SCAN domain-containing protein 3

Overview
NameSCAN domain-containing protein 3
Smed IDSMED30002410
Length (bp)1337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCAN domain-containing protein 3 (SMED30002410) t-SNE clustered cells

Violin plots show distribution of expression levels for SCAN domain-containing protein 3 (SMED30002410) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCAN domain-containing protein 3 (SMED30002410) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCAN domain-containing protein 3 (SMED30002410) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SCAN domain-containing protein 3 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 51.2174 bits (121), Expect = 1.221e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = -1
Query: 1140 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYL 1241
            M LICSISNE+PE P ++  S H YERRLI++Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYI 34          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Human
Match: PRPF19 (pre-mRNA processing factor 19 [Source:HGNC Symbol;Acc:HGNC:17896])

HSP 1 Score: 51.2174 bits (121), Expect = 2.733e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = -1
Query: 1140 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYL 1241
            M LICSISNE+PE P ++  S H YERRLI++Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYI 34          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 37.7354 bits (86), Expect = 5.577e-8
Identity = 19/48 (39.58%), Postives = 28/48 (58.33%), Query Frame = 1
Query:   67 KKMSELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLD 210
            K + +   LF ++ ++ K+ Y+ DIF  LNELN  +Q  N    TCLD
Sbjct:  519 KAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNS---TCLD 563          

HSP 2 Score: 32.7278 bits (73), Expect = 5.577e-8
Identity = 16/62 (25.81%), Postives = 32/62 (51.61%), Query Frame = 3
Query:  246 SLEMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENSVE 431
            +L  F + H I+  K+  ++   +EHL +L  +   +FP +    +   ++PF+  AE+  E
Sbjct:  592 TLSAFFEEHDIEQHKRITVVISVKEHLDMLASEISWYFPNLPEIPFALARSPFSVKAEDVPE 653          

HSP 3 Score: 25.0238 bits (53), Expect = 5.577e-8
Identity = 12/23 (52.17%), Postives = 16/23 (69.57%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFLKK 73
            LS GKVL R+FELR ++  F  +
Sbjct:  496 LSRGKVLKRIFELRDELKMFFNQ 518          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Mouse
Match: Prpf19 (pre-mRNA processing factor 19 [Source:MGI Symbol;Acc:MGI:106247])

HSP 1 Score: 51.2174 bits (121), Expect = 1.812e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = -1
Query: 1140 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYL 1241
            M LICSISNE+PE P ++  S H YERRLI++Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYI 34          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Mouse
Match: Prpf19 (pre-mRNA processing factor 19 [Source:MGI Symbol;Acc:MGI:106247])

HSP 1 Score: 51.2174 bits (121), Expect = 1.818e-6
Identity = 21/34 (61.76%), Postives = 27/34 (79.41%), Query Frame = -1
Query: 1140 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYL 1241
            M LICSISNE+PE P ++  S H YERRLI++Y+
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYI 34          
BLAST of SCAN domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q4R6P1|F200A_MACFA (Protein FAM200A OS=Macaca fascicularis OX=9541 GN=FAM200A PE=2 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 3.126e-6
Identity = 25/56 (44.64%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   67 KKMSELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKKT 234
            +K S L  +FEN   V KL Y++DIF  LNELN K+Q +N ++   L+ + G +KT
Sbjct:  326 EKQSHLANIFENDIWVTKLAYLSDIFGILNELNLKIQGKNNDIFQYLEHILGFQKT 381          

HSP 2 Score: 26.1794 bits (56), Expect = 3.126e-6
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFL 67
            LS GKVL+R++ELR ++  FL
Sbjct:  304 LSQGKVLSRVYELRNEIYIFL 324          
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Match: A0A0L7QQ45 (SCAN domain-containing protein 3 OS=Habropoda laboriosa OX=597456 GN=WH47_06898 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.426e-49
Identity = 50/73 (68.49%), Postives = 61/73 (83.56%), Query Frame = 3
Query:  225 KKNLQ*GSLEMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENSVEALSL 443
            +K LQ GSLEMFQ+T++  I+ KQ+ILDL Q HL+LLQ+KF H+F TINT QYNWI+NPF +DAENS EALSL
Sbjct:  380 QKELQKGSLEMFQRTYKSMIKNKQLILDLTQPHLSLLQEKFNHYFFTINTEQYNWIRNPFLTDAENSTEALSL 452          

