N G C++   +K+   Y+CIC  G++G  CE   ++C  N C N G+C+  VN   + C+C   + G  C   +  CD+  C   + C  D+   F C CP G+ G  C I  +  C+S PC+N   C+     F CVC  G+ G  C  N NDC    C NG  C+D  N   C+C  G+ G  C  N+NEC  N PC     C+D    +RC C                  W+G+           CNL                         VVP             +      CL  PC   G C+    PT V
Sbjct:  374 FTCSCDEGFTGTYCHENINDCTVNP--CKNGGTCID--GVKS---YQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVN--DFYCECRNGWKGKTCHSRERQCDEATCNNGATCY-DRGDSFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSN-PCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCPWNGKLYASGAKWEDECNLCQCLNGRTNCTKLWCGGTLCLTSGKVVPGPDAHRCPTGQKCMATPASACLAAPCDYWGECLPRPEPTRV 712          

HSP 6 Score: 110.538 bits (275), Expect = 6.956e-25
Identity = 117/435 (26.90%), Postives = 173/435 (39.77%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKL---CKPSANERGFYN----------------------CSSNGDRI----------CHTGYSGSYCDKVV---CLKKCINGAC----VGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHN-CIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ-VNKNDCQ---KLSCMNGAKCMDRANRIDC-----ECTTGW----------------------TGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQ 1677
            F L + +  +CS++Y G+ C +L   C+ S   R   +                      C  +G  +          C  G++G+YC + +    +  C NG      V   QC C  GW GD C+  I    C    C+     ++L+    C C+  W G  C+     C      C N   C + G+      + C+C  G++GA C  V ++ C  + C N   C  + ++  + C C E + G  C  N   C+ +PC     C+ D  + ++C C PGF G +C I+ +EC S PC  G  C+D  +GF C+CP G SG RCQ V    C    KL   +GAK  D  N   C      CT  W                      TG+ C        +  PC   G C+  P   R +C+    G 
Sbjct:  300 FNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCE--IDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEA--TCNNGATCYDRGD-----SFACLCPMGWEGATCSIVRNSSCASSPCMNTATCVGSGDS--FTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCV-DGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCPWNGKLY-ASGAKWEDECNLCQCLNGRTNCTKLWCGGTLCLTSGKVVPGPDAHRCPTGQKCMATPASACLAAPCDYWGECLPRPEPTRVKCRPNHPGH 721          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009101.1 (pep scaffold:Pmarinus_7.0:GL486879:2800:7708:-1 gene:ENSPMAG00000008237.1 transcript:ENSPMAT00000009101.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 2.952e-37
Identity = 71/179 (39.66%), Postives = 96/179 (53.63%), Query Frame = 1
Query: 1174 NKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITD-KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICI--DTPGSYRCQCQATWSGQFCNLKIVV 1701
            N Y C CP  F+G  C  +  SCDD PC     C  D +  G+ C CPPGF G NCE   + CSS PC NG  C+D  + F C C  GFSG+RC++N +DC +  C++G  C D  N   C C TG+ G+ C    + C  + PC N G+C+     G Y C+C+  + G  C   ++ 
Sbjct:    4 NDYSCVCPSGFFGKNCDMSSMSCDDTPCFNGGRCADDAEGGGYSCHCPPGFSGFNCEKKAEHCSSNPCANGAQCLDLEATFKCRCKPGFSGNRCEMNVDDCGRQPCLHGGTCRDLVNGFTCSCPTGYEGKDCGTPASYCQ-SGPCFNGGVCVLQGGDGGYACECRVGFGGIDCGELVLT 181          

HSP 2 Score: 128.642 bits (322), Expect = 1.065e-32
Identity = 66/175 (37.71%), Postives = 91/175 (52.00%), Query Frame = 1
Query: 1060 YRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANR--IDCECTTGWTGRMCNQNI 1578
            Y C+C  GF G +C+    +C    CFNGG+C  +     Y C CP  F G  C+     C  NPC   ++C+ D  + FKC+C PGF G  CE++ D+C  +PCL+GG C D  +GF C CP G+ G  C    + CQ   C NG  C+ +       CEC  G+ G  C + +
Sbjct:    6 YSCVCPSGFFGKNCDMSSMSCDDTPCFNGGRCADDAEGGGYSCHCPPGFSGFNCEKKAEHCSSNPCANGAQCL-DLEATFKCRCKPGFSGNRCEMNVDDCGRQPCLHGGTCRDLVNGFTCSCPTGYEGKDCGTPASYCQSGPCFNGGVCVLQGGDGGYACECRVGFGGIDCGELV 179          

HSP 3 Score: 117.857 bits (294), Expect = 4.961e-29
Identity = 67/216 (31.02%), Postives = 96/216 (44.44%), Query Frame = 1
Query: 1282 DKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCID--RPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEP 1923
            D  + + C CP GF G+NC++    C   PC NGG C D     G+ C CP GFSG  C+     C    C NGA+C+D      C C  G++G  C  N+++C   QPCL+ G C D    + C C   + G+ C               C   PC N G+C+L                   G Y C+C  GF G  C ++++  ++  + + P
Sbjct:    1 DLENDYSCVCPSGFFGKNCDMSSMSCDDTPCFNGGRCADDAEGGGYSCHCPPGFSGFNCEKKAEHCSSNPCANGAQCLDLEATFKCRCKPGFSGNRCEMNVDDCG-RQPCLHGGTCRDLVNGFTCSCPTGYEGKDCGTPASY---------CQSGPCFNGGVCVLQGGD---------------GGYACECRVGFGGIDCGELVLTRTNTAISNVP 191          

HSP 4 Score: 75.485 bits (184), Expect = 8.789e-15
Identity = 56/180 (31.11%), Postives = 78/180 (43.33%), Query Frame = 1
Query:  814 CRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECI-TDKTSGFKCKCPPGFIGRNC 1338
            C C +G+ G +CD     C   P    G C  D    E    +C+C   + G  C     +CS+NP  C N  +CL+         ++C CKPGF G  CE    +C    C +GG C+  V  N + C CP  + G  C    + C   PC     C+      G+ C+C  GF G +C
Sbjct:    8 CVCPSGFFGKNCDMSSMSCDDTPCFNGGRCADD---AEGGGYSCHCPPGFSGFNCEKKAEHCSSNP--CANGAQCLDL-----EATFKCRCKPGFSGNRCEMNVDDCGRQPCLHGGTCRDLV--NGFTCSCPTGYEGKDCGTPASYCQSGPCFNGGVCVLQGGDGGYACECRVGFGGIDC 175          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 1.740e-35
Identity = 75/216 (34.72%), Postives = 107/216 (49.54%), Query Frame = 1
Query: 1240 CDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C  NPC     CI D  + + C C  GF G+ CE D DEC+S PC NGG C++    F C C  G++G  C  + ++C    C NG +C++ A    C C  G+TG +C+ ++NECA + PCLN G C D   ++ C+C   ++G  C   +          +C  +PC N G C                 +     +TC+C PGFTG  CE V+
Sbjct:   15 CSPNPCQNGGRCI-DGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECA-SSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDV---------NECASSPCLNGGRC-----------------RDGVAAFTCECAPGFTGTRCETVL 202          

HSP 2 Score: 128.642 bits (322), Expect = 6.397e-34
Identity = 76/207 (36.71%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  967 NIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINEC 1587
              D++ CS  PN C+N G C     I     Y C C  GF G  CE     C  + C NGG+C +N     + C C   + G  C  +   C  +PC    +C+    S F C C  G+ G  C+ D +EC+S PCLNGG C D  + F C C  GF+G RC+ + N+C    C+NG +C D      CEC  G+TG  C   +N C
Sbjct:    9 GADVDECS--PNPCQNGGRC-----IDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQC-VN-GAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGS-FTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLNPC 205          

HSP 3 Score: 117.472 bits (293), Expect = 5.210e-30
Identity = 73/211 (34.60%), Postives = 105/211 (49.76%), Query Frame = 1
Query:  850 DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKL 1482
            D+C P P C +G    D         TC+C + + G  C  D++ C+++P  C+N G+C+N         + C C  G+ G  C+     C  + C NGG+C +N     + C C   + G  C  +   C  +PC+    C  D  + F C+C PGF G  CE D +EC+S PCLNGG C D  + F C C  GF+G RC+   N C K+
Sbjct:   13 DECSPNP-CQNGGRCIDGAAS----YTCDCAQGFTGKRCETDIDECTSDP--CQNGGQCVNGAG-----SFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQC-VN-GAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRC-RDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLNPCTKM 208          

HSP 4 Score: 90.8929 bits (224), Expect = 8.288e-21
Identity = 60/193 (31.09%), Postives = 92/193 (47.67%), Query Frame = 1
Query:  778 KCINGACVGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEI 1344
            +CI+GA      C C  G+TG  C    D+C   P C +G     +        TC+C   + G  C+ D++ C+++P  C+N G+C+N         + C C  G+ G  C+   + C  + C NGG+C+  V    + C+C   F G RC+ +   C  +PC+    C  D  + F C+C PGF G  CE 
Sbjct:   25 RCIDGA--ASYTCDCAQGFTGKRCETDIDECTSDP-CQNGG----QCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDP--CQNGGQCVNGAG-----SFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGV--AAFTCECAPGFTGTRCETDVNECASSPCLNGGRC-RDGVAAFTCECAPGFTGTRCET 200          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO41506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S429])

HSP 1 Score: 200.675 bits (509), Expect = 3.721e-55
Identity = 153/447 (34.23%), Postives = 202/447 (45.19%), Query Frame = 1
Query:  604 LLVSFRYTCSQNYHGEECDK--------LCKPSAN---ERGFYNCSSNGDRICHTGYSGSYCDKVV---CLKKCINGA----CVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDET-TKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            L  ++  TC+  Y G  C +        +C+   N       Y CS      C  GY+GS C+  +    +  C NG      V    C C  G+TG  C+  I    C    CR   T T ++    C C   + G +C I++N C  +PN C N G C +  N      Y C C PG+ G+ CE   + C    C NGG C   VN   Y C C   + G  C+ N   C   PC+    C  DK   ++C CP G+ G  CE D ++C   PCLNGG C DR +G+ C C  G++G+ C+ + +DC    CMNGA C+D  N   C C TGWTG  C  N++EC+ N PC+N G C D  G Y C C A ++G  C   I          +C  NPC N   C   +NS                   YTC C PG+ G  CEK
Sbjct:   95 LFNNYTCTCAAGYTGINCTENIDDCNGVVCQNGGNCVDGVNGYKCS------CAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDID--DCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDC--DPNPCGNGGTCTDQLNA-----YLCTCPPGYTGSKCEIDINECASFPCQNGGSCTDQVN--GYTCSCAAGYSGVNCEINADDCQSMPCLNGGSC-KDKVDAYECTCPLGYTGLRCETDINDCQPNPCLNGGSCTDRVNGYTCACAPGYTGNNCEKDIDDCASTPCMNGATCLDGVNSYTCICVTGWTGDQCTINVDECSSN-PCVNGGTCNDEAGGYTCTCAAGYTGLHCETDI---------DECRTNPCLNGATCTDKVNS-------------------YTCTCAPGYAGVHCEK 494          