HSP 2 Score: 78.1814 bits (191), Expect = 3.426e-49
Identity = 37/52 (71.15%), Postives = 42/52 (80.77%), Query Frame = 1
Query:   73 MSELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLK 228
            M+ELH LFE++H + KL YM DIFEHLNELNKKMQ R+EN LTC DKL G K
Sbjct:  322 MTELHQLFEDNHWMAKLAYMADIFEHLNELNKKMQGRSENYLTCSDKLMGFK 373          

HSP 3 Score: 47.7506 bits (112), Expect = 3.426e-49
Identity = 37/102 (36.27%), Postives = 45/102 (44.12%), Query Frame = 1
Query:  451 REGFVELRAVGTLKLKFNEFSLDYN*GGISIRXXXXXXXXXXXXXXXXXXXXXXXXEVM-------------LNGLDQELHVPLSHIEPNIKYLCSLKQTRI 717
            RE F+ELR  GTLKL F+E  L      IS++                 S      +               L GLD EL V LS+IEPNIK +CS KQ +I
Sbjct:  455 REEFIELRNDGTLKLNFSEMPLAN--FWISVKKEYPQISDKAIAILLPFSTTYLCEQSFSTLVLIKNDKRSCLKGLDHELRVALSNIEPNIKRICSSKQAQI 554          

HSP 4 Score: 35.039 bits (79), Expect = 3.426e-49
Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFLKK 73
            LS GKVLARLFELR +  EFL K
Sbjct:  297 LSRGKVLARLFELRNEAREFLLK 319          
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Match: A0A0L7QW41 (SCAN domain-containing protein 3 (Fragment) OS=Habropoda laboriosa OX=597456 GN=WH47_05031 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 8.981e-37
Identity = 48/73 (65.75%), Postives = 59/73 (80.82%), Query Frame = 3
Query:  225 KKNLQ*GSLEMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENSVEALSL 443
            +K LQ GSLEMFQ+T++  I+ KQ+ILDL Q HL+LLQ+K  H+F TINT QYNWI+N F +DAENS EALSL
Sbjct:  302 QKELQKGSLEMFQRTYKSMIKNKQLILDLTQPHLSLLQEKLNHYFFTINTEQYNWIRNSFLADAENSTEALSL 374          

HSP 2 Score: 50.8322 bits (120), Expect = 8.981e-37
Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 1
Query:  106 HSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLK 228
            + + KL Y   IFEH+N+LNKKMQ R+EN LTC DKL G K
Sbjct:  258 YWMAKLAY---IFEHINQLNKKMQGRSENYLTCSDKLMGFK 295          

HSP 3 Score: 43.8986 bits (102), Expect = 8.981e-37
Identity = 24/45 (53.33%), Postives = 29/45 (64.44%), Query Frame = 2
Query:  515 WITIKEEYPYD-------FYCSSSIYLCKISFST*VLIKNDKRSC 628
            WI++K+EYP             S+ YLC+ SFST VLIKNDKRSC
Sbjct:  402 WISVKKEYPQISVKVVPILLPFSTTYLCEQSFSTLVLIKNDKRSC 446          

HSP 4 Score: 30.0314 bits (66), Expect = 8.981e-37
Identity = 14/22 (63.64%), Postives = 16/22 (72.73%), Query Frame = 1
Query:  451 REGFVELRAVGTLKLKFNEFSL 516
            RE F+ELR  GTLKL F+E  L
Sbjct:  377 REEFIELRNDGTLKLNFSEMPL 398          
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Match: A0A087U6M3 (SCAN domain-containing protein 3 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_03270 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 5.755e-17
Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 1
Query:  115 VKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLK 228
             +L Y+ DIF HLNELN +MQ RNENLLT  DK+NG +
Sbjct:  329 ARLAYLADIFHHLNELNTRMQGRNENLLTSTDKINGFR 366          

HSP 2 Score: 40.0466 bits (92), Expect = 5.755e-17
Identity = 16/56 (28.57%), Postives = 34/56 (60.71%), Query Frame = 3
Query:  243 GSLEMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFAS 410
            G+LEMF  T Q +      + ++  +HL  L++K   +F +++T   +W+++P++S
Sbjct:  379 GNLEMFTLTMQWQGVHTAALCEIIVKHLKTLEEKLSFYFSSVSTECLDWVRDPYSS 434          

HSP 3 Score: 29.6462 bits (65), Expect = 5.755e-17
Identity = 14/30 (46.67%), Postives = 18/30 (60.00%), Query Frame = 1
Query:  628 LNGLDQELHVPLSHIEPNIKYLCSLKQTRI 717
            L  +D+EL V LS I   I  LCS KQ ++
Sbjct:  517 LRTVDEELRVCLSSIPARISALCSAKQAQL 546          

HSP 4 Score: 25.0238 bits (53), Expect = 5.755e-17
Identity = 13/43 (30.23%), Postives = 21/43 (48.84%), Query Frame = 2
Query:  515 WITIKEEYPY-------DFYCSSSIYLCKISFST*VLIKNDKR 622
            W+   +E+P             S+ YLC+ISFS+ + +K   R
Sbjct:  472 WLDTAKEFPLLANKAILTLLPFSTTYLCEISFSSMIAMKTKYR 514          

HSP 5 Score: 24.2534 bits (51), Expect = 5.755e-17
Identity = 12/21 (57.14%), Postives = 16/21 (76.19%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFL 67
            LS GKVL R++ELR ++  FL
Sbjct:  291 LSRGKVLVRVYELREELKVFL 311          
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Match: A0A2S2PVY5 (SCAN domain-containing protein 3 OS=Sipha flava OX=143950 GN=SCAND3_21 PE=4 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.551e-16
Identity = 28/86 (32.56%), Postives = 49/86 (56.98%), Query Frame = 3
Query:  225 KKNLQ*GSLEMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENSVEALSLLKSRGICGIKGCR 482
            K++++  SL+MF  T  I   +  I   L   HLT L+     +FP I+  +Y+W++NP+A+ +E++ + LSL K   +  I+  R
Sbjct:  458 KRHVENKSLKMFPLTFDID-PQGDITTQLVLNHLTDLEDSMAQYFPHISVEKYDWVRNPYATSSESTAD-LSLEKEEQLAEIQEDR 541          

HSP 2 Score: 44.669 bits (104), Expect = 1.551e-16
Identity = 21/39 (53.85%), Postives = 26/39 (66.67%), Query Frame = 1
Query:  115 VKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKK 231
             K+ Y+ DIF HLN LN+ MQ + EN+LT  DKL G  K
Sbjct:  414 AKVAYLADIFYHLNCLNESMQGKEENVLTSSDKLKGFLK 452          

HSP 3 Score: 30.8018 bits (68), Expect = 1.551e-16
Identity = 12/31 (38.71%), Postives = 20/31 (64.52%), Query Frame = 1
Query:  634 GLDQELHVPLSHIEPNIKYLCSLKQTRIPRH 726
             +DQE+ V LS I P I+ LC+ +Q ++  +
Sbjct:  603 SVDQEMRVCLSSIRPRIELLCTKRQAQVSHY 633          

HSP 4 Score: 26.1794 bits (56), Expect = 1.551e-16
Identity = 16/43 (37.21%), Postives = 21/43 (48.84%), Query Frame = 2
Query:  515 WITIKEEYPYDFYCS-------SSIYLCKISFST*VLIKNDKR 622
            W+  K EYP     +       S+ YLC++ FS    IKN KR
Sbjct:  556 WMYAKTEYPVIAVEAINILLHFSTTYLCELGFSALTNIKNKKR 598          