HSP 2 Score: 193.356 bits (490), Expect = 1.341e-52
Identity = 141/420 (33.57%), Postives = 188/420 (44.76%), Query Frame = 1
Query:  814 CRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLP-LTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVN------------------------------------TNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLP-----------TSVNIP--------NNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C+C  GWTG +C    D+C P P      C+   T   L    TC C   + G+ C  +++ C  N  VC+N G C++  N      Y+C C PG+ G++CE   + C +N C NGG C   VN                                     N Y C C   F G  CQ N   CD NPC GN    TD+ + + C CPPG+ G  CEID +EC+S PC NGG C D+ +G+ C C  G+SG  C++N +DCQ + C+NG  C D+ +  +C C  G+TG  C  +IN+C  N PCLN G C D    Y C C   ++G  C   I           C   PC N   C+  +NS              ++N+         N        G YTC C  G+TG  CE  I
Sbjct:   63 CQCPKGWTGKNCTEDVDECAPQP------CKNGATCNNLFNNYTCTCAAGYTGINCTENIDDC--NGVVCQNGGNCVDGVN-----GYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNPC-GNGGTCTDQLNAYLCTCPPGYTGSKCEIDINECASFPCQNGGSCTDQVNGYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDAYECTCPLGYTGLRCETDINDCQPN-PCLNGGSCTDRVNGYTCACAPGYTGNNCEKDI---------DDCASTPCMNGATCLDGVNSYTCICVTGWTGDQCTINVDECSSNPCVNGGTCNDEAGGYTCTCAAGYTGLHCETDI 458          

HSP 3 Score: 186.422 bits (472), Expect = 2.763e-50
Identity = 133/407 (32.68%), Postives = 188/407 (46.19%), Query Frame = 1
Query:  613 SFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRI---------CHTGYSGSYCDKVVCLKKCINGAC---------VGPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI 1767
             ++ +C+  Y G  C+       NE    +C + G+           C  GY+G  C+  +    C +  C         V   +C+C  G+ G  C    + C P P    G+C     T +L    C C   + G  C ID+N C++ P  C+N G C +  N      Y C C  G+ G +CE    +C    C NGG CK  V+   Y C CP  + G RC+ +   C  NPC+    C TD+ +G+ C C PG+ G NCE D D+C+S PC+NG  C+D  + + C+C  G++GD+C +N ++C    C+NG  C D A    C C  G+TG  C  +I+EC  N PCLN   C D   SY C C   ++G  C            E  C   PC N G C 
Sbjct:  136 GYKCSCAPGYTGSNCET----DINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDI--DDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNPCGNGGTC-----TDQLNAYLCTCPPGYTGSKCEIDINECASFP--CQNGGSCTDQVN-----GYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVD--AYECTCPLGYTGLRCETDINDCQPNPCLNGGSC-TDRVNGYTCACAPGYTGNNCEKDIDDCASTPCMNGATCLDGVNSYTCICVTGWTGDQCTINVDECSSNPCVNGGTCNDEAGGYTCTCAAGYTGLHCETDIDECRTN-PCLNGATCTDKVNSYTCTCAPGYAGVHCEKD---------EDDCASKPCLNGGTCT 511          

HSP 4 Score: 164.466 bits (415), Expect = 6.827e-43
Identity = 124/378 (32.80%), Postives = 180/378 (47.62%), Query Frame = 1
Query:  601 QLLVSFRYTCSQNYHGEECDKLCKPSANE--RGFYNCSS--NGDRI-CHTGYSGSYCDKVV--C-LKKCINGAC----VGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTN-QQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
             L+  F  TC+  Y G  C+      A+   R    C+   NG R  C  G+ GSYC   +  C    C NG      +    C C  G+TG  C+    +C  +P    GSC     T ++   TC+C   + G+ C I+ + C + P        CLN G+ K     Y C C  G+ G  CE   ++C  N C NGG C   VN   Y C C   + G+ C+ +   C   PC+  + C+ D  + + C C  G+ G  C I+ DECSS PC+NGG C D   G+ C C  G++G  C+ + ++C+   C+NGA C D+ N   C C  G+ G  C ++ ++CA ++PCLN G C D    + C C   + G+ C
Sbjct:  170 DLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNPCGNGGTCTDQLNAYLCTCPPGYTGSKCEIDINECASFPCQNGGSC-----TDQVNGYTCSCAAGYSGVNCEINADDCQSMP--------CLNGGSCKDKVDAYECTCPLGYTGLRCETDINDCQPNPCLNGGSCTDRVN--GYTCACAPGYTGNNCEKDIDDCASTPCMNGATCL-DGVNSYTCICVTGWTGDQCTINVDECSSNPCVNGGTCNDEAGGYTCTCAAGYTGLHCETDIDECRTNPCLNGATCTDKVNSYTCTCAPGYAGVHCEKDEDDCA-SKPCLNGGTCTDLLADFECACVLGFIGKTC 530          

HSP 5 Score: 130.183 bits (326), Expect = 1.906e-31
Identity = 94/297 (31.65%), Postives = 121/297 (40.74%), Query Frame = 1
Query: 1114 HNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQ-------------------------------------PCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
             +C  + C N G C      N Y C C + F G  CQ N   C  +PC     C  D  + + C+CP G+ G+NC  D DEC+ +PC NG  C +  + + C C  G++G  C  N +DC  + C NG  C+D  N   C C  G+TG  C  +INECA+N                                      PC N G C D    YRCQC   + G +C + I           C  NPC N G C   LN+                   Y C C PG+TG  CE  I
Sbjct:    2 DDCAPSPCRNNGTCTDM--HNAYRCQCTQGFVGKNCQININDCIPDPCQNGGWCCCDLVNDWICQCPKGWTGKNCTEDVDECAPQPCKNGATCNNLFNNYTCTCAAGYTGINCTENIDDCNGVVCQNGGNCVDGVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQINI---------NDCDPNPCGNGGTCTDQLNA-------------------YLCTCPPGYTGSKCEIDI 268          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO36196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC3])

HSP 1 Score: 192.2 bits (487), Expect = 3.831e-54
Identity = 125/360 (34.72%), Postives = 178/360 (49.44%), Query Frame = 1
Query:  811 QCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
             C C  G+ G  C+    +C   P    G+C       ++   +C C   + G+ C  D+N C++NP  C N G C +  N      Y C C+PG+ G  CE   + C  N+C NGG C   VN   + C CP  + G +C+ N   C++NPCV    C  D+ + F C C  G+ G  CE D +EC+S PC+NGG C D  +GF C CP G++G +C+++ N+C+   C NG  C D+ N   C C  G+TG  C  +I+ECA N PC+N G C +    ++C C   ++G  C + I          +C  NPC N   C         ++ NN         YTC C  GF G+ CE
Sbjct:   24 HCTCPPGYNGTKCEIDINECDSNPCANGGTCA-----DQVNSFSCTCVSGYTGLQCKTDINECASNP--CLNGGTCNDLVN-----GYNCKCQPGYNGTTCEIDINECASNQCVNGGTCTDLVN--GFNCTCPPGYNGTKCEININECENNPCVNGGTC-ADQVNSFSCTCVSGYTGLKCETDINECASNPCVNGGTCTDLVNGFHCTCPPGYNGTKCEIDINECESNPCANGGTCADQVNSFSCTCVLGYTGLKCETDIDECASN-PCINGGTCTELVNGFKCTCVPGYNGTRCEIDI---------DECSSNPCLNGATC--------SDLLNN---------YTCTCASGFQGERCE 341          

HSP 2 Score: 176.022 bits (445), Expect = 1.425e-48
Identity = 113/305 (37.05%), Postives = 155/305 (50.82%), Query Frame = 1
Query:  973 DLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            D+N C++NP  C N G C +  N      + C C PG+ G  CE   + C  N C NGG C   VN+  + C C   + G +C+ +   C  NPC+    C  D  +G+ CKC PG+ G  CEID +EC+S  C+NGG C D  +GF C CP G++G +C++N N+C+   C+NG  C D+ N   C C +G+TG  C  +INECA N PC+N G C D    + C C   ++G  C + I          +C  NPC N G C        VN             ++C C  G+TG  CE  I
Sbjct:    1 DINECASNP--CVNGGTCTDLVN-----GFHCTCPPGYNGTKCEIDINECDSNPCANGGTCADQVNS--FSCTCVSGYTGLQCKTDINECASNPCLNGGTC-NDLVNGYNCKCQPGYNGTTCEIDINECASNQCVNGGTCTDLVNGFNCTCPPGYNGTKCEININECENNPCVNGGTCADQVNSFSCTCVSGYTGLKCETDINECASN-PCVNGGTCTDLVNGFHCTCPPGYNGTKCEIDI---------NECESNPCANGGTCA-----DQVN------------SFSCTCVLGYTGLKCETDI 268          

HSP 3 Score: 153.295 bits (386), Expect = 9.809e-41
Identity = 112/337 (33.23%), Postives = 157/337 (46.59%), Query Frame = 1
Query:  601 QLLVSFRYTCSQNYHG-------EECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVV---CLKKCINGAC----VGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMC 1566
             L+  F  TC   Y+G        ECD    P AN     +  ++    C +GY+G  C   +       C+NG      V    C+CQ G+ G +C+  I    C    C    T  +L+    C C   + G  C I++N C NNP  C N G C +  N      + C C  G+ G  CE   + C  N C NGG C   V  N + C CP  + G +C+ +   C+ NPC     C  D+ + F C C  G+ G  CE D DEC+S PC+NGG C +  +GF C C  G++G RC+++ ++C    C+NGA C D  N   C C +G+ G  C
Sbjct:   18 DLVNGFHCTCPPGYNGTKCEIDINECDS--NPCANGGTCADQVNSFSCTCVSGYTGLQCKTDINECASNPCLNGGTCNDLVNGYNCKCQPGYNGTTCE--IDINECASNQCVNGGTCTDLVNGFNCTCPPGYNGTKCEININECENNP--CVNGGTCADQVN-----SFSCTCVSGYTGLKCETDINECASNPCVNGGTCTDLV--NGFHCTCPPGYNGTKCEIDINECESNPCANGGTC-ADQVNSFSCTCVLGYTGLKCETDIDECASNPCINGGTCTELVNGFKCTCVPGYNGTRCEIDIDECSSNPCLNGATCSDLLNNYTCTCASGFQGERC 340          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO48851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH9])