HSP 5 Score: 23.483 bits (49), Expect = 1.551e-16
Identity = 10/20 (50.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEF 64
            LS GKVL R +EL+ ++S+ 
Sbjct:  376 LSKGKVLQRFYELKNELSKL 395          
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Match: A0A177B1V0 (Uncharacterized protein (Fragment) OS=Intoshia linei OX=1819745 GN=A3Q56_04665 PE=4 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.040e-15
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = 1
Query:   76 SELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKK 231
            SE   L EN    +KL Y++DIF+H N +N  MQ + EN+LT +D+++ LK+
Sbjct:   18 SEFSILIENQLWCIKLAYLSDIFDHFNRVNASMQEKEENILTLVDRIHSLKE 69          

HSP 2 Score: 48.9062 bits (115), Expect = 1.040e-15
Identity = 27/64 (42.19%), Postives = 34/64 (53.12%), Query Frame = 3
Query:  291 KQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENSVEALSLLKSRGICGIKGCR 482
            K  I  L   HLT LQ K  H+FP INT  Y+W+ NPF S  +N+    SL++      IK  R
Sbjct:  102 KYSITSLIVNHLTDLQGKLHHYFPNINTKDYDWMINPFISIPKNA----SLIEEEEFIDIKNDR 161          

HSP 3 Score: 29.261 bits (64), Expect = 1.040e-15
Identity = 14/27 (51.85%), Postives = 18/27 (66.67%), Query Frame = 1
Query:  637 LDQELHVPLSHIEPNIKYLCSLKQTRI 717
            LD EL   L+ I  NIK +CS KQ++I
Sbjct:  224 LDDELRGSLTQIPLNIKRICSSKQSKI 250          

HSP 4 Score: 23.0978 bits (48), Expect = 1.040e-15
Identity = 11/20 (55.00%), Postives = 16/20 (80.00%), Query Frame = 2
Query:  560 SSIYLCKISFST*VLIKNDK 619
            S+ Y+C+ISFS  +LIK+ K
Sbjct:  198 STTYICEISFSAMLLIKSYK 217          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000034374.1 (pep primary_assembly:ASM223467v1:1:33902242:33903496:-1 gene:ENSORLG00000022072.1 transcript:ENSORLT00000034374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 40.817 bits (94), Expect = 1.317e-11
Identity = 17/58 (29.31%), Postives = 36/58 (62.07%), Query Frame = 3
Query:  243 GSLEMFQKTHQ-IKIEKKQ-IILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFAS 410
            G+++ F+     I++ K Q  ++     H++ LQ+ F+ +FP  +  QY+WI++PF++
Sbjct:  247 GTIDSFENLKSFIEVNKLQNTVIPCMNAHISALQKHFQRYFPVQDPTQYDWIRDPFSA 304          

HSP 2 Score: 38.1206 bits (87), Expect = 1.317e-11
Identity = 18/46 (39.13%), Postives = 29/46 (63.04%), Query Frame = 1
Query:   94 FENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKK 231
            F N+  ++KL Y++D+F+ LNELN +MQ  N +L    DK+    +
Sbjct:  190 FNNNKFLMKLAYLSDMFQKLNELNLQMQGSNTHLPHLADKITSFTR 235          

HSP 3 Score: 29.261 bits (64), Expect = 1.317e-11
Identity = 14/26 (53.85%), Postives = 20/26 (76.92%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFLKKCPN 82
            LSLGKV +R+FELR ++  FL++  N
Sbjct:  159 LSLGKVSSRVFELRDEIRIFLEEEEN 184          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 37.3502 bits (85), Expect = 1.293e-9
Identity = 16/46 (34.78%), Postives = 30/46 (65.22%), Query Frame = 1
Query:   94 FENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKK 231
            F + + + KL Y++DIF  LNELN ++Q ++++L    DK++   +
Sbjct:  387 FSDENFLAKLAYLSDIFGKLNELNLQLQGKDKHLPQVTDKISSFTR 432          

HSP 2 Score: 35.8094 bits (81), Expect = 1.293e-9
Identity = 14/37 (37.84%), Postives = 26/37 (70.27%), Query Frame = 3
Query:  315 QEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENS 425
            +EH++ L   F+ +FP  N++QY+W+++PF + A  S
Sbjct:  471 KEHISSLIGFFKKYFPE-NSSQYDWVRDPFNAPAPTS 506          

HSP 3 Score: 28.1054 bits (61), Expect = 1.293e-9
Identity = 13/23 (56.52%), Postives = 19/23 (82.61%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFLKK 73
            LS GKVL+R+FELR ++  FL++
Sbjct:  355 LSRGKVLSRVFELREQIRMFLEQ 377          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 37.3502 bits (85), Expect = 1.293e-9
Identity = 16/46 (34.78%), Postives = 30/46 (65.22%), Query Frame = 1
Query:   94 FENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKK 231
            F + + + KL Y++DIF  LNELN ++Q ++++L    DK++   +
Sbjct:  387 FSDENFLAKLAYLSDIFGKLNELNLQLQGKDKHLPQVTDKISSFTR 432          

HSP 2 Score: 35.8094 bits (81), Expect = 1.293e-9
Identity = 14/37 (37.84%), Postives = 26/37 (70.27%), Query Frame = 3
Query:  315 QEHLTLLQQKFEHHFPTINTNQYNWIQNPFASDAENS 425
            +EH++ L   F+ +FP  N++QY+W+++PF + A  S
Sbjct:  471 KEHISSLIGFFKKYFPE-NSSQYDWVRDPFNAPAPTS 506          

HSP 3 Score: 27.7202 bits (60), Expect = 1.293e-9
Identity = 13/23 (56.52%), Postives = 19/23 (82.61%), Query Frame = 2
Query:    5 LSLGKVLARLFELRCKVSEFLKK 73
            LS GKVL+R+FELR ++  FL++
Sbjct:  355 LSRGKVLSRVFELREQIRMFLEQ 377          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 1.424e-9
Identity = 22/60 (36.67%), Postives = 33/60 (55.00%), Query Frame = 1
Query:   61 VSKKMSELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKKTYS 240
            ++ K S L   + N   + KL Y++DIF  LN+LN  +Q RN N+    DK+   +K  S
Sbjct:  358 LTDKKSPLAHHYTNATFIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVQAFQKKLS 417          

HSP 2 Score: 33.113 bits (74), Expect = 1.424e-9
Identity = 23/70 (32.86%), Postives = 33/70 (47.14%), Query Frame = 3
Query:  249 LEMFQKTHQIKIEKKQI-ILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASD-AENSVEALSLLKS 452
            L+MF     I     Q+ I     +HL+ L  KF  +FP      + W+ +PF+ D  EN V   S L+S
Sbjct:  428 LDMFPLLSDILESSPQVKISHSVSQHLSHLANKFAEYFPEDPREGHMWVVDPFSVDPTENDVALPSHLES 497          

HSP 3 Score: 24.2534 bits (51), Expect = 1.424e-9
Identity = 14/44 (31.82%), Postives = 20/44 (45.45%), Query Frame = 2
Query:  515 WITIKEEYPYDFYCS-------SSIYLCKISFST*VLIKNDKRS 625
            WI + +EYP     +       ++ YLC+  FST    K   RS
Sbjct:  521 WIVVSKEYPLLALRAFKVLLPFTTTYLCESGFSTVATTKTKARS 564          
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Match: ENSORLT00000030244.1 (pep primary_assembly:ASM223467v1:13:28104458:28106771:-1 gene:ENSORLG00000022768.1 transcript:ENSORLT00000030244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 42.743 bits (99), Expect = 1.434e-9
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 1
Query:   61 VSKKMSELH*LFENHHSVVKLEYMTDIFEHLNELNKKMQSRNENLLTCLDKLNGLKKTYS 240
            ++ K S L   + N   + KL Y++DIF  LN+LN  +Q RN N+    DK+   ++  S
Sbjct:  229 LTDKKSPLAHHYTNATFIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVQAFQRKLS 288          