HSP 1 Score: 203.756 bits (517), Expect = 4.233e-53
Identity = 142/404 (35.15%), Postives = 197/404 (48.76%), Query Frame = 1
Query:  691 GFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            GFY    N   +CH  Y G+   +    K C NG       G   C C++G+TG +C+Q +    C    C+     K E    +C CK  + G  C  D+N C+ NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF G+NCE D +ECS  PC NGG+C ++  G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+TG++C Q++NEC+ N PC N G+C +  G Y C C+A ++G+ C   +          +C  NPC+N G+C             NE+     G Y+C C  GFTG  CE+ +
Sbjct:  967 GFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDVNE--CSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECNKNP--CQNGGVCKN-----EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNE--HGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVC-KNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNKHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNECSKN-PCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDV---------NECSKNPCKNGGVC------------KNEH-----GGYSCTCKAGFTGKNCEQDV 1331          

HSP 2 Score: 201.06 bits (510), Expect = 2.541e-52
Identity = 155/478 (32.43%), Postives = 222/478 (46.44%), Query Frame = 1
Query:  601 QLLVSFRYTCSQNYHGEECDK--------LCKPSA---NERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKK-CINGACV----GPNQCRCQTGWTGDSCDQ----CIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII---ANSSIVMYSEPQITTEGFLYKSR 1959
            ++  ++  TC   + G+ C++         CK      NE G Y+C+      C  G++G  C++ V  C K  C NG       G   C C+ G+TG +C+Q    C   P    G C+      E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF G+ CE D +ECS  PC NGG+C +   G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+TG+ C Q++NEC+ N PC N G+C +  G Y C C+A ++G+ C   +          +C  NPC+N G+C             NE+     G Y+C C  GFTG    K++    A++ ++M        E  +  +R
Sbjct: 1005 EVNGAYSCTCKSGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCA------CKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCK-----NEHGGYSCACKAGFTGKNCEQDVNECSKNP--CKNGGVCKN-----EHGGYSCACKAGFTGKNCEQDMNECSKNPCQNGGVCKNK--HGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVC-KNEHGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKN-PCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDV---------NECSKNPCKNGGVC------------KNEH-----GGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNAR 1434          

HSP 3 Score: 195.667 bits (496), Expect = 1.130e-50
Identity = 149/416 (35.82%), Postives = 198/416 (47.60%), Query Frame = 1
Query:  691 GFYNCSSNGDRICHTGYSG-SYCDKVVCLKK-CINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE----KVIIANSSI 1905
            GFY    N   +CH  Y G +  D   C K  C NG       G   C C+ G+TG +C+Q +    C    C+     K E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G +CE+  + C +N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF G+NCE D +ECS  PC NGG+C +   G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+ G+ C Q++NEC+ N PC N G+C +  G Y C C+A ++G+ C   +          +C  NPC+N G+C             NE+     G Y+C C  GFTG  CE    K II   SI
Sbjct:  193 GFYVYELNRPPVCHLRYCGNAEFDVNECSKNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNE--CSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSVNP--CKNGGVCKN-----EHGGYSCACKVGFTGKNCEQDVNECSVNPCKNGGVCKN--EHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVC-KNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVCKNEHGGYSCACKAGFMGKNCEQDVNECSKN-PCKNGGVCKNEHGGYSCACKAGFTGKNCEQDV---------NECSKNPCKNGGVC------------KNEH-----GGYSCACKAGFTGKNCEQDGLKTIIHLQSI 569          

HSP 4 Score: 193.356 bits (490), Expect = 6.083e-50
Identity = 147/430 (34.19%), Postives = 200/430 (46.51%), Query Frame = 1
Query:  682 NERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKK-CINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCN---------------------LKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            NE G Y+C+      C  G++G  C++ +  C K  C NG       G   C C+ G+TG +C+Q +    C    C+     K E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF G+NCE D +ECS  PC NGG+C +   G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+TG+ C Q++NEC+ N PC N G+C +  G Y C C+A ++G+  N                     ++  V N    + +C +NPC NNG CI        N P         G Y C C   +TG  CE  
Sbjct: 1081 NEHGGYSCA------CKAGFTGKNCEQDMNECSKNPCQNGGVCKNEHGGYSCACKAGFTGKNCEQDVNE--CSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDMNECSKNP--CQNGGVCKN-----KHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNE--HGGYSCTCKAGFTGKICEQDVNECSKNPCKNGGVC-KNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKN-PCKNGGVCKNEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCI--------NTP---------GSYKCNCIDEYTGKHCETA 1474          

HSP 5 Score: 189.889 bits (481), Expect = 7.164e-49
Identity = 143/439 (32.57%), Postives = 201/439 (45.79%), Query Frame = 1
Query:  682 NERGFYNCSSNGDRICHTGYSGSYCDKVV---CLKKCINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFLYKSRIANRP 1974
            NE G Y+C+      C  G++G  C++ V    +  C NG       G   C C+ G+TG +C+Q +    C    C+     K E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF+G+NCE D +ECS  PC NGG+C +   G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+TG+ C Q+  +  I+   +  G+C +  G Y C C+A ++G+ C   +          +C +NPC+N G+C             NE+     G Y+C C  GFTG  CE+          Y +            R A RP
Sbjct:  271 NEHGGYSCA------CKAGFTGKNCEQDVNECSVNPCKNGGVCKNEHGGYSCACKVGFTGKNCEQDVNE--CSVNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNP--CKNGGVCKN-----EHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNE--HGGYSCACKAGFTGKNCEQDVNECSKNPCQNGGVC-KNEHGGYSCACKAGFMGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKNCEQDGLKTIIHLQSIKCGVCKNEHGGYSCACKAGFTGKNCEQDV---------NECSVNPCKNGGVC------------KNEH-----GGYSCACKAGFTGKNCEQAPSKPRECRSYKKLDTA-------DRAAGRP 658          

HSP 6 Score: 142.124 bits (357), Expect = 4.879e-34
Identity = 106/329 (32.22%), Postives = 144/329 (43.77%), Query Frame = 1
Query:  973 DLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINE-CAINQPCLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVV---------------PNINYLE-------RKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            D+N CS NP  C+N G C N      +  Y C CK GF G  CE+  + C  N C NGG CK       Y C C   F G  C+ +   C+ NPC     C  ++  G+ C C  GF G+NCE D +EC+  PC NGG+C +   G+ C C  GF+G  C+ + N+C K  C NG  C +      C C  G+TG++C Q I E C  + P    G       G    +    WSG+ C+    +               P + +L          C   PC+N G C                 + + G Y+C C  GFTG  CE+ +
Sbjct:  726 DVNECSKNP--CQNGGVCKN-----EHGGYSCACKAGFTGKICEQDVNECNKNPCQNGGVCKNE--HGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVC-KNEHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKICEQEICEICGTHAPGWMEGSHPTVAEGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTC-----------------REVNGAYSCTCKSGFTGKNCEQDV 1027          

HSP 7 Score: 136.346 bits (342), Expect = 3.061e-32
Identity = 107/358 (29.89%), Postives = 154/358 (43.02%), Query Frame = 1
Query:  913 ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKND---CQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQN----INECA--------------------------INQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            E    +C CK  + G  C  D+N C+ NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C+ NPC     C  ++  G+ C C  GF G+NCE D +ECS  PC NGG+C +   G+ C C  GF+G  C+    +         M G+        +  +    W+G+ C+ N    +  C                            ++PC N G C +  G+Y C C++ ++G+ C   +          +C  NPC+N G+C             NE+     G Y+C C  GFTG  CE+ +
Sbjct:  744 EHGGYSCACKAGFTGKICEQDVNECNKNP--CQNGGVCKN-----EHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVCKN--EHGGYSCTCKAGFTGKNCEQDVNECNKNPCQNGGVC-KNEHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCACKAGFTGKICEQEICEICGTHAPGWMEGSHPTVAEGIVTRKVCYHWSGKTCHWNNAIRVRNCGGFYVYELNRPPVCHLRYCGNAEFETCSSKPCKNGGTCREVNGAYSCTCKSGFTGKNCEQDV---------NECSKNPCKNGGVC------------KNEH-----GGYSCACKAGFTGKNCEQDV 1065          

HSP 8 Score: 100.138 bits (248), Expect = 3.847e-21
Identity = 93/299 (31.10%), Postives = 126/299 (42.14%), Query Frame = 1
Query:  682 NERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKK-CINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGR------------------------------NCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNK 1464
            N+ G Y+C+      C  G++G  C++ V  C K  C NG       G   C C+ G+TG  C+Q +    C    C+     K E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G +CE+  + C  N C NGG CK       Y C C   F G  C+ +   C  NPC     C  ++  G+ C C  GF G+                              N   D++EC   PCLN G CI+ P  + C C   ++G  C+  K
Sbjct: 1195 NKHGGYSCA------CKAGFTGKNCEQDVNECSKNPCKNGGVCKNEHGGYSCTCKAGFTGKICEQDVNE--CSKNPCKNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNP--CKNGGVCKN-----EHGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVCKNE--HGGYSCTCKAGFTGKNCEQDVNECSKNPCKNGGVC-KNEHGGYSCTCKAGFTGKTANKMLTNVPASTRVIMAESALTAMEDTVVNARPDKNECKVNPCLNNGKCINTPGSYKCNCIDEYTGKHCETAK 1475          

HSP 9 Score: 50.8322 bits (120), Expect = 3.456e-6
Identity = 52/150 (34.67%), Postives = 70/150 (46.67%), Query Frame = 1
Query:  682 NERGFYNCSSNGDRICHTGYSGSYCDKVV--CLKK-CINGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTK-ELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEK 1107
            NE G Y+C+      C  G++G  C++ V  C K  C NG       G   C C+ G+TG +C+Q +    C    C+     K E    +C CK  + G  C  D+N CS NP  C+N G C N      +  Y C CK GF G  CE+
Sbjct:  781 NEHGGYSCT------CKAGFTGKNCEQDVNECNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNE--CNKNPCQNGGVCKNEHGGYSCTCKAGFTGKNCEQDVNECSKNP--CKNGGVCKN-----EHGGYSCACKAGFTGKICEQ 915          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO34084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQA8])

HSP 1 Score: 189.119 bits (479), Expect = 5.905e-53
Identity = 128/373 (34.32%), Postives = 175/373 (46.92%), Query Frame = 1
Query:  787 NGACV----GPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELL-PLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPG--SYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKV 1884
            NG C     G   C C  G+TG +CD  I    C    C F+ T  + +   TC C+  + G  C +++N C+   + C   G C++  N      Y C C  G+ G+ C    ++CI N C +G  C   +    Y C C   F G  C+ N   C  NPC     CI D+   + C CP G+ G  C+++ DEC+S+PCLN G C D    F CVCP GF G RC+   N+C    C NG  C D  NR +C C  G+ GR C  N+ EC ++ PCLNNG C++  G   Y C C   ++G+ C + I           C   PC N        L T ++  NN         Y+C C P +TG  CE +
Sbjct:   12 NGTCTPALGGGVSCACPAGFTGATCD--IDIDECQSNPCYFNGTCIDGINGFTCKCQDGFIGSLCEVNVNECNETQSPCSEHGACIDGVN-----SYTCACNLGYTGSTCNVTVNDCISNPCIHGATCHDGLL--GYSCACAVGFTGINCEININDCASNPCAAYQRCI-DRIDSYTCACPLGYTGNACDVNIDECASQPCLNNGTCQDGRGNFSCVCPAGFEGLRCENQTNECASSPCFNGGTCHDLLNRFECVCPNGFLGRQCEANVVEC-LSDPCLNNGTCVEKIGVVGYHCACPVGYTGKLCEIDI---------DDCASMPCGN--------LSTCIDHVNN---------YSCACVPWYTGRNCENL 347          

HSP 2 Score: 140.584 bits (353), Expect = 3.016e-36
Identity = 94/280 (33.57%), Postives = 133/280 (47.50%), Query Frame = 1
Query: 1063 RCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDD--NPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGIC--ILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVII 1890
             C C  GF GA C+     C  N C+  G C   +N   + C C + F G  C+ N   C++  +PC  +  CI D  + + C C  G+ G  C +  ++C S PC++G  C D   G+ C C VGF+G  C++N NDC    C    +C+DR +   C C  G+TG  C+ NI+ECA +QPCLNNG C D  G++ C C A + G  C  +           +C  +PC N G C  +LN                    + C C  GF G  CE  ++
Sbjct:   24 SCACPAGFTGATCDIDIDECQSNPCYFNGTCIDGIN--GFTCKCQDGFIGSLCEVNVNECNETQSPCSEHGACI-DGVNSYTCACNLGYTGSTCNVTVNDCISNPCIHGATCHDGLLGYSCACAVGFTGINCEININDCASNPCAAYQRCIDRIDSYTCACPLGYTGNACDVNIDECA-SQPCLNNGTCQDGRGNFSCVCPAGFEGLRCENQT---------NECASSPCFNGGTCHDLLNR-------------------FECVCPNGFLGRQCEANVV 271          

HSP 3 Score: 117.087 bits (292), Expect = 2.824e-28
Identity = 82/253 (32.41%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  727 CHTGYSGSYCDKVV--CLKK-CINGACVGPN----QCRCQTGWTGDSCDQCIPYPGCVHGSC-RFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQ-QYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITD-KTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ 1455
            C+ GY+GS C+  V  C+   CI+GA          C C  G+TG +C+  I    C    C  +      +   TC C   + G  C+++++ C++ P        CLN G  +  +  + C+C  GF+G  CE   + C  + CFNGG C   +  N++ C CP  F G +C+ N   C  +PC+ N  C+      G+ C CP G+ G+ CEID D+C+S PC N   CID  + + C C   ++G  C+
Sbjct:  105 CNLGYTGSTCNVTVNDCISNPCIHGATCHDGLLGYSCACAVGFTGINCE--ININDCASNPCAAYQRCIDRIDSYTCACPLGYTGNACDVNIDECASQP--------CLNNGTCQDGRGNFSCVCPAGFEGLRCENQTNECASSPCFNGGTCHDLL--NRFECVCPNGFLGRQCEANVVECLSDPCLNNGTCVEKIGVVGYHCACPVGYTGKLCEIDIDDCASMPCGNLSTCIDHVNNYSCACVPWYTGRNCE 345          

HSP 4 Score: 110.153 bits (274), Expect = 6.627e-26
Identity = 76/220 (34.55%), Postives = 96/220 (43.64%), Query Frame = 1
Query: 1240 CDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS--CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICI--LNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C    C  N  C      G  C CP GF G  C+ID DEC S PC   G CID  +GF C C  GF G  C+VN N+C +    C     C+D  N   C C  G+TG  CN  +N+C I+ PC++   C D    Y C C   ++G  C + I           C  NPC     CI  ++S                   YTC C  G+TG+ C+  I
Sbjct:    4 CTSASCSNNGTCTPALGGGVSCACPAGFTGATCDIDIDECQSNPCYFNGTCIDGINGFTCKCQDGFIGSLCEVNVNECNETQSPCSEHGACIDGVNSYTCACNLGYTGSTCNVTVNDC-ISNPCIHGATCHDGLLGYSCACAVGFTGINCEINI---------NDCASNPCAAYQRCIDRIDS-------------------YTCACPLGYTGNACDVNI 194          

HSP 5 Score: 86.6557 bits (213), Expect = 4.281e-18
Identity = 58/177 (32.77%), Postives = 79/177 (44.63%), Query Frame = 1
Query: 1354 ECSSKPCLNGGMCIDRPSGFL-CVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQ-PCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            +C+S  C N G C     G + C CP GF+G  C ++ ++CQ   C     C+D  N   C+C  G+ G +C  N+NEC   Q PC  +G CID   SY C C   ++G  CN+ +           C+ NPC +   C    L                  Y+C C  GFTG  CE
Sbjct:    3 QCTSASCSNNGTCTPALGGGVSCACPAGFTGATCDIDIDECQSNPCYFNGTCIDGINGFTCKCQDGFIGSLCEVNVNECNETQSPCSEHGACIDGVNSYTCACNLGYTGSTCNVTV---------NDCISNPCIHGATCHDGLL-----------------GYSCACAVGFTGINCE 153          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO46969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ6])

HSP 1 Score: 189.504 bits (480), Expect = 9.109e-53
Identity = 140/399 (35.09%), Postives = 207/399 (51.88%), Query Frame = 1
Query:  724 ICHTGYSGSYCDKVV--CLKK-CINGA-CV---GPNQCRCQTGWTGDSCDQ--CIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII-NKCFNGGKCKINVNT-NKYICDCPESFYGDRCQFNQTSC-DDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDEC-SSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            +C +G+SG+ C   +  C K  C NG  CV   G + C C+ GWTG +C++  C P P C +G    D+  ++     C C+  + G  C  D+N C  NP  C+N G+C+N      +  + C CK G+ G +CE+  + C   N C NGG C    NT   + C C   + G  C+ +   C   NPC     C T+   G+ CKC  G+ G+NCE D +EC SS PC NGG+C + P G+ C C  G++G  C+ + N+C   + C NG  C +   R  CEC +G+TG+ C  ++NECA + PC N G+C ++PG Y C+C + ++G+ C            E KC ++PC+N G CI +                  G Y+C+C  G++G  CE
Sbjct:   26 VCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCKLGWTGKNCEKAPCSPNP-CENGGKCADDLGQDSG-YRCVCRSGFSGARCQSDINECKKNP--CQNGGDCVN-----KHGSHLCNCKLGWTGRNCEEDVNECASSNPCKNGGVC---TNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGGVC-TNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSCECASGYTGKNCEIDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKD---------EDKCKVSPCQNGGKCINSD-----------------GGYSCECKGGYSGKHCE 385          

HSP 2 Score: 179.874 bits (455), Expect = 2.057e-49
Identity = 129/365 (35.34%), Postives = 194/365 (53.15%), Query Frame = 1
Query:  811 QCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSC-DDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDEC-SSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLS-CMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLI-NPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 1881
            +C C++G++G  C    ++C   P C +G    D   K    L CNCK  W G   N +   CS  PN CEN G+C +  ++  +  YRC+C+ GF GA C+   + C  N C NGG C +N + + ++C+C   + G  C+ +   C   NPC     C T+   GF CKC  G+ G+ C+ D +EC SS PC NGG+C + P G+ C C  G++G  C+ + N+C   + C NG  C +      C+C +G+TG+ C +++NECA + PC N G+C ++PG Y C+C + ++G+ C + +          +C   NPC+N G+C         N P         G Y+CKC  G+TG  CEK
Sbjct:   24 RCVCRSGFSGARCQSDINECKKNP-CQNGG---DCVNKHGSHL-CNCKLGWTGK--NCEKAPCS--PNPCENGGKCAD--DLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDC-VNKHGS-HLCNCKLGWTGRNCEEDVNECASSNPCKNGGVC-TNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCTNSPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANSPGRYSCECASGYTGKNCEIDV---------NECASSNPCKNGGVC--------TNSP---------GGYSCKCASGYTGKNCEK 348          

HSP 3 Score: 155.606 bits (392), Expect = 5.116e-41
Identity = 100/261 (38.31%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 1120 CIINKCFNGGKCKINVN-TNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCID---RPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCL-INPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C  N C NGG C  +    + Y C C   F G RCQ +   C  NPC    +C+ +K     C C  G+ G+NCE  +  CS  PC NGG C D   + SG+ CVC  GFSG RCQ + N+C+K  C NG  C+++     C C  GWTGR C +++NECA + PC N G+C +TPG + C+C + ++G+ C   +          +C   NPC+N G+C         N P         G Y+CKC  G+TG  CEK +
Sbjct:    2 CSPNPCENGGICADDRGQASGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCV-NKHGSHLCNCKLGWTGKNCE--KAPCSPNPCENGGKCADDLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCKLGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKCASGYTGKECKKDV---------NECASSNPCKNGGVC--------TNSP---------GGYSCKCASGYTGKNCEKDV 233          

HSP 4 Score: 106.301 bits (264), Expect = 2.100e-24
Identity = 95/307 (30.94%), Postives = 139/307 (45.28%), Query Frame = 1
Query:  592 DHFQLLVSFRYTCSQNYHGEECDK---LCKPSANERGFYNCSSNGDRICHT--GYSGSYCDKVV--CLKK--CINGACV----GPNQCRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCII-NKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSC-DDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQ 1455
            D       +R  C   + G  C      CK +  + G    + +G  +C+   G++G  C++ V  C     C NG       G   C+C +G+TG  C    ++C     C +G       T      +C C   + G  C  D+N C+++ N C+N G C N     +   Y C C  G+ G +CEK  + C   N C NGG C  +    +Y C+C   + G  C+ +   C   NPC     C T+   G+ CKC  G+ G+NCE DED+C   PC NGG CI+   G+ C C  G+SG  C+
Sbjct:   92 DDLGQDSGYRCVCRSGFSGARCQSDINECKKNPCQNGGDCVNKHGSHLCNCKLGWTGRNCEEDVNECASSNPCKNGGVCTNTPGGFSCKCASGYTGKECKKDVNECASSNPCKNGG----VCTNSPGGYSCKCASGYTGKNCEKDVNECASS-NPCKNGGVCTN-----SPGGYSCKCASGYTGKNCEKDVNECASSNPCKNGGVCANS--PGRYSCECASGYTGKNCEIDVNECASSNPCKNGGVC-TNSPGGYSCKCASGYTGKNCEKDEDKCKVSPCQNGGKCINSDGGYSCECKGGYSGKHCE 385          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000013302.2 (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:101166370])