HSP 2 Score: 33.8834 bits (76), Expect = 1.434e-9
Identity = 20/68 (29.41%), Postives = 34/68 (50.00%), Query Frame = 3
Query:  252 EMFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPFASD-AENSVEALSLLKS 452
            ++ + + Q+KI           +HL+ L +KF  +FP      + W+ +PF+ D  EN V   S L+S
Sbjct:  307 DILESSPQVKISHS------VSQHLSQLAEKFAEYFPEDPREGHMWVVDPFSVDPTENDVALPSHLES 368          

HSP 3 Score: 24.2534 bits (51), Expect = 1.434e-9
Identity = 14/44 (31.82%), Postives = 20/44 (45.45%), Query Frame = 2
Query:  515 WITIKEEYPYDFYCS-------SSIYLCKISFST*VLIKNDKRS 625
            WI + +EYP     +       ++ YLC+  FST    K   RS
Sbjct:  392 WIVVSKEYPLLALRAVKVLLPFTTTYLCESGFSTVATTKTKARS 435          
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000005606.1 (SMESG000005606.1)

HSP 1 Score: 341.658 bits (875), Expect = 3.792e-117
Identity = 170/189 (89.95%), Postives = 172/189 (91.01%), Query Frame = -1
Query:  708 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL-----------VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTSTHLNQFNKKSQLDLSIGVLPQLRCLGILV 1241
            MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL            LSTLKSQVGII HIVSPQAAQFDKS+AGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDE H FLFDGLVLGYLM ALGSGHSEQSNGKAWTNSDANILIL+QVTSTHLNQFNKKSQLDLSIGVLPQLRCL ILV
Sbjct:    1 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDLNPVTGVQFSREALSTLKSQVGIISHIVSPQAAQFDKSKAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDENHKFLFDGLVLGYLMAALGSGHSEQSNGKAWTNSDANILILNQVTSTHLNQFNKKSQLDLSIGVLPQLRCLCILV 189          
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000081329.1 (SMESG000081329.1)

HSP 1 Score: 340.117 bits (871), Expect = 1.347e-116
Identity = 169/189 (89.42%), Postives = 171/189 (90.48%), Query Frame = -1
Query:  708 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL-----------VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTSTHLNQFNKKSQLDLSIGVLPQLRCLGILV 1241
            MLLICSISNEIPEVPVLNRFSGHAYE RLIDEYL TSDL            LSTLKSQVGII HIVSPQAAQFDK EAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEY+NFLFDGLVLGYLM ALGSGHSEQSNGKAWTNSDANILIL+QVTSTHLNQFNKKSQLDLSIGVLPQLRCL ILV
Sbjct:    1 MLLICSISNEIPEVPVLNRFSGHAYESRLIDEYLKTSDLNPVTGVQFSREALSTLKSQVGIISHIVSPQAAQFDKCEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYNNFLFDGLVLGYLMAALGSGHSEQSNGKAWTNSDANILILNQVTSTHLNQFNKKSQLDLSIGVLPQLRCLCILV 189          
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000033959.1 (SMESG000033959.1)

HSP 1 Score: 344.739 bits (883), Expect = 1.647e-116
Identity = 176/214 (82.24%), Postives = 178/214 (83.18%), Query Frame = -1
Query:  669 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL-----------VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTSTHLNQFNKKSQLDLSIGVLPQLRCLGILVCF------------SEHKYFIFGSI 1241
            M LICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL           VLSTLKSQVGII HIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIP NIQEC+MDEYHNFLFDGLVLGYLM ALGSGHSEQSNGKAWTNSDANILI +QVTSTHLNQFNKKSQLDLSIGVL QLRCL ILV              SE K F  GSI
Sbjct:    1 MSLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDLNPVTGIQFSREVLSTLKSQVGIISHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPINIQECAMDEYHNFLFDGLVLGYLMAALGSGHSEQSNGKAWTNSDANILIFNQVTSTHLNQFNKKSQLDLSIGVLQQLRCLDILVGLINKLIKKMMEFTSEFKLFRKGSI 214          
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000078035.1 (SMESG000078035.1)