HSP 1 Score: 300.442 bits (768), Expect = 4.416e-87
Identity = 183/538 (34.01%), Postives = 269/538 (50.00%), Query Frame = 1
Query:  154 FSQPVQCSKGVFEIHIKKYTLFPTLNLNK-CCPTRKNSTNSCSE-DCNIFMEICLSIYQKNPH-RYACDIGETYIKTDILGNYALN------DSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKN---DCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNIN 1713
            F+  V CS GVFE+ ++++     ++ N  CCP          + +C  F  +CL  YQ N      C  G     T +LG+ +        DS            W   F++I++  H D    L T+    +++  +++  +     W  K + T  D  +L  S+R+ C ++Y+G+ C   C+P  +  G ++C   G+ IC++G+ G YC + +CL  C   +G C  P +C+C+ G++G  CD CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C PG+ GA CE     C  N C NGG C  + N N Y C CP  FYG+ C+ +  +C D PC     C  +   G+ C+CP G+ G NCE   D CSS PCLNG  C+D  + +LC CP GF G  C+V  +    CQ   C NG  C D  N   C C  G+TG+ C+  ++ C  N PC N   C +  G Y C C   + G   N + ++P ++
Sbjct:   15 FTCQVLCS-GVFELKLQEFLNKKGISGNANCCPVGSAHPQGHQQCECKTFFRVCLKHYQANVSPEPPCTYGGAV--TPVLGSNSFQVPETNADSFTNPIRFPFGFTWPGTFSLIIEALHTDSLDDLTTENPERLISRITTQRHLSVGEEWF-KDMQT-ADRTELRYSYRFLCDEHYYGDGCSVFCRPRDDAFGHFSCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCTNTGQ----GSYTCTCLPGYTGASCEIQVSECSGNPCRNGGSC--SDNDNGYKCACPPGFYGNNCELSANTCADGPCFNGGRCADNPEGGYFCQCPAGYAGFNCEKKIDHCSSNPCLNGAECVDLVNTYLCRCPEGFIGSNCEVRSSISGHCQSFPCQNGGTCQDGGNDYSCTCPPGYTGKNCSSPVSRCHHN-PCHNGATCHERGGRYVCACVPGYGGH--NCQFLLPEMS 529          

HSP 2 Score: 136.346 bits (342), Expect = 3.406e-32
Identity = 96/321 (29.91%), Postives = 137/321 (42.68%), Query Frame = 1
Query:  937 CKKKWGGMFCN--IDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDN-PCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDR-ANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            C   W G +C   I L  C      C+  GEC               C+ GF G +C+    +CI       G C+       + C+C E + G  C  +   C  + PC+  + C       + C C PG+ G +CEI   ECS  PC NGG C D  +G+ C CP GF G+ C+++ N C    C NG +C D       C+C  G+ G  C + I+ C+ N PCLN   C+D   +Y C+C   + G  C ++  +         C   PC+N G C                 +  G  Y+C C PG+TG  C   +
Sbjct:  214 CNSGWKGQYCTEPICLPGCDEEHGFCDKPGECK--------------CRVGFSGRYCD----DCIRYPGCLHGTCQ-----QPWQCNCQEGWGGLFCNQDLNYCTHHKPCLNGATCTNTGQGSYTCTCLPGYTGASCEIQVSECSGNPCRNGGSCSDNDNGYKCACPPGFYGNNCELSANTCADGPCFNGGRCADNPEGGYFCQCPAGYAGFNCEKKIDHCSSN-PCLNGAECVDLVNTYLCRCPEGFIGSNCEVRSSISG------HCQSFPCQNGGTC-----------------QDGGNDYSCTCPPGYTGKNCSSPV 487          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dll4 (delta-like protein 4 [Source:NCBI gene;Acc:101163294])

HSP 1 Score: 297.36 bits (760), Expect = 4.983e-87
Identity = 175/524 (33.40%), Postives = 266/524 (50.76%), Query Frame = 1
Query:  181 GVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYAL----NDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNV------VIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS-GFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGS----YRCQCQATWSGQFCNLKIVV 1701
            G+FE+H+ ++     L          +   +C+  C  +  +CL  YQ       C  G T   T +LG  +       ++     I  +  W  +F++I++  H     K+        ++++  + +  +   + W   Q +      +L  S+R+ C+Q+Y+GE C K C P  +  G YNC+ +G   C  G+ G YC++ VC + C   NG C  P +C C+ GWTG  CD+C  YP C HG+C+        LP  CNC++ WGG+ C+ DLN+C+++   C N   C+N G       Y C C PGF GA+CE V   C  N C N GKC        Y C CP+ F G  C+ +  +C D+PC    EC   +   G+ CKCP G+ G NCE   D+C+  PC NGG+C+ +    +C C  GF+G RC++N NDC    C+NG  C DR N   C C TG+TGR C + ++EC ++ PCLN G+C ++  S      C C + ++G  C   +++
Sbjct:   23 GIFELHLHEFQNHQGL---------LSDGRACAPSCRTYFRVCLKNYQTVISPGDCIFGSTV--TPVLGANSFQAKDTGTLPGPIQIPFKFGWPGSFSLIIEAWHSSYGNKRPADYKSQDLLISFFAVQRHLSAGTDW--SQDTQTDRLTELKYSYRFVCNQSYYGESCSKKCTPRDDRFGHYNCTQDGQLTCLPGWKGKYCEEPVCQEGCSERNGNCSRPGECVCRKGWTGMFCDECETYPACNHGTCQ--------LPWQCNCQEGWGGLLCDQDLNFCTHH-RPCVNGATCMNTGQ----GSYTCTCLPGFTGANCELVMKECDSNPCRNSGKC--TSLEGSYKCMCPQGFEGLHCEQSTLTCADSPCFHGGECRERRNGHGYMCKCPRGYTGLNCERRVDKCTLLPCANGGLCLLQGGMSVCSCRAGFTGQRCEININDCSGSPCLNGGTCKDRINDYTCSCPTGFTGRNCQRVLDECTLH-PCLNGGLCTESGASGEPAVACICPSGFTGPQCESFVLL 517          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000037553.1 (delta like canonical Notch ligand 1 [Source:NCBI gene;Acc:101166370])

HSP 1 Score: 300.056 bits (767), Expect = 6.375e-87
Identity = 183/538 (34.01%), Postives = 268/538 (49.81%), Query Frame = 1
Query:  154 FSQPVQCSKGVFEIHIKKYTLFPTLNLNK-CCPTRKNSTNSCSE-DCNIFMEICLSIYQKNPH-RYACDIGETYIKTDILGNYALN------DSVKRDYSILVRERWKRNFNIIVKIKHYD----LITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKN---DCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNIN 1713
            F   V CS GVFE+ ++++     ++ N  CCP          + +C  F  +CL  YQ N      C  G     T +LG+ +        DS            W   F++I++  H D    L T+    +++  +++  +     W  K + T  D  +L  S+R+ C ++Y+G+ C   C+P  +  G ++C   G+ IC++G+ G YC + +CL  C   +G C  P +C+C+ G++G  CD CI YPGC+HG+C+         P  CNC++ WGG+FCN DLNYC+++   C N   C N G       Y C C PG+ GA CE     C  N C NGG C  + N N Y C CP  FYG+ C+ +  +C D PC     C  +   G+ C+CP G+ G NCE   D CSS PCLNG  C+D  + +LC CP GF G  C+V  +    CQ   C NG  C D  N   C C  G+TG+ C+  ++ C  N PC N   C +  G Y C C   + G  C  + ++P ++
Sbjct:    3 FVFQVLCS-GVFELKLQEFLNKKGISGNANCCPVGSAHPQGHQQCECKTFFRVCLKHYQANVSPEPPCTYGGAV--TPVLGSNSFQVPETNADSFTNPIRFPFGFTWPGTFSLIIEALHTDSLDDLTTENPERLISRITTQRHLSVGEEWF-KDMQT-ADRTELRYSYRFLCDEHYYGDGCSVFCRPRDDAFGHFSCGERGEIICNSGWKGQYCTEPICLPGCDEEHGFCDKPGECKCRVGFSGRYCDDCIRYPGCLHGTCQ--------QPWQCNCQEGWGGLFCNQDLNYCTHH-KPCLNGATCTNTGQ----GSYTCTCLPGYTGASCEIQVSECSGNPCRNGGSC--SDNDNGYKCACPPGFYGNNCELSANTCADGPCFNGGRCADNPEGGYFCQCPAGYAGFNCEKKIDHCSSNPCLNGAECVDLVNTYLCRCPEGFIGSNCEVRSSISGHCQSFPCQNGGTCQDGGNDYSCTCPPGYTGKNCSSPVSRCHHN-PCHNGATCHERGGRYVCACVPGYGGHNC--QFLLPEMS 517          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dlc (delta-like protein C [Source:NCBI gene;Acc:101170775])

HSP 1 Score: 295.434 bits (755), Expect = 8.885e-87
Identity = 173/515 (33.59%), Postives = 244/515 (47.38%), Query Frame = 1
Query:  151 YFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQ--KNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            Y S     S GVFE+ I  +   P L     CP +         DC +F  +CL   Q   NP    C  G     ++++G  ++  S       L +  W  +  +I++        +    +++ +++   +     W     S  ++  +L  S+R  C + YHGE C   C+P  +  G + C   G R C  G+ G YC + +C   C   +G C  P QC C+ GW G  CD+C  YPGC+HG+C+        LP  CNCK+ WGG+ CN DLNYC+N+   C+N   C N G       Y C C+PG+ G  CE   + C  N C NGG CK  +N   Y C CP+ FYG  C+ +  +C D PC     C+ + T G+ C CP G+ G NCE     CSS PC NG  C+D  +   C CP+GF+G RC+ N +DC    C N   C+D  N   C C  G+T   C+++ N C    PC N G C        C+C   + G  C
Sbjct:   12 YVSARAALSSGVFELKIVSFISAPPL-----CPLQPG-------DCRVFFRLCLKHVQHVSNPGT-PCTYGNA--SSEVIGVNSIPGSATVRVPFLYK--WPGSVALILEAWSAAESAETPSSLLSWTATRRTLSVGQEW-----SETENQTELHYSYRVICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYCSQSICAAGCSEEHGFCTSPGQCLCRQGWRGKLCDECALYPGCIHGTCQ--------LPWQCNCKEGWGGLLCNQDLNYCTNH-KPCKNGASCTNTGK----GSYTCTCRPGYLGKDCETETNECDSNPCRNGGSCKDLLN--DYSCACPQGFYGKNCEVSAMTCADGPCFNGGTCMEEGTGGYSCHCPAGYTGSNCEKRLGRCSSNPCANGAQCLDLMNQVTCRCPLGFTGSRCETNIDDCASRPCFNAGTCVDGVNNFTCRCPLGFTSNDCSEHRNPCD-QFPCHNGGACYVHFTGPVCKCSVGFMGNHC 488          

HSP 2 Score: 65.855 bits (159), Expect = 1.910e-10
Identity = 77/268 (28.73%), Postives = 105/268 (39.18%), Query Frame = 1
Query: 1123 IINKCFNGGKCKI-----NVNTNKYICD------CPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            I ++ ++G  C       N     ++CD      C E + G+ C  +Q+ C      G SE     TS  +C C  G+ G+ C    DEC+  P    G C   P  + C C  G+ G  C  + N C     C NGA C +       C C  G+ G+ C    NEC  N PC N G C D    Y C C   + G+ C +  +          C   PC N G C+                    G Y+C C  G+TG  CEK +
Sbjct:  150 ICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYC--SQSICA----AGCSEEHGFCTSPGQCLCRQGWRGKLC----DECALYPGCIHGTC-QLP--WQCNCKEGWGGLLCNQDLNYCTNHKPCKNGASCTNTGKGSYTCTCRPGYLGKDCETETNECDSN-PCRNGGSCKDLLNDYSCACPQGFYGKNCEVSAMT---------CADGPCFNGGTCMEEGT----------------GGYSCHCPAGYTGSNCEKRL 378          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: dlc (delta-like protein C [Source:NCBI gene;Acc:101170775])

HSP 1 Score: 295.049 bits (754), Expect = 1.146e-86
Identity = 173/515 (33.59%), Postives = 244/515 (47.38%), Query Frame = 1
Query:  151 YFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQ--KNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCI--NGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFC 1683
            Y S     S GVFE+ I  +   P L     CP +         DC +F  +CL   Q   NP    C  G     ++++G  ++  S       L +  W  +  +I++        +    +++ +++   +     W     S  ++  +L  S+R  C + YHGE C   C+P  +  G + C   G R C  G+ G YC + +C   C   +G C  P QC C+ GW G  CD+C  YPGC+HG+C+        LP  CNCK+ WGG+ CN DLNYC+N+   C+N   C N G       Y C C+PG+ G  CE   + C  N C NGG CK  +N   Y C CP+ FYG  C+ +  +C D PC     C+ + T G+ C CP G+ G NCE     CSS PC NG  C+D  +   C CP+GF+G RC+ N +DC    C N   C+D  N   C C  G+T   C+++ N C    PC N G C        C+C   + G  C
Sbjct:   12 YVSARAALSSGVFELKIVSFISAPPL-----CPLQPG-------DCRVFFRLCLKHVQHVSNPGT-PCTYGNA--SSEVIGVNSIPGSATVRVPFLYK--WPGSVALILEAWSAAESAETPSSLLSWTATRRTLSVGQEW-----SETENQTELHYSYRVICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYCSQSICAAGCSEEHGFCTSPGQCLCRQGWRGKLCDECALYPGCIHGTCQ--------LPWQCNCKEGWGGLLCNQDLNYCTNH-KPCKNGASCTNTGK----GSYTCTCRPGYLGKDCETETNECDSNPCRNGGSCKDLLN--DYSCACPQGFYGKNCEVSAMTCADGPCFNGGTCMEEGTGGYSCHCPAGYTGSNCEKRLGRCSSNPCANGAQCLDLMNQVTCRCPLGFTGSRCETNIDDCASRPCFNAGTCVDGVNNFTCRCPLGFTSNDCSEHRNPCD-QFPCHNGGACYVHFTGPVCKCSVGFMGNHC 488          

HSP 2 Score: 65.855 bits (159), Expect = 1.831e-10
Identity = 77/268 (28.73%), Postives = 105/268 (39.18%), Query Frame = 1
Query: 1123 IINKCFNGGKCKI-----NVNTNKYICD------CPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQ-KLSCMNGAKCMDRA-NRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            I ++ ++G  C       N     ++CD      C E + G+ C  +Q+ C      G SE     TS  +C C  G+ G+ C    DEC+  P    G C   P  + C C  G+ G  C  + N C     C NGA C +       C C  G+ G+ C    NEC  N PC N G C D    Y C C   + G+ C +  +          C   PC N G C+                    G Y+C C  G+TG  CEK +
Sbjct:  150 ICDRFYHGETCSTFCRPRNDTHGHFVCDEEGRRHCMEGWRGEYC--SQSICA----AGCSEEHGFCTSPGQCLCRQGWRGKLC----DECALYPGCIHGTC-QLP--WQCNCKEGWGGLLCNQDLNYCTNHKPCKNGASCTNTGKGSYTCTCRPGYLGKDCETETNECDSN-PCRNGGSCKDLLNDYSCACPQGFYGKNCEVSAMT---------CADGPCFNGGTCMEEGT----------------GGYSCHCPAGYTGSNCEKRL 378          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 1756.88 bits (4549), Expect = 0.000e+0
Identity = 956/987 (96.86%), Postives = 961/987 (97.37%), Query Frame = 1
Query:   94 MLQLRMYSKXXXXXXXXXXYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFLYKSRIANRPMTXXXXXXXXXXXXXXXXXXXSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSHNMKLSNVPLCNYQCHLSPFXXXXXXXXXXXXXXLFSQKNSSLESDEKFFYKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSRGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDXXXXXXXXXXXXYIRPSDNRVIIYNIRSAKPQKINYNLISHPHFKETSCFFDXXXXXXXXXXXXXTDSTIIDDISS 3054
            MLQLRMYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCEN GECLNFGNIKTNQQYRCICKP                      GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGF GRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIAN SIVMYSEP+ITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCS+NMKLSNVPLCNYQCHLSPFNANNN+AGSQNNSNLFSQKNSSLESDEKFF+KSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSS+GSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDSNLSSLNPIISNYIRPSDNRVIIYN RSAKPQKINYNLISHPHFKETSCFFDSNLILSSSIKSNKTDSTIIDDISS
Sbjct:    1 MLQLRMYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKP----------------------GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANGSIVMYSEPRITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSYNMKLSNVPLCNYQCHLSPFNANNNYAGSQNNSNLFSQKNSSLESDEKFFHKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSKGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDSNLSSLNPIISNYIRPSDNRVIIYNTRSAKPQKINYNLISHPHFKETSCFFDSNLILSSSIKSNKTDSTIIDDISS 965          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 1746.1 bits (4521), Expect = 0.000e+0
Identity = 951/982 (96.84%), Postives = 956/982 (97.35%), Query Frame = 1
Query:  109 MYSKXXXXXXXXXXYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFLYKSRIANRPMTXXXXXXXXXXXXXXXXXXXSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSHNMKLSNVPLCNYQCHLSPFXXXXXXXXXXXXXXLFSQKNSSLESDEKFFYKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSRGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDXXXXXXXXXXXXYIRPSDNRVIIYNIRSAKPQKINYNLISHPHFKETSCFFDXXXXXXXXXXXXXTDSTIIDDISS 3054
            MYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCEN GECLNFGNIKTNQQYRCICKP                      GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGF GRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIAN SIVMYSEP+ITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCS+NMKLSNVPLCNYQCHLSPFNANNN+AGSQNNSNLFSQKNSSLESDEKFF+KSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSS+GSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDSNLSSLNPIISNYIRPSDNRVIIYN RSAKPQKINYNLISHPHFKETSCFFDSNLILSSSIKSNKTDSTIIDDISS
Sbjct:    1 MYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKP----------------------GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANGSIVMYSEPRITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSYNMKLSNVPLCNYQCHLSPFNANNNYAGSQNNSNLFSQKNSSLESDEKFFHKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSKGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAIENVNLAWPTVDSNLSSLNPIISNYIRPSDNRVIIYNTRSAKPQKINYNLISHPHFKETSCFFDSNLILSSSIKSNKTDSTIIDDISS 960          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 1555.42 bits (4026), Expect = 0.000e+0
Identity = 830/860 (96.51%), Postives = 835/860 (97.09%), Query Frame = 1
Query:   94 MLQLRMYSKXXXXXXXXXXYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANSSIVMYSEPQITTEGFLYKSRIANRPMTXXXXXXXXXXXXXXXXXXXSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSHNMKLSNVPLCNYQCHLSPFXXXXXXXXXXXXXXLFSQKNSSLESDEKFFYKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSRGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNL 2673
            MLQLRMYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCEN GECLNFGNIKTNQQYRCICKP                      GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGF GRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIAN SIVMYSEP+ITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCS+NMKLSNVPLCNYQCHLSPFNANNN+AGSQNNSNLFSQKNSSLESDEKFF+KSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSS+GSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNL
Sbjct:    1 MLQLRMYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKCCPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNYALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKP----------------------GKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIANGSIVMYSEPRITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSFLCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNNEKIPLSMTKLNNEMIQNEKCIPRYKCSYNMKLSNVPLCNYQCHLSPFNANNNYAGSQNNSNLFSQKNSSLESDEKFFHKSSLSVRDGEPESQYHNLSSMKSVDKDPFTGSIDLDNYDKFNYKSSKGSNSAMVYRKSNNNLPQELCSSHNSLLEAPIKQNL 838          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.669e-59
Identity = 178/589 (30.22%), Postives = 256/589 (43.46%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLN-KCCPTRKNST-NSCSEDCNIFMEICLSIYQKN-------PHRYACDIGETYIKTDILGNYAL--NDSVKRDYSILVRERWKRNFNIIVKIKHYDL-----ITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSG---FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 1878
            SK  F + I KY  +    L+ KCC    +   ++C+  C     ICL  Y  +       P+   C  G+    T+I G+ ++  N      Y   ++  W  +  +I  I+ YD        K  +  V   +       SS W    LS  +  +Q   S    C  +Y+GE CD+ CK   N  G Y C  NG+++C  G+ GS C+  +C   C  I+G C  P +CRC+ GW G  CD+C+ YPGC HG+C          P TC+C+  WGG FC+  LNYC+ N N C+N G C N   +   Q Y+CIC  GF+G  CE     C  N C  G   K   +  ++ C C E + G  C  + + CD N C    +C  D+    +C C  G+ G  C +    C +  C +   C  + +    + C+C  G++G  C    N+C    C N   C D  N   C C+T + G+ C  NI     NQPC N G+C +    Y C+C+  ++G  C +          +  C  NPC N   C                   I   + C CN  F G  CE
Sbjct:   28 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRL--TEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLI--IEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQF--SMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDS-------PWTCSCENNWGGQFCDQSLNYCAEN-NPCKNGGICENL--LSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGTCMK---SKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI--ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI---------YKTGCSPNPCLNGAYCYT-----------------INQDFYCHCNKEFWGKRCE 563          