HSP 1 Score: 338.961 bits (868), Expect = 4.187e-116
Identity = 169/189 (89.42%), Postives = 171/189 (90.48%), Query Frame = -1
Query:  708 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL-----------VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTSTHLNQFNKKSQLDLSIGVLPQLRCLGILV 1241
            MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL           VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKT LDKIPTNIQECSM+EYHNFLFDGLVLGYLM ALGSGHSE SNGKAWTNSDANILILSQVT THLNQFNKKSQLDLSI V PQLRCL IL+
Sbjct:    1 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDLNPVTGIQFSREVLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTTLDKIPTNIQECSMNEYHNFLFDGLVLGYLMAALGSGHSEPSNGKAWTNSDANILILSQVTLTHLNQFNKKSQLDLSIWVRPQLRCLCILL 189          
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000057582.1 (SMESG000057582.1)

HSP 1 Score: 340.117 bits (871), Expect = 7.917e-109
Identity = 167/189 (88.36%), Postives = 172/189 (91.01%), Query Frame = -1
Query:  708 MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDL-----------VLSTLKSQVGIIFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECSMDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTSTHLNQFNKKSQLDLSIGVLPQLRCLGILV 1241
            MLL+CSISNEIP +PVLNRFSGHAYERRLI+EYLTTSDL           VLSTLKSQVGII HIVSPQAAQFDKSEAGKTLRWMDMLNATVPSR KTALDKIPTNIQ+CSMDEYHNFLFDGLVLGYLM ALGSGHSEQSNGKAWTNSDANILILS+VTSTHLNQFNKKSQLDLSIGV PQLRCL ILV
Sbjct:    1 MLLVCSISNEIPGIPVLNRFSGHAYERRLIEEYLTTSDLNPVTGIQFSREVLSTLKSQVGIISHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRTKTALDKIPTNIQKCSMDEYHNFLFDGLVLGYLMAALGSGHSEQSNGKAWTNSDANILILSRVTSTHLNQFNKKSQLDLSIGVRPQLRCLCILV 189          
The following BLAST results are available for this feature:
BLAST of SCAN domain-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PRPF191.221e-661.76pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
PRPF192.733e-661.76pre-mRNA processing factor 19 [Source:HGNC Symbol;... [more]
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zbed55.577e-839.58zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Prpf191.812e-661.76pre-mRNA processing factor 19 [Source:MGI Symbol;A... [more]
Prpf191.818e-661.76pre-mRNA processing factor 19 [Source:MGI Symbol;A... [more]
back to top
BLAST of SCAN domain-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q4R6P1|F200A_MACFA3.126e-644.64Protein FAM200A OS=Macaca fascicularis OX=9541 GN=... [more]
back to top
BLAST of SCAN domain-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L7QQ453.426e-4968.49SCAN domain-containing protein 3 OS=Habropoda labo... [more]
A0A0L7QW418.981e-3765.75SCAN domain-containing protein 3 (Fragment) OS=Hab... [more]
A0A087U6M35.755e-1763.16SCAN domain-containing protein 3 (Fragment) OS=Ste... [more]
A0A2S2PVY51.551e-1632.56SCAN domain-containing protein 3 OS=Sipha flava OX... [more]
A0A177B1V01.040e-1544.23Uncharacterized protein (Fragment) OS=Intoshia lin... [more]