HSP 2 Score: 135.191 bits (339), Expect = 1.023e-31
Identity = 104/340 (30.59%), Postives = 150/340 (44.12%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKLCKPSANE--RGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQ----CRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHN-CIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCD----DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ 1572
            + +   F   C++ + G+ C+       NE     Y+  S    +  +G   +YC K         G C+   +    CRC  G+ GDSC    D C   P C +G    D          C C   + G  C    +YC  +P  C N G CL   +   N  + C CK  + G  C   +H+ C  N C NGG C      N + C C + + G  CQF           N C     CI    + F C C PGF G++C+I+ +EC+  PC NGG CID+ + + C+C  GF G  CQ+N ++C    C  GA C+DR +  +C C  G  G++C+ 
Sbjct:  543 YTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKY--------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNP-CKNGGICIDSINN----FECICDNGFFGKTCEERTDYCIKSP--CMNYGVCLRHSDELYND-FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 866          

HSP 3 Score: 77.411 bits (189), Expect = 6.024e-14
Identity = 87/326 (26.69%), Postives = 128/326 (39.26%), Query Frame = 1
Query:  937 CKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKV--EHNC--IINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECS-SKPCLNGGMC---IDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 1887
            CK  + G FC+    YC NN             G+ K +     +C  G+ G+ C     +  C  I   C N G+C+         CD                C   P   +  C+    S + C C   + G+ C+   + C+ + PC NGG+C   +     + C+CP GF G  C+++   C    C  G  CM       C+C   WTG++C+Q+ + C  N  C N G C  D  G+ RC CQ  + G  C          +L   C  + C++   C + S                 G Y C C PG+TG  C+K I
Sbjct:  189 CKPDYYGEFCD---RYCKNNG------------GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCD---------------ECMKYPGCKHGTCVD---SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDP--CFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSEC----------HLAAPCENSQCKHALDCQIQSTAL--------------GDYKCLCQPGYTGKYCDKEI 453          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.835e-59
Identity = 189/634 (29.81%), Postives = 271/634 (42.74%), Query Frame = 1
Query:  175 SKGVFEIHIKKYTLFPTLNLN-KCCPTRKNST-NSCSEDCNIFMEICLSIYQKN-------PHRYACDIGETYIKTDILGNYAL--NDSVKRDYSILVRERWKRNFNIIVKIKHYDL-----ITKKNVVIVTLXXXXXXXXXXXXWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCE-----------------------------------KVEHNCIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS--GFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNN-GICILNSLPTSVNIPNNEYFKPIGG-------PYTCKCNPGFTGDLCEKVI 1887
            SK  F + I KY  +    L+ KCC    +   ++C+  C     ICL  Y  +       P+   C  G+    T+I G+ ++  N      Y   ++  W  +  +I  I+ YD        K  +  V   +       SS W    LS  +  +Q   S    C  +Y+GE CD+ CK   N  G Y C  NG+++C  G+ GS C+  +C   C  I+G C  P +CRC+ GW G  CD+C+ YPGC HG+C          P TC+C+  WGG FC+  LNYC+ N N C+N G C N   +   Q Y+CIC  GF+G  CE                                   +    C  N C NGG+C  + N N+  C C + + G  C      C+++ C    +C    T+   +KC C PG+ G+ C+ + +EC   PC N G+C D  + + C C   F G  C++N   CQ   C NG  C +      C+C TG+TG  C      C+ N PCLN   C      + C C   + G+ C          +    C    C +    C +  +  S  I +N Y    G         + C+C PGF GD CE  I
Sbjct:   21 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRL--TEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLI--IEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQF--SMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDS-------PWTCSCENNWGGQFCDQSLNYCAEN-NPCKNGGICENL--LSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRR-CICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPN-PCLNGAYCYTINQDFYCHCNKEFWGKRC---------EHSRPYCGNESCESAYDACSMPQMLNSSGIKHN-YCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDI 621          

HSP 2 Score: 135.191 bits (339), Expect = 1.108e-31
Identity = 104/340 (30.59%), Postives = 150/340 (44.12%), Query Frame = 1
Query:  598 FQLLVSFRYTCSQNYHGEECDKLCKPSANE--RGFYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQ----CRCQTGWTGDSC----DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHN-CIINKCFNGGKCKINVNTNKYICDCPESFYGDRCQFNQTSCD----DNPCVGNSECITDKTSGFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ 1572
            + +   F   C++ + G+ C+       NE     Y+  S    +  +G   +YC K         G C+   +    CRC  G+ GDSC    D C   P C +G    D          C C   + G  C    +YC  +P  C N G CL   +   N  + C CK  + G  C   +H+ C  N C NGG C      N + C C + + G  CQF           N C     CI    + F C C PGF G++C+I+ +EC+  PC NGG CID+ + + C+C  GF G  CQ+N ++C    C  GA C+DR +  +C C  G  G++C+ 
Sbjct:  536 YTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKY--------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNP-CKNGGICIDSINN----FECICDNGFFGKTCEERTDYCIKSP--CMNYGVCLRHSDELYND-FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 859          
The following BLAST results are available for this feature:
BLAST of Delta-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLL17.974e-8632.95delta like canonical Notch ligand 1 [Source:HGNC S... [more]
DLL17.974e-8632.95delta like canonical Notch ligand 1 [Source:HGNC S... [more]
JAG21.783e-7931.44jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
JAG27.104e-7832.61jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
DLL47.133e-7632.60delta like canonical Notch ligand 4 [Source:HGNC S... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clec-786.645e-4231.00C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
crb-12.000e-3832.69Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
lin-127.176e-3330.18pep chromosome:WBcel235:III:9060096:9071760:-1 gen... [more]
glp-12.275e-2731.03pep chromosome:WBcel235:III:9092241:9099698:1 gene... [more]
apx-14.095e-2731.80Anterior pharynx in excess protein 1 [Source:UniP... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dl1.522e-8032.77gene:FBgn0000463 transcript:FBtr0083739[more]
Dl1.522e-8032.77gene:FBgn0000463 transcript:FBtr0083740[more]
Dl1.522e-8032.77gene:FBgn0000463 transcript:FBtr0304658[more]
Ser1.529e-5827.31gene:FBgn0004197 transcript:FBtr0344121[more]
Ser1.529e-5827.31gene:FBgn0004197 transcript:FBtr0085128[more]
back to top
BLAST of Delta-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlc5.550e-9135.08deltaC [Source:NCBI gene;Acc:30120][more]
dlc8.322e-9135.08deltaC [Source:NCBI gene;Acc:30120][more]
dlb3.897e-8732.97deltaB [Source:NCBI gene;Acc:30141][more]
dla4.337e-8633.46deltaA [Source:NCBI gene;Acc:30131][more]
dla5.684e-8633.46deltaA [Source:NCBI gene;Acc:30131][more]
back to top
BLAST of Delta-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsdme2.279e-8533.90gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme2.720e-8533.90gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme3.531e-8533.90gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme3.837e-8533.90gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
gsdme1.312e-8233.40gasdermin E [Source:Xenbase;Acc:XB-GENE-983245][more]
back to top
BLAST of Delta-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dll16.293e-8532.70delta like canonical Notch ligand 1 [Source:MGI Sy... [more]
Dll45.521e-7831.95delta like canonical Notch ligand 4 [Source:MGI Sy... [more]
Jag21.666e-7530.22jagged 2 [Source:MGI Symbol;Acc:MGI:1098270][more]
Jag17.056e-7531.99jagged 1 [Source:MGI Symbol;Acc:MGI:1095416][more]
Notch21.582e-4933.02notch 2 [Source:MGI Symbol;Acc:MGI:97364][more]
back to top
BLAST of Delta-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9IAT6|DLLC_DANRE9.656e-9035.27Delta-like protein C OS=Danio rerio OX=7955 GN=dlc... [more]
sp|P97677|DLL1_RAT1.039e-8633.14Delta-like protein 1 OS=Rattus norvegicus OX=10116... [more]
sp|O57409|DLLB_DANRE2.942e-8632.97Delta-like protein B OS=Danio rerio OX=7955 GN=dlb... [more]
sp|Q6DI48|DLLA_DANRE3.373e-8533.46Delta-like protein A OS=Danio rerio OX=7955 GN=dla... [more]
sp|O00548|DLL1_HUMAN3.829e-8532.95Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DL... [more]
back to top
BLAST of Delta-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N7Z9Z08.355e-10133.28Delta-like protein OS=Scylla olivacea OX=85551 PE=... [more]
A0A385Z8N98.401e-9933.12Delta-like protein OS=Penaeus vannamei OX=6689 PE=... [more]
A0MK382.216e-9835.99Delta-like protein OS=Parhyale hawaiensis OX=31751... [more]
A0A1Y1KDN65.352e-9833.81Delta-like protein OS=Photinus pyralis OX=7054 GN=... [more]
A0A067QK077.103e-9835.53Delta-like protein (Fragment) OS=Zootermopsis neva... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dld3.908e-8734.67delta like canonical Notch ligand 1 [Source:NCBI g... [more]
dlc4.125e-8632.91deltaC [Source:NCBI gene;Acc:30120][more]
dlc4.545e-8632.91deltaC [Source:NCBI gene;Acc:30120][more]
dlc3.473e-8335.27deltaC [Source:NCBI gene;Acc:30120][more]
dlb2.310e-8033.79deltaB [Source:NCBI gene;Acc:30141][more]
back to top
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG12.665e-7034.66jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
ENSPMAT00000002643.12.602e-4738.13pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 g... [more]
ENSPMAT00000000962.12.307e-4128.40pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 ... [more]
ENSPMAT00000009101.12.952e-3739.66pep scaffold:Pmarinus_7.0:GL486879:2800:7708:-1 ge... [more]
ENSPMAT00000002014.11.740e-3534.72pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415063.721e-5534.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361963.831e-5434.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488514.233e-5335.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340845.905e-5334.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469699.109e-5335.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013302.24.416e-8734.01delta like canonical Notch ligand 1 [Source:NCBI g... [more]
dll44.983e-8733.40delta-like protein 4 [Source:NCBI gene;Acc:1011632... [more]
ENSORLT00000037553.16.375e-8734.01delta like canonical Notch ligand 1 [Source:NCBI g... [more]
dlc8.885e-8733.59delta-like protein C [Source:NCBI gene;Acc:1011707... [more]
dlc1.146e-8633.59delta-like protein C [Source:NCBI gene;Acc:1011707... [more]
back to top
BLAST of Delta-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022173.10.000e+096.86SMESG000022173.1[more]
SMESG000022173.10.000e+096.84SMESG000022173.1[more]
SMESG000022173.10.000e+096.51SMESG000022173.1[more]
SMESG000027402.11.669e-5930.22SMESG000027402.1[more]
SMESG000027402.11.835e-5929.81SMESG000027402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002414 ID=SMED30002414|Name=Delta-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3432bp
AATTATTAAAAAAATTTTTAAAAAATCGAGTGCCTTTTTTCGATAAAAAG
AAATTTTCAGAAAACAAAAAATTTTGAAATTCAATTTCAATCAATGCTTC
AATTAAGAATGTACTCAAAACTATTAATTTTATTCTTGATTAATCTATTA
TATTTCAGTCAACCGGTTCAATGCAGCAAAGGTGTTTTTGAAATTCACAT
CAAAAAATATACTTTATTTCCTACTCTCAATTTAAATAAATGTTGCCCAA
CTCGGAAAAACTCGACAAATTCCTGTTCAGAAGATTGCAATATTTTCATG
GAGATTTGTCTATCTATTTATCAAAAAAACCCACACAGATACGCTTGCGA
TATCGGAGAGACCTACATAAAAACGGATATTTTAGGAAATTATGCTTTGA
ATGATTCTGTGAAAAGAGATTATTCGATTTTAGTCAGGGAGAGATGGAAA
CGCAATTTCAATATCATTGTGAAAATCAAGCATTACGATTTAATTACTAA
AAAAAACGTTGTAATAGTTACATTGTCATCCTCTGAGGTCGATGTTAAAC
CGAGCTCTTCGTGGATCACAAAACAGCTTTCGACTCCGAAAGATCATTTT
CAACTTCTTGTATCATTTCGGTATACTTGTTCTCAAAACTACCATGGAGA
AGAATGTGATAAGCTGTGTAAACCCAGCGCCAATGAAAGAGGATTTTATA
ACTGTTCAAGTAATGGGGATCGGATATGTCACACTGGATACAGCGGGAGT
TATTGTGATAAAGTCGTATGTCTCAAAAAATGCATTAATGGGGCTTGTGT
TGGTCCTAATCAGTGCAGATGTCAAACAGGTTGGACTGGCGACAGCTGTG
ACCAGTGTATTCCATATCCTGGCTGTGTCCACGGCAGCTGTAGATTCGAT
GAGACGACGAAAGAACTGTTACCATTGACATGCAATTGTAAAAAGAAATG
GGGAGGAATGTTTTGCAATATTGATCTAAATTATTGCTCAAACAATCCGA
ATGTCTGCGAAAACGAAGGAGAATGTTTGAATTTTGGAAATATCAAAACA
AATCAGCAATATCGATGCATTTGTAAGCCCGGTTTTAAAGGGGCCCACTG
TGAGAAAGTCGAACACAATTGTATTATTAATAAATGCTTCAATGGAGGAA
AATGTAAAATTAACGTCAACACCAATAAATATATCTGTGATTGCCCAGAA
TCATTTTATGGTGACCGATGCCAATTTAACCAGACTTCTTGTGATGACAA
CCCTTGTGTTGGCAATTCTGAATGCATTACAGATAAGACTTCTGGTTTCA
AATGCAAATGCCCTCCTGGATTTATCGGCCGTAACTGCGAAATAGACGAA
GACGAATGTTCTTCTAAGCCCTGCTTAAATGGAGGAATGTGTATTGATCG
ACCAAGCGGGTTTCTATGTGTTTGTCCAGTTGGATTTTCTGGAGATCGTT
GCCAAGTCAACAAAAATGATTGTCAAAAGCTGTCATGCATGAATGGTGCC
AAATGCATGGATCGAGCCAATAGAATTGACTGTGAATGTACAACCGGCTG
GACTGGTAGGATGTGCAATCAAAATATCAACGAATGTGCAATCAATCAAC
CGTGCCTTAACAATGGAATATGTATTGATACGCCAGGTTCTTATAGATGT
CAATGTCAAGCAACTTGGAGTGGACAATTTTGCAATTTAAAAATCGTTGT
TCCAAACATCAATTATTTAGAGAGAAAATGTTTAATTAATCCATGTAGAA
ATAATGGAATTTGTATTTTAAATTCTTTGCCAACGAGCGTGAATATACCA
AACAATGAATATTTTAAACCAATTGGTGGTCCCTATACTTGTAAATGTAA
TCCAGGATTTACCGGGGATTTGTGTGAAAAGGTTATCATAGCAAACAGTT
CAATTGTCATGTATTCGGAGCCCCAAATAACAACAGAGGGTTTTCTGTAT
AAAAGCCGCATTGCTAATCGTCCAATGACTCTAATTCTCTTGATAATTAT
TGCAATAGGAGTACCGACTATTATTGTAATAATCGTTTCATTTCTCTGCT
GTGGAAATTGCAGTAAATTAAAACAACCGAAATCAAATTATCAAAAGGAT
TGCAAGAAAGAGAATATTATTGAAAGAACGAATATAAAAATTCTTAATAA
CAAACTAAATCGTAGTCTTCCTCAGCATTATTTGAAGAACAATGAAAAAA
TCCCATTGTCTATGACAAAACTGAACAATGAAATGATTCAGAATGAAAAA
TGTATTCCACGATATAAATGCAGTCACAACATGAAACTGTCCAATGTTCC
CTTATGCAATTATCAATGTCACTTATCGCCGTTCAATGCAAACAACAATC
ATGCCGGATCTCAAAATAATTCAAATTTATTTTCACAGAAAAACAGTTCT
TTAGAAAGCGATGAGAAATTCTTTTATAAATCCTCTTTGTCAGTTCGTGA
TGGTGAACCAGAATCGCAATATCATAATTTGAGTTCCATGAAGTCAGTTG
ACAAAGATCCTTTCACCGGTTCGATAGACTTGGACAATTATGACAAATTC
AACTACAAGTCGTCGAGGGGTTCCAATTCAGCAATGGTTTATAGAAAAAG
CAATAATAATCTCCCACAAGAGTTGTGCTCCAGTCATAATTCTCTGTTAG
AAGCTCCAATCAAACAAAATTTAAGAACTGCTGTATCTCAACAACTTTCC
CAACCCCCCGTTTCTCCTGTTTTCGAAGATAAAGATTGCGGTATGCCTGG
AAAACTGTTTCGAATCAATTCCAAAACTAGTCTCAATGCAATAGAGAACG
TCAATTTAGCTTGGCCTACAGTTGACTCTAATCTCTCATCCCTTAACCCA
ATAATTTCTAACTACATCAGACCTTCAGACAATCGAGTCATTATCTACAA
TATTCGTTCGGCAAAACCTCAAAAAATCAATTATAACTTGATTTCACATC
CTCATTTTAAAGAAACGTCATGCTTTTTCGACTCGAATCTCATTCTCTCA
TCGTCAATCAAATCCAACAAAACCGATTCGACCATAATAGACGATATTTC
ATCTAAAAAACTCTAACTCTATCTTAAAATGTTACTTTTTTACATTGAAT
TCTTTCAATTTTATTCACTAAGTGCAATAAATTCAATTCTACAAAAAACT
CAGTCTCATTGTGGAATTGAATTGTTTTTATTTTCTTTGACAATAAAAAG
GGGATAACGACTTAATAAAATATTAATGTTTTTTCTTACTCAAAAAAAAA
AATCCTATGCTCAATTAATTCTCTTTTATTTTTCGATGGAGAAGGAAAAA
AAATTAGAAAACCTTTTTGTTTGTTTTTTTGTATTGATATATTTTTTGAT
ATACCACATCATCATTTAAGATATCAAATGCCCTTATCTCGGTGTTGTCA
AAATCACAATCGTTACACACACACACACATAA
back to top

protein sequence of SMED30002414-orf-1

>SMED30002414-orf-1 ID=SMED30002414-orf-1|Name=SMED30002414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=991bp
MLQLRMYSKLLILFLINLLYFSQPVQCSKGVFEIHIKKYTLFPTLNLNKC
CPTRKNSTNSCSEDCNIFMEICLSIYQKNPHRYACDIGETYIKTDILGNY
ALNDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVD
VKPSSSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERG
FYNCSSNGDRICHTGYSGSYCDKVVCLKKCINGACVGPNQCRCQTGWTGD
SCDQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSN
NPNVCENEGECLNFGNIKTNQQYRCICKPGFKGAHCEKVEHNCIINKCFN
GGKCKINVNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTS
GFKCKCPPGFIGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSG
DRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAI
NQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINP
CRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVIIA
NSSIVMYSEPQITTEGFLYKSRIANRPMTLILLIIIAIGVPTIIVIIVSF
LCCGNCSKLKQPKSNYQKDCKKENIIERTNIKILNNKLNRSLPQHYLKNN
EKIPLSMTKLNNEMIQNEKCIPRYKCSHNMKLSNVPLCNYQCHLSPFNAN
NNHAGSQNNSNLFSQKNSSLESDEKFFYKSSLSVRDGEPESQYHNLSSMK
SVDKDPFTGSIDLDNYDKFNYKSSRGSNSAMVYRKSNNNLPQELCSSHNS
LLEAPIKQNLRTAVSQQLSQPPVSPVFEDKDCGMPGKLFRINSKTSLNAI
ENVNLAWPTVDSNLSSLNPIISNYIRPSDNRVIIYNIRSAKPQKINYNLI
SHPHFKETSCFFDSNLILSSSIKSNKTDSTIIDDISSKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR001774DSL
IPR013032EGF-like_CS
IPR018097EGF_Ca-bd_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007154cell communication
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 114..164
e-value: 7.0E-6
score: 35.5
coord: 66..100
e-value: 1.1E-5
score: 35.0
coord: 28..61
e-value: 0.093
score: 21.8
coord: 1..23
e-value: 66.0
score: 6.7
IPR000742EGF-like domainPFAMPF00008EGFcoord: 67..96
e-value: 4.8E-7
score: 30.0
coord: 29..58
e-value: 1.1E-4
score: 22.4
coord: 115..161
e-value: 2.0E-5
score: 24.8
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 1..23
score: 12.76
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 63..100
score: 21.772
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 25..61
score: 16.118
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 111..164
score: 12.456
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 63..100
e-value: 1.3E-10
score: 51.3
coord: 1..23
e-value: 0.34
score: 5.6
coord: 25..61
e-value: 0.0038
score: 21.3
IPR013032EGF-like, conserved sitePFAMPF12661hEGFcoord: 2..17
e-value: 0.026
score: 15.2
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 152..163
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 88..99
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 49..60
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 11..22
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 49..60
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 152..163
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 11..22
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 68..101
e-value: 1.3E-11
score: 46.5
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 117..166
e-value: 1.2E-9
score: 39.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 30..67
e-value: 1.1E-9
score: 39.7
coord: 1..29
e-value: 4.0E-6
score: 28.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 349..368
NoneNo IPR availablePANTHERPTHR24049FAMILY NOT NAMEDcoord: 2..188
NoneNo IPR availableCDDcd00054EGF_CAcoord: 63..99
e-value: 1.21486E-11
score: 57.2614
NoneNo IPR availableCDDcd00054EGF_CAcoord: 2..23
e-value: 0.00125852
score: 34.5346
NoneNo IPR availableCDDcd00054EGF_CAcoord: 25..60
e-value: 0.00271567
score: 33.7642
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 1..30
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 63..105
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 114..168
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 26..68
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 79..90
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 2..13
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 63..88