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCAN domain-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034374.11.317e-1129.31pep primary_assembly:ASM223467v1:1:33902242:339034... [more]
ENSORLT00000040389.11.293e-934.78pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000035512.11.293e-934.78pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000032459.11.424e-936.67pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000030244.11.434e-935.00pep primary_assembly:ASM223467v1:13:28104458:28106... [more]
back to top
BLAST of SCAN domain-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005606.13.792e-11789.95SMESG000005606.1[more]
SMESG000081329.11.347e-11689.42SMESG000081329.1[more]
SMESG000033959.11.647e-11682.24SMESG000033959.1[more]
SMESG000078035.14.187e-11689.42SMESG000078035.1[more]
SMESG000057582.17.917e-10988.36SMESG000057582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30002410 ID=SMED30002410|Name=SCAN domain-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1337bp
CTAGCTGTCACTTGGAAAGGTTCTGGCTAGATTATTTGAACTACGATGCA
AGGTTAGTGAGTTTCTAAAAAAATGTCCGAACTACACTAGCTCTTTGAAA
ATCATCATTCGGTGGTCAAACTTGAGTATATGACAGATATTTTCGAGCAT
CTGAACGAACTCAATAAAAAAATGCAAAGTAGAAATGAAAATTTATTGAC
GTGTTTAGATAAATTAAACGGGTTAAAAAAAACTTACAGTGAGGATCACT
AGAAATGTTTCAAAAGACCCATCAGATCAAGATCGAGAAGAAGCAAATAA
TTTTGGATTTGGCTCAAGAACATTTAACATTACTGCAACAAAAATTTGAG
CACCACTTTCCTACAATAAATACTAATCAATATAATTGGATTCAAAATCC
TTTTGCAAGTGATGCCGAAAATTCTGTTGAAGCACTTTCTCTCTTAAAAT
CGAGAGGGATTTGTGGAATTAAGGGCTGTCGGGACTCTGAAACTGAAGTT
CAACGAATTTTCATTGGATTACAATTAAGGAGGAATATCCATACGATTTC
TACTGTTCCTCTTCCATTTACTTATGTAAAATAAGTTTTTCAACTTAAGT
TTTAATAAAAAATGATAAGAGGTCATGCTAAATGGCCTTGACCAAGAACT
TCATGTTCCACTTTCACATATCGAACCGAATATAAAATATTTGTGTTCAC
TGAAGCAAACGAGGATACCGAGACATCGCAGCTGTGGAAGAACCCCGATC
GACAGATCCAATTGTGATTTTTTATTGAATTGATTCAGATGGGTTGATGT
TACTTGACTGAGGATGAGAATGTTTGCGTCAGAATTTGTCCAGGCTTTTC
CATTTGATTGTTCACTATGACCTGAACCCAACGCTGTCATCAAATATCCC
AAAACTAGACCATCAAACAGAAAGTTATGATATTCATCCATAGAGCATTC
TTGAATATTTGTTGGGATTTTATCAAGTGCAGTTTTAATACGACTTGGAA
CTGTAGCATTTAACATATCCATCCAACGAAGAGTTTTTCCTGCTTCACTT
TTATCGAATTGTGCAGCTTGAGGAGAAACAATATGAAATATAATTCCAAC
TTGTGATTTAAGAGTAGACAAAACTAAATCACTGGTTGTTAAGTATTCAT
CAATTAACCTTCTTTCATAAGCATGCCCTGAAAATCTATTAAGAACTGGA
ACTTCAGGAATTTCATTAGAAATCGAACATATTAACAACATTTTTGAACG
GTTTAAAGTCAAAATTTATTTTTCAAATTACAAAATTCTTTCTTAAATTA
CACATTAATTGATACTCACAAAATTAAAATTTCAATT
back to top

protein sequence of SMED30002410-orf-1

>SMED30002410-orf-1 ID=SMED30002410-orf-1|Name=SMED30002410-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MFQKTHQIKIEKKQIILDLAQEHLTLLQQKFEHHFPTINTNQYNWIQNPF
ASDAENSVEALSLLKSRGICGIKGCRDSETEVQRIFIGLQLRRNIHTIST
VPLPFTYVK*
back to top

protein sequence of SMED30002410-orf-2

>SMED30002410-orf-2 ID=SMED30002410-orf-2|Name=SMED30002410-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=197bp
MLLICSISNEIPEVPVLNRFSGHAYERRLIDEYLTTSDLVLSTLKSQVGI
IFHIVSPQAAQFDKSEAGKTLRWMDMLNATVPSRIKTALDKIPTNIQECS
MDEYHNFLFDGLVLGYLMTALGSGHSEQSNGKAWTNSDANILILSQVTST
HLNQFNKKSQLDLSIGVLPQLRCLGILVCFSEHKYFIFGSICESGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